3Q80A

Structure of mtb 2-c-methyl-d-erythritol 4-phosphate cytidyltransferase (ispd) complexed with cdp-me
Total Genus 67
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
67
sequence length
226
structure length
218
Chain Sequence
GEVVAIVPAAGSGERLAVGVPKAFYQLDGQTLIERAVDGLLDSGVVDTVVVAVPADRTDEARQILGHRAMIVAGGSNRTDTVNLALTVLSEPEFVLVHDAARALTPPALVARVVEALRDGYAAVVPVLPLSDTIKAVDANGVVLGTPERAGLRAVQTPQGFTTDLLLRSYQRGSLEYTDDASLVEHIGGQVQVVDGDPLAFKITTKLDLLLAQAIVRG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords 2-C-methyl-D-erythritol 4-phosphate cytidyltransferase
publication title Crystal Structure of Mycobacterium tuberculosis 2-C-methyl-D-erythritol 4-phosphate cytidyltransferase (IspD): a candidate antitubercular drug target
rcsb
source organism Mycobacterium tuberculosis
total genus 67
structure length 218
sequence length 226
chains with identical sequence B
ec nomenclature ec 2.7.7.60: 2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase.
pdb deposition date 2011-01-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01128 IspD 2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.550.10 Alpha Beta Alpha-Beta Complex Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A 3q80A00
2X60A 2ZU7A 4M4KA 3CGXA 4B4BA 1R7VA 3R2WA 4AYLA 5CQNX 2YQSA 1ZI1A 1EZIA 1H7HA 5C49A 4D11C 4Y62A 4E1KA 1YP2A 3PNNA 3OKRA 2ZU9A 5FTSA 1FO8A 1VH3A 1GX0A 1ZJ2A 2P73A 2V0JA 3SXCA 4FRLA 4B42A 4D11A 2I7BA 4KPXA 1H4CA 3V90A 1G95A 5EIYA 3FOQA 5I1FA 3SXGA 3ZLKA 5C48A 5CMGX 5EJ1A 3CKVA 1H7EA 2P6WA 2VS5A 3I0KA 4HCQA 1ZCTA 2Z87A 1ZJOA 3OGZA 3BCVA 1QGSA 3OH1A 5FTVA 1WT1A 5DDVA 1G1LA 1FOAA 1I52A 1VZUA 2XWNA 1G93A 1LVWA 3K8DA 1WT3A 1W77A 4L41C 5IDSA 2ZU8A 1VGTA 1FO9A 1R7UA 1VZTA 2AGDA 3CKQA 2FFUA 1G23A 2AM4A 4CVHA 1H4DA 5AJNA 2RIYA 3U2WA 3V0MA 2Y4MA 5C1GA 2QH5A 5FUHA 2VSHA 2APCA 1FR8A 1ZDGA 3U2UA 3POLA 1YP3A 4M2AA 2XWLA 1NQIB 2VSIA 3LW6A 1ZIZA 3FWWA 2O1FA 3RSBA 3ZGFA 2AE7A 5IDTA 4KXOA 2V0IA 1FXJA 3CKJA 4BQHA 2WVLA 4HO6A 1GWWA 5C38A 2OI6A 4EEGA 4EEAA 4B3UA 2BO6A 3HL3A 1R81A 3V0OA 4HOCA 5FV9A 1VGZA 1FG5N 5C1HA 4Y9XA 2AH9A 5C4CA 1ZJPA 5L6VA 1K4VA 4XWIA 3RMWA 2FY7A 4NAKA 1TW1A 3I0HA 3OH2A 5C3DA 2JCKA 3V8ZA 1OMZA 3RMVA 1E5KA 1ON8A 1INJA 1ZJ1A 1XHBA 2YC3A 4LW3A 5FYEA 1G2VA 4Y7FA 2PA4A 1S4PA 2JCOA 5CMIA 4R7PA 3PKPA 4ASJA 1NHEB 1H7TA 1H3MA 2YQHA 1S4NA 4FQWA 4KC2A 1IIMA 2WEEA 4KC1A 2FYBA 1XZ6A 2AECA 3I0LA 5CQMX 1O23B 3SX8A 1H5RA 2PGYA 3TQDA 5BXCA 2AESA 3Q7UA 1H5TA 1ZHJA 3CU0A 3F1YA 1ZCUA 3IOHA 4IRQA 2PX7A 1W57A 2CU2A 3D8VA 3E26A 4FCEA 2VD4A 1OQMB 2JCLA 3I0FA 2OI7A 4Y7TA 4DDZA 2O1GA 1ZI4A 2WAWA 1QGQA 4HO4A 3I0GA 1WT2A 4DECA 3I0JA 1H5SC 1HJJA 1FWYA 1O0RA 1H7LA 5C1LA 1WSZA 1WT0A 2MZBA 2P72A 4EEOA 2Y4JA 4ARWA 1V84A 3V0NA 3U2XA 3JTJA 4D0ZA 4AAWA 3V0PA 1H5SA 4MYBA 2Y4LA 3ZF8A 2VS3A 4J18A 3TZTA 1NKHB 3EE5A 5CMFX 1FGXA 2W0VA 2Z86A 1VPAA 5IFYA 2WVMA 1TW5A 3D5NA 4EE4A 2OI5A 4FRAA 2ICYA 2Y7AA 2RITA 2RJ8A 2A8UA 4ASYA 2OEFA 1G3LA 5AJOA 2RJ1A 2X5ZA 4Y7UA 4G3PA 1JYLA 1MP5A 4B2XA 4HG6A 4YS8A 3D98A 4B5BA 1NF5B 5C3AA 1O7QA 1GWVA 2X5SA 3U0YA 1ZJ0A 2YQJA 1V83A 1W55A 1FXOA 2BO7A 3SXEA 4FROA 4EVWA 1YP4A 3SXDA 1LZIA 1OMXA 5CQPA 2D7IA 2WVKA 3GUEA 5C47A 5EJZA 1H5SD 1VGWA 1MC3A 2Y4KA 4P02A 4JD0A 4CJ8A 4ECMA 1PZYB 1FRWA 1Z90A 2Y6PA 2RJ9A 1NMMB 4M28A 3F1CA 3JUKA 1R7XA 5HS2A 3CKNA 1SS9A 4B2WA 2AM3A 4FRQA 1HM0A 2GGOA 3PKQA 1VICA 3SX7A 2JCJA 5CMHA 1NWGB 2DPWA 5FU8A 2NXVA 1QG8A 4G3QA 3IOJA 1PZTA 3I0IX 4KNXA 4FRDA 2RJ0A 3NGWA 2FYCB 3Q80A 4LW6A 2O1HA 1HM8A 2RJ6A 4CJCA 1YROB 3OH0A 1FGGA 2PGVA 4NALA 1LL2A 2I5KA 1R80A 4FRBA 1ON6A 3U2TA 3OH3A 4KC4A 4Y6NA 4UEGA 1G9RA 4HO0A 5CQLX 4Y63A 5DDTA 4EEMA 1V82A 3QVBA 1WVCA 1H7FA 1QWJA 1EYRA 1ZDFA 1KWSA 2YC5A 2QKXA 4Y6UA 4AC3A 4FRPA 3KIAA 4P00A 3T7MA 4Y7GA 5C4DA 2BO4A 1MP3A 4DE7A 4HO3A 5CMJA 3U0XA 1R82A 4MNDA 3SX5A 1VGUA 2YESA 4D0TA 1R7YA 2V0HA 4G87A 3DUVA 3T7OA 2RIXA 3ST8A 1H5RB 2WGZA 4C2SA 4EE3A 2VXLA 1ZJ3A 2UX8A 1H5TB 3ZLLA 3V0LA 4EE5A 3V8YA 4ZDQA 3USRA 1JVDA 1FZWA 1R7TA 2D7RA 3I0CA 2Q4JA 3V91A 5AJPA 3I0DA 3IOIA 5JQQA 4B4GA 2GGQA 1IINA 4HO8A 1LL3A 2VFZA 3N9WA 4K6RA 1JV3A 1LZ7A 3K8EA 4GBPA 3JUJA 3OH4A 2RJ5A 1S4OA 1ZI5A 2RIZA 1HJLA 1VH1A 1TZFA 1GX4A 2E3DA 3SPTA 3SXBA 1H5SB 3E25A 1GQ9A 2D0JA 4M2BA 4NAIA 1H7GA 2XMHA 3BRKX 4KRVA 3DK5A 3USQA 3V0QA 2X65A 4FREA 4HO2A 4Y7VA 4FRMA 5C4EA 5J49A 2RJ7A 3OC9A 3Q4SA 3SX3A 1JVGA 1ZI3A 2YCMA 5C3BA 1ZCVA 4BMAA 1LL0A 2FYDB 5C36A 4KPZA 1G8OA 1MP4A 4JISA 1JV1A 1H4EA 2FFVA 2W0WA 2AM5A 2I5EA 2YQCA 5C4FA 1O7OA 3OAMA 2RJ4A 3I0EA 5C8RA 5CQOA 4Y64A 1LZJA 1LZ0A 2XWMA 4IRPA 2OEGA 2VS4A 4FRHA 2XMEA 2A8WA 2V0KA 1GQCA 1INIA 1ZCYA 5L6SA 1JYKA 5FU0A 4D48A 1GA8A 4KT7A 1FR9A 3R3IA 4HO5A 3T7NA 4AYJA 3O3PA 2V0LA 3DJ4A 1VZXA 1G97A 2VXMA 3CKOA 1TVYA 3ZGGA 4NANA 2ICXA 3U2VA 4CJBA 2WE9A 1HV9A 4HO9A 1VM8A 2E8BA 4KQLA 4B4MA 3SXAA 2FYAA 1HM9A 4FCUA 4KNRA 1H7QA 1G0RA 2QGIA 5C4BA 2BO8A 4G3SA
chains in the Genus database with same CATH superfamily
2X60A 2ZU7A 4M4KA 3CGXA 4B4BA 1R7VA 3R2WA 4AYLA 4FIXA 5CQNX 2YQSA 1ZI1A 1EZIA 1H7HA 5C49A 4D11C 4Y62A 4E1KA 1YP2A 3PNNA 3OKRA 2ZU9A 5FTSA 1FO8A 1VH3A 1GX0A 1ZJ2A 2P73A 2V0JA 3SXCA 4FRLA 4B42A 4D11A 2I7BA 4KPXA 1H4CA 3V90A 1G95A 5EIYA 3FOQA 5I1FA 3SXGA 3ZLKA 5C48A 5CMGX 5EJ1A 3CKVA 1H7EA 2P6WA 2VS5A 3I0KA 4HCQA 1ZCTA 2Z87A 1ZJOA 3OGZA 3BCVA 1QGSA 3OH1A 5FTVA 1WT1A 5DDVA 1G1LA 1FOAA 1I52A 1VZUA 2XWNA 5D92A 1G93A 1LVWA 3K8DA 1WT3A 1W77A 4L41C 5IDSA 2ZU8A 1VGTA 1FO9A 1R7UA 1VZTA 2AGDA 3CKQA 2FFUA 4O6NA 1G23A 2AM4A 4CVHA 1H4DA 5AJNA 2RIYA 3U2WA 3V0MA 2Y4MA 5C1GA 2QH5A 5FUHA 2VSHA 2APCA 1FR8A 1ZDGA 3U2UA 3POLA 1YP3A 4M2AA 2XWLA 1NQIB 2VSIA 3LW6A 1ZIZA 3FWWA 2O1FA 3RSBA 3ZGFA 2AE7A 5IDTA 4KXOA 2V0IA 1FXJA 3CKJA 4BQHA 2WVLA 4HO6A 1GWWA 5C38A 2OI6A 4EEGA 4EEAA 4B3UA 2BO6A 3HL3A 1R81A 3V0OA 4HOCA 5FV9A 1VGZA 1FG5N 5C1HA 4Y9XA 2AH9A 5C4CA 1ZJPA 5L6VA 1K4VA 4XWIA 3RMWA 2FY7A 4NAKA 1TW1A 3I0HA 3OH2A 5C3DA 2JCKA 3V8ZA 1OMZA 3RMVA 1E5KA 1ON8A 1INJA 1ZJ1A 1XHBA 2YC3A 2C0NA 4LW3A 5FYEA 1G2VA 2VK9A 4Y7FA 2PA4A 1S4PA 2JCOA 5CMIA 4R7PA 3PKPA 4ASJA 1NHEB 1H7TA 1H3MA 2YQHA 1S4NA 4FQWA 4KC2A 1IIMA 2WEEA 4KC1A 2FYBA 1XZ6A 2AECA 3I0LA 5CQMX 1O23B 3SX8A 1H5RA 2PGYA 3TQDA 5BXCA 2AESA 3Q7UA 1H5TA 1ZHJA 3CU0A 3F1YA 1ZCUA 3IOHA 4IRQA 2PX7A 1W57A 2J0AA 2CU2A 3D8VA 3E26A 4FCEA 2VD4A 1OQMB 2JCLA 3I0FA 2OI7A 4Y7TA 4DDZA 2O1GA 1ZI4A 2WAWA 1QGQA 4HO4A 3I0GA 1WT2A 4DECA 3I0JA 1H5SC 1HJJA 1FWYA 1O0RA 1H7LA 5C1LA 1WSZA 1WT0A 2MZBA 2P72A 4EEOA 2Y4JA 4ARWA 1V84A 3V0NA 3U2XA 3JTJA 4D0ZA 4AAWA 3V0PA 1H5SA 4MYBA 2Y4LA 3ZF8A 2VS3A 4J18A 3TZTA 1NKHB 3EE5A 5CMFX 1FGXA 2W0VA 2Z86A 1VPAA 5IFYA 2WVMA 1TW5A 3D5NA 4EE4A 2OI5A 4FRAA 2ICYA 2Y7AA 2RITA 2RJ8A 2A8UA 4ASYA 2OEFA 1G3LA 5AJOA 2RJ1A 2X5ZA 4Y7UA 4G3PA 1JYLA 1MP5A 4B2XA 4HG6A 4YS8A 3D98A 4B5BA 1NF5B 5C3AA 1O7QA 1GWVA 2X5SA 3U0YA 1ZJ0A 2YQJA 1V83A 1W55A 4O6MA 1FXOA 2BO7A 3SXEA 4FROA 4EVWA 4MIXA 1YP4A 3SXDA 1LZIA 1OMXA 5CQPA 2D7IA 2WVKA 3GUEA 5C47A 5EJZA 1H5SD 1VGWA 1MC3A 2Y4KA 4P02A 4JD0A 4CJ8A 4ECMA 1PZYB 1FRWA 1Z90A 2Y6PA 2RJ9A 1NMMB 4M28A 3F1CA 3JUKA 1R7XA 5HS2A 3CKNA 1SS9A 4B2WA 2AM3A 4FRQA 1HM0A 2GGOA 3PKQA 1VICA 3SX7A 2JCJA 5CMHA 1NWGB 2DPWA 5FU8A 2NXVA 1QG8A 4G3QA 3IOJA 1PZTA 3I0IX 4KNXA 4FRDA 2RJ0A 3NGWA 2FYCB 3Q80A 4LW6A 2O1HA 1HM8A 2RJ6A 4CJCA 1YROB 3OH0A 1FGGA 2PGVA 4NALA 1LL2A 2I5KA 1R80A 4FRBA 1ON6A 3U2TA 3OH3A 4KC4A 4Y6NA 4UEGA 1G9RA 4HO0A 5CQLX 4Y63A 5DDTA 4EEMA 1V82A 3QVBA 1WVCA 1H7FA 1QWJA 1EYRA 1ZDFA 1KWSA 2YC5A 2QKXA 4Y6UA 4AC3A 4FRPA 3KIAA 4FIYA 4P00A 3T7MA 4Y7GA 5C4DA 2BO4A 1MP3A 4DE7A 4HO3A 5CMJA 3U0XA 4Q7CA 1R82A 4MNDA 3SX5A 1VGUA 2YESA 4D0TA 1R7YA 2V0HA 4G87A 3DUVA 3T7OA 2RIXA 3ST8A 1H5RB 2WGZA 4C2SA 4EE3A 2VXLA 1ZJ3A 2UX8A 1H5TB 3ZLLA 3V0LA 4EE5A 3V8YA 4ZDQA 3USRA 1JVDA 1FZWA 1R7TA 2D7RA 3I0CA 2Q4JA 3V91A 5AJPA 3I0DA 3IOIA 5JQQA 4B4GA 2GGQA 1IINA 4HO8A 1LL3A 2VFZA 3N9WA 4K6RA 1JV3A 1LZ7A 3K8EA 4GBPA 3JUJA 3OH4A 2RJ5A 1S4OA 1ZI5A 2RIZA 1HJLA 1VH1A 1TZFA 1GX4A 2E3DA 3SPTA 3SXBA 1H5SB 3E25A 1GQ9A 2D0JA 4M2BA 4NAIA 1H7GA 2XMHA 3BRKX 4KRVA 3DK5A 3USQA 3V0QA 2X65A 4FREA 4HO2A 4Y7VA 4FRMA 5C4EA 5J49A 2RJ7A 3OC9A 3Q4SA 3SX3A 1JVGA 1ZI3A 2YCMA 5C3BA 1ZCVA 4BMAA 1LL0A 2FYDB 5C36A 4KPZA 1G8OA 1MP4A 4JISA 1JV1A 1H4EA 2FFVA 2W0WA 2AM5A 2I5EA 2YQCA 5C4FA 1O7OA 3OAMA 2RJ4A 3I0EA 5C8RA 5CQOA 4Y64A 1LZJA 1LZ0A 2XWMA 4IRPA 2OEGA 2VS4A 4FRHA 2XMEA 2A8WA 2V0KA 1GQCA 1INIA 1ZCYA 5L6SA 1JYKA 5FU0A 4D48A 1GA8A 4KT7A 1FR9A 3R3IA 4HO5A 3T7NA 4AYJA 3O3PA 2V0LA 1VZXA 3CKOA 1G97A 2VXMA 3DJ4A 2J0BA 1TVYA 5D91A 3ZGGA 4NANA 2ICXA 3U2VA 4CJBA 2WE9A 1HV9A 4HO9A 1VM8A 2E8BA 4KQLA 4B4MA 3SXAA 2FYAA 1HM9A 4FCUA 4KNRA 1H7QA 1G0RA 2QGIA 5C4BA 2BO8A 4G3SA
chains in the Genus database with same CATH topology
2X60A 2ZU7A 4M4KA 3CGXA 4B4BA 1R7VA 3R2WA 4AYLA 4FIXA 5CQNX 2YQSA 1ZI1A 1EZIA 1H7HA 5C49A 4D11C 4Y62A 4E1KA 1YP2A 3PNNA 3OKRA 2ZU9A 5FTSA 1FO8A 1VH3A 1GX0A 1ZJ2A 2P73A 2V0JA 3SXCA 4FRLA 4B42A 4D11A 2I7BA 4KPXA 1H4CA 3V90A 1G95A 5EIYA 3FOQA 5I1FA 3SXGA 3ZLKA 5C48A 5CMGX 5EJ1A 3CKVA 1H7EA 2P6WA 2VS5A 3I0KA 4HCQA 1ZCTA 2Z87A 1ZJOA 3OGZA 3BCVA 1QGSA 3OH1A 5FTVA 1WT1A 5DDVA 1G1LA 1FOAA 1I52A 1VZUA 2XWNA 5D92A 1G93A 1LVWA 3K8DA 1WT3A 1W77A 4L41C 5IDSA 2ZU8A 1VGTA 1FO9A 1R7UA 1VZTA 2AGDA 3CKQA 2FFUA 4O6NA 1G23A 2AM4A 4CVHA 1H4DA 5AJNA 2RIYA 3U2WA 3V0MA 2Y4MA 5C1GA 2QH5A 5FUHA 2VSHA 2APCA 1FR8A 1ZDGA 3U2UA 3POLA 1YP3A 4M2AA 2XWLA 1NQIB 2VSIA 3LW6A 1ZIZA 3FWWA 2O1FA 3RSBA 3ZGFA 2AE7A 5IDTA 4KXOA 2V0IA 1FXJA 3CKJA 4BQHA 2WVLA 4HO6A 1GWWA 5C38A 2OI6A 4EEGA 4EEAA 4B3UA 2BO6A 3HL3A 1R81A 3V0OA 4HOCA 5FV9A 1VGZA 1FG5N 5C1HA 4Y9XA 2AH9A 5C4CA 1ZJPA 5L6VA 1K4VA 4XWIA 3RMWA 2FY7A 4NAKA 1TW1A 3I0HA 3OH2A 5C3DA 2JCKA 3V8ZA 1OMZA 3RMVA 1E5KA 1ON8A 1INJA 1ZJ1A 1XHBA 2YC3A 2C0NA 4LW3A 5FYEA 1G2VA 2VK9A 4Y7FA 2PA4A 1S4PA 2JCOA 5CMIA 4R7PA 3PKPA 4ASJA 1NHEB 1H7TA 1H3MA 2YQHA 1S4NA 4FQWA 4KC2A 1IIMA 2WEEA 4KC1A 2FYBA 1XZ6A 2AECA 3I0LA 5CQMX 1O23B 3SX8A 1H5RA 2PGYA 3TQDA 5BXCA 2AESA 3Q7UA 1H5TA 1ZHJA 3CU0A 3F1YA 1ZCUA 3IOHA 4IRQA 2PX7A 1W57A 2J0AA 2CU2A 3D8VA 3E26A 4FCEA 2VD4A 1OQMB 2JCLA 3I0FA 2OI7A 4Y7TA 4DDZA 2O1GA 1ZI4A 2WAWA 1QGQA 4HO4A 3I0GA 1WT2A 4DECA 3I0JA 1H5SC 1HJJA 1FWYA 1O0RA 1H7LA 5C1LA 1WSZA 1WT0A 2MZBA 2P72A 4EEOA 2Y4JA 4ARWA 1V84A 3V0NA 3U2XA 3JTJA 4D0ZA 4AAWA 3V0PA 1H5SA 4MYBA 2Y4LA 3ZF8A 2VS3A 4J18A 3TZTA 1NKHB 3EE5A 5CMFX 1FGXA 2W0VA 2Z86A 1VPAA 5IFYA 2WVMA 1TW5A 3D5NA 4EE4A 2OI5A 4FRAA 2ICYA 2Y7AA 2RITA 2RJ8A 2A8UA 4ASYA 2OEFA 1G3LA 5AJOA 2RJ1A 2X5ZA 4Y7UA 4G3PA 1JYLA 1MP5A 4B2XA 4HG6A 4YS8A 3D98A 4B5BA 1NF5B 5C3AA 1O7QA 1GWVA 2X5SA 3U0YA 1ZJ0A 2YQJA 1V83A 1W55A 4O6MA 1FXOA 2BO7A 3SXEA 4FROA 4EVWA 4MIXA 1YP4A 3SXDA 1LZIA 1OMXA 5CQPA 2D7IA 2WVKA 3GUEA 5C47A 5EJZA 1H5SD 1VGWA 1MC3A 2Y4KA 4P02A 4JD0A 4CJ8A 4ECMA 1PZYB 1FRWA 1Z90A 2Y6PA 2RJ9A 1NMMB 4M28A 3F1CA 3JUKA 1R7XA 5HS2A 3CKNA 1SS9A 4B2WA 2AM3A 4FRQA 1HM0A 2GGOA 3PKQA 1VICA 3SX7A 2JCJA 5CMHA 1NWGB 2DPWA 5FU8A 2NXVA 1QG8A 4G3QA 3IOJA 1PZTA 3I0IX 4KNXA 4FRDA 2RJ0A 3NGWA 2FYCB 3Q80A 4LW6A 2O1HA 1HM8A 2RJ6A 4CJCA 1YROB 3OH0A 1FGGA 2PGVA 4NALA 1LL2A 2I5KA 1R80A 4FRBA 1ON6A 3U2TA 3OH3A 4KC4A 4Y6NA 4UEGA 1G9RA 4HO0A 5CQLX 4Y63A 5DDTA 4EEMA 1V82A 3QVBA 1WVCA 1H7FA 1QWJA 1EYRA 1ZDFA 1KWSA 2YC5A 2QKXA 4Y6UA 4AC3A 4FRPA 3KIAA 4FIYA 4P00A 3T7MA 4Y7GA 5C4DA 2BO4A 1MP3A 4DE7A 4HO3A 5CMJA 3U0XA 4Q7CA 1R82A 4MNDA 3SX5A 1VGUA 2YESA 4D0TA 1R7YA 2V0HA 4G87A 3DUVA 3T7OA 2RIXA 3ST8A 1H5RB 2WGZA 4C2SA 4EE3A 2VXLA 1ZJ3A 2UX8A 1H5TB 3ZLLA 3V0LA 4EE5A 3V8YA 4ZDQA 3USRA 1JVDA 1FZWA 1R7TA 2D7RA 3I0CA 2Q4JA 3V91A 5AJPA 3I0DA 3IOIA 5JQQA 4B4GA 2GGQA 1IINA 4HO8A 1LL3A 2VFZA 3N9WA 4K6RA 1JV3A 1LZ7A 3K8EA 4GBPA 3JUJA 3OH4A 2RJ5A 1S4OA 1ZI5A 2RIZA 1HJLA 1VH1A 1TZFA 1GX4A 2E3DA 3SPTA 3SXBA 1H5SB 3E25A 1GQ9A 2D0JA 4M2BA 4NAIA 1H7GA 2XMHA 3BRKX 4KRVA 3DK5A 3USQA 3V0QA 2X65A 4FREA 4HO2A 4Y7VA 4FRMA 5C4EA 5J49A 2RJ7A 3OC9A 3Q4SA 3SX3A 1JVGA 1ZI3A 2YCMA 5C3BA 1ZCVA 4BMAA 1LL0A 2FYDB 5C36A 4KPZA 1G8OA 1MP4A 4JISA 1JV1A 1H4EA 2FFVA 2W0WA 2AM5A 2I5EA 2YQCA 5C4FA 1O7OA 3OAMA 2RJ4A 3I0EA 5C8RA 5CQOA 4Y64A 1LZJA 1LZ0A 2XWMA 4IRPA 2OEGA 2VS4A 4FRHA 2XMEA 2A8WA 2V0KA 1GQCA 1INIA 1ZCYA 5L6SA 1JYKA 5FU0A 4D48A 1GA8A 4KT7A 1FR9A 3R3IA 4HO5A 3T7NA 4AYJA 3O3PA 2V0LA 1VZXA 3CKOA 1G97A 2VXMA 3DJ4A 2J0BA 1TVYA 5D91A 3ZGGA 4NANA 2ICXA 3U2VA 4CJBA 2WE9A 1HV9A 4HO9A 1VM8A 2E8BA 4KQLA 4B4MA 3SXAA 2FYAA 1HM9A 4FCUA 4KNRA 1H7QA 1G0RA 2QGIA 5C4BA 2BO8A 4G3SA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2X60 A;  2ZU7 A;  4M4K A;  3CGX A;  4B4B A;  1R7V A;  3R2W A;  4AYL A;  5CQN X;  2YQS A;  1ZI1 A;  1EZI A;  1H7H A;  5C49 A;  4D11 C;  4Y62 A;  4E1K A;  1YP2 A;  3PNN A;  3OKR A;  2ZU9 A;  5FTS A;  1FO8 A;  1VH3 A;  1GX0 A;  1ZJ2 A;  2P73 A;  2V0J A;  3SXC A;  4FRL A;  4B42 A;  4D11 A;  2I7B A;  4KPX A;  1H4C A;  3V90 A;  1G95 A;  5EIY A;  3FOQ A;  5I1F A;  3SXG A;  3ZLK A;  5C48 A;  5CMG X;  5EJ1 A;  3CKV A;  1H7E A;  2P6W A;  2VS5 A;  3I0K A;  4HCQ A;  1ZCT A;  2Z87 A;  1ZJO A;  3OGZ A;  3BCV A;  1QGS A;  3OH1 A;  5FTV A;  1WT1 A;  5DDV A;  1G1L A;  1FOA A;  1I52 A;  1VZU A;  2XWN A;  1G93 A;  1LVW A;  3K8D A;  1WT3 A;  1W77 A;  4L41 C;  5IDS A;  2ZU8 A;  1VGT A;  1FO9 A;  1R7U A;  1VZT A;  2AGD A;  3CKQ A;  2FFU A;  1G23 A;  2AM4 A;  4CVH A;  1H4D A;  5AJN A;  2RIY A;  3U2W A;  3V0M A;  2Y4M A;  5C1G A;  2QH5 A;  5FUH A;  2VSH A;  2APC A;  1FR8 A;  1ZDG A;  3U2U A;  3POL A;  1YP3 A;  4M2A A;  2XWL A;  1NQI B;  2VSI A;  3LW6 A;  1ZIZ A;  3FWW A;  2O1F A;  3RSB A;  3ZGF A;  2AE7 A;  5IDT A;  4KXO A;  2V0I A;  1FXJ A;  3CKJ A;  4BQH A;  2WVL A;  4HO6 A;  1GWW A;  5C38 A;  2OI6 A;  4EEG A;  4EEA A;  4B3U A;  2BO6 A;  3HL3 A;  1R81 A;  3V0O A;  4HOC A;  5FV9 A;  1VGZ A;  1FG5 N;  5C1H A;  4Y9X A;  2AH9 A;  5C4C A;  1ZJP A;  5L6V A;  1K4V A;  4XWI A;  3RMW A;  2FY7 A;  4NAK A;  1TW1 A;  3I0H A;  3OH2 A;  5C3D A;  2JCK A;  3V8Z A;  1OMZ A;  3RMV A;  1E5K A;  1ON8 A;  1INJ A;  1ZJ1 A;  1XHB A;  2YC3 A;  4LW3 A;  5FYE A;  1G2V A;  4Y7F A;  2PA4 A;  1S4P A;  2JCO A;  5CMI A;  4R7P A;  3PKP A;  4ASJ A;  1NHE B;  1H7T A;  1H3M A;  2YQH A;  1S4N A;  4FQW A;  4KC2 A;  1IIM A;  2WEE A;  4KC1 A;  2FYB A;  1XZ6 A;  2AEC A;  3I0L A;  5CQM X;  1O23 B;  3SX8 A;  1H5R A;  2PGY A;  3TQD A;  5BXC A;  2AES A;  3Q7U A;  1H5T A;  1ZHJ A;  3CU0 A;  3F1Y A;  1ZCU A;  3IOH A;  4IRQ A;  2PX7 A;  1W57 A;  2CU2 A;  3D8V A;  3E26 A;  4FCE A;  2VD4 A;  1OQM B;  2JCL A;  3I0F A;  2OI7 A;  4Y7T A;  4DDZ A;  2O1G A;  1ZI4 A;  2WAW A;  1QGQ A;  4HO4 A;  3I0G A;  1WT2 A;  4DEC A;  3I0J A;  1H5S C;  1HJJ A;  1FWY A;  1O0R A;  1H7L A;  5C1L A;  1WSZ A;  1WT0 A;  2MZB A;  2P72 A;  4EEO A;  2Y4J A;  4ARW A;  1V84 A;  3V0N A;  3U2X A;  3JTJ A;  4D0Z A;  4AAW A;  3V0P A;  1H5S A;  4MYB A;  2Y4L A;  3ZF8 A;  2VS3 A;  4J18 A;  3TZT A;  1NKH B;  3EE5 A;  5CMF X;  1FGX A;  2W0V A;  2Z86 A;  1VPA A;  5IFY A;  2WVM A;  1TW5 A;  3D5N A;  4EE4 A;  2OI5 A;  4FRA A;  2ICY A;  2Y7A A;  2RIT A;  2RJ8 A;  2A8U A;  4ASY A;  2OEF A;  1G3L A;  5AJO A;  2RJ1 A;  2X5Z A;  4Y7U A;  4G3P A;  1JYL A;  1MP5 A;  4B2X A;  4HG6 A;  4YS8 A;  3D98 A;  4B5B A;  1NF5 B;  5C3A A;  1O7Q A;  1GWV A;  2X5S A;  3U0Y A;  1ZJ0 A;  2YQJ A;  1V83 A;  1W55 A;  1FXO A;  2BO7 A;  3SXE A;  4FRO A;  4EVW A;  1YP4 A;  3SXD A;  1LZI A;  1OMX A;  5CQP A;  2D7I A;  2WVK A;  3GUE A;  5C47 A;  5EJZ A;  1H5S D;  1VGW A;  1MC3 A;  2Y4K A;  4P02 A;  4JD0 A;  4CJ8 A;  4ECM A;  1PZY B;  1FRW A;  1Z90 A;  2Y6P A;  2RJ9 A;  1NMM B;  4M28 A;  3F1C A;  3JUK A;  1R7X A;  5HS2 A;  3CKN A;  1SS9 A;  4B2W A;  2AM3 A;  4FRQ A;  1HM0 A;  2GGO A;  3PKQ A;  1VIC A;  3SX7 A;  2JCJ A;  5CMH A;  1NWG B;  2DPW A;  5FU8 A;  2NXV A;  1QG8 A;  4G3Q A;  3IOJ A;  1PZT A;  3I0I X;  4KNX A;  4FRD A;  2RJ0 A;  3NGW A;  2FYC B;  3Q80 A;  4LW6 A;  2O1H A;  1HM8 A;  2RJ6 A;  4CJC A;  1YRO B;  3OH0 A;  1FGG A;  2PGV A;  4NAL A;  1LL2 A;  2I5K A;  1R80 A;  4FRB A;  1ON6 A;  3U2T A;  3OH3 A;  4KC4 A;  4Y6N A;  4UEG A;  1G9R A;  4HO0 A;  5CQL X;  4Y63 A;  5DDT A;  4EEM A;  1V82 A;  3QVB A;  1WVC A;  1H7F A;  1QWJ A;  1EYR A;  1ZDF A;  1KWS A;  2YC5 A;  2QKX A;  4Y6U A;  4AC3 A;  4FRP A;  3KIA A;  4P00 A;  3T7M A;  4Y7G A;  5C4D A;  2BO4 A;  1MP3 A;  4DE7 A;  4HO3 A;  5CMJ A;  3U0X A;  1R82 A;  4MND A;  3SX5 A;  1VGU A;  2YES A;  4D0T A;  1R7Y A;  2V0H A;  4G87 A;  3DUV A;  3T7O A;  2RIX A;  3ST8 A;  1H5R B;  2WGZ A;  4C2S A;  4EE3 A;  2VXL A;  1ZJ3 A;  2UX8 A;  1H5T B;  3ZLL A;  3V0L A;  4EE5 A;  3V8Y A;  4ZDQ A;  3USR A;  1JVD A;  1FZW A;  1R7T A;  2D7R A;  3I0C A;  2Q4J A;  3V91 A;  5AJP A;  3I0D A;  3IOI A;  5JQQ A;  4B4G A;  2GGQ A;  1IIN A;  4HO8 A;  1LL3 A;  2VFZ A;  3N9W A;  4K6R A;  1JV3 A;  1LZ7 A;  3K8E A;  4GBP A;  3JUJ A;  3OH4 A;  2RJ5 A;  1S4O A;  1ZI5 A;  2RIZ A;  1HJL A;  1VH1 A;  1TZF A;  1GX4 A;  2E3D A;  3SPT A;  3SXB A;  1H5S B;  3E25 A;  1GQ9 A;  2D0J A;  4M2B A;  4NAI A;  1H7G A;  2XMH A;  3BRK X;  4KRV A;  3DK5 A;  3USQ A;  3V0Q A;  2X65 A;  4FRE A;  4HO2 A;  4Y7V A;  4FRM A;  5C4E A;  5J49 A;  2RJ7 A;  3OC9 A;  3Q4S A;  3SX3 A;  1JVG A;  1ZI3 A;  2YCM A;  5C3B A;  1ZCV A;  4BMA A;  1LL0 A;  2FYD B;  5C36 A;  4KPZ A;  1G8O A;  1MP4 A;  4JIS A;  1JV1 A;  1H4E A;  2FFV A;  2W0W A;  2AM5 A;  2I5E A;  2YQC A;  5C4F A;  1O7O A;  3OAM A;  2RJ4 A;  3I0E A;  5C8R A;  5CQO A;  4Y64 A;  1LZJ A;  1LZ0 A;  2XWM A;  4IRP A;  2OEG A;  2VS4 A;  4FRH A;  2XME A;  2A8W A;  2V0K A;  1GQC A;  1INI A;  1ZCY A;  5L6S A;  1JYK A;  5FU0 A;  4D48 A;  1GA8 A;  4KT7 A;  1FR9 A;  3R3I A;  4HO5 A;  3T7N A;  4AYJ A;  3O3P A;  2V0L A;  3DJ4 A;  1VZX A;  1G97 A;  2VXM A;  3CKO A;  1TVY A;  3ZGG A;  4NAN A;  2ICX A;  3U2V A;  4CJB A;  2WE9 A;  1HV9 A;  4HO9 A;  1VM8 A;  2E8B A;  4KQL A;  4B4M A;  3SXA A;  2FYA A;  1HM9 A;  4FCU A;  4KNR A;  1H7Q A;  1G0R A;  2QGI A;  5C4B A;  2BO8 A;  4G3S A; 
#chains in the Genus database with same CATH topology
 2X60 A;  2ZU7 A;  4M4K A;  3CGX A;  4B4B A;  1R7V A;  3R2W A;  4AYL A;  4FIX A;  5CQN X;  2YQS A;  1ZI1 A;  1EZI A;  1H7H A;  5C49 A;  4D11 C;  4Y62 A;  4E1K A;  1YP2 A;  3PNN A;  3OKR A;  2ZU9 A;  5FTS A;  1FO8 A;  1VH3 A;  1GX0 A;  1ZJ2 A;  2P73 A;  2V0J A;  3SXC A;  4FRL A;  4B42 A;  4D11 A;  2I7B A;  4KPX A;  1H4C A;  3V90 A;  1G95 A;  5EIY A;  3FOQ A;  5I1F A;  3SXG A;  3ZLK A;  5C48 A;  5CMG X;  5EJ1 A;  3CKV A;  1H7E A;  2P6W A;  2VS5 A;  3I0K A;  4HCQ A;  1ZCT A;  2Z87 A;  1ZJO A;  3OGZ A;  3BCV A;  1QGS A;  3OH1 A;  5FTV A;  1WT1 A;  5DDV A;  1G1L A;  1FOA A;  1I52 A;  1VZU A;  2XWN A;  5D92 A;  1G93 A;  1LVW A;  3K8D A;  1WT3 A;  1W77 A;  4L41 C;  5IDS A;  2ZU8 A;  1VGT A;  1FO9 A;  1R7U A;  1VZT A;  2AGD A;  3CKQ A;  2FFU A;  4O6N A;  1G23 A;  2AM4 A;  4CVH A;  1H4D A;  5AJN A;  2RIY A;  3U2W A;  3V0M A;  2Y4M A;  5C1G A;  2QH5 A;  5FUH A;  2VSH A;  2APC A;  1FR8 A;  1ZDG A;  3U2U A;  3POL A;  1YP3 A;  4M2A A;  2XWL A;  1NQI B;  2VSI A;  3LW6 A;  1ZIZ A;  3FWW A;  2O1F A;  3RSB A;  3ZGF A;  2AE7 A;  5IDT A;  4KXO A;  2V0I A;  1FXJ A;  3CKJ A;  4BQH A;  2WVL A;  4HO6 A;  1GWW A;  5C38 A;  2OI6 A;  4EEG A;  4EEA A;  4B3U A;  2BO6 A;  3HL3 A;  1R81 A;  3V0O A;  4HOC A;  5FV9 A;  1VGZ A;  1FG5 N;  5C1H A;  4Y9X A;  2AH9 A;  5C4C A;  1ZJP A;  5L6V A;  1K4V A;  4XWI A;  3RMW A;  2FY7 A;  4NAK A;  1TW1 A;  3I0H A;  3OH2 A;  5C3D A;  2JCK A;  3V8Z A;  1OMZ A;  3RMV A;  1E5K A;  1ON8 A;  1INJ A;  1ZJ1 A;  1XHB A;  2YC3 A;  2C0N A;  4LW3 A;  5FYE A;  1G2V A;  2VK9 A;  4Y7F A;  2PA4 A;  1S4P A;  2JCO A;  5CMI A;  4R7P A;  3PKP A;  4ASJ A;  1NHE B;  1H7T A;  1H3M A;  2YQH A;  1S4N A;  4FQW A;  4KC2 A;  1IIM A;  2WEE A;  4KC1 A;  2FYB A;  1XZ6 A;  2AEC A;  3I0L A;  5CQM X;  1O23 B;  3SX8 A;  1H5R A;  2PGY A;  3TQD A;  5BXC A;  2AES A;  3Q7U A;  1H5T A;  1ZHJ A;  3CU0 A;  3F1Y A;  1ZCU A;  3IOH A;  4IRQ A;  2PX7 A;  1W57 A;  2J0A A;  2CU2 A;  3D8V A;  3E26 A;  4FCE A;  2VD4 A;  1OQM B;  2JCL A;  3I0F A;  2OI7 A;  4Y7T A;  4DDZ A;  2O1G A;  1ZI4 A;  2WAW A;  1QGQ A;  4HO4 A;  3I0G A;  1WT2 A;  4DEC A;  3I0J A;  1H5S C;  1HJJ A;  1FWY A;  1O0R A;  1H7L A;  5C1L A;  1WSZ A;  1WT0 A;  2MZB A;  2P72 A;  4EEO A;  2Y4J A;  4ARW A;  1V84 A;  3V0N A;  3U2X A;  3JTJ A;  4D0Z A;  4AAW A;  3V0P A;  1H5S A;  4MYB A;  2Y4L A;  3ZF8 A;  2VS3 A;  4J18 A;  3TZT A;  1NKH B;  3EE5 A;  5CMF X;  1FGX A;  2W0V A;  2Z86 A;  1VPA A;  5IFY A;  2WVM A;  1TW5 A;  3D5N A;  4EE4 A;  2OI5 A;  4FRA A;  2ICY A;  2Y7A A;  2RIT A;  2RJ8 A;  2A8U A;  4ASY A;  2OEF A;  1G3L A;  5AJO A;  2RJ1 A;  2X5Z A;  4Y7U A;  4G3P A;  1JYL A;  1MP5 A;  4B2X A;  4HG6 A;  4YS8 A;  3D98 A;  4B5B A;  1NF5 B;  5C3A A;  1O7Q A;  1GWV A;  2X5S A;  3U0Y A;  1ZJ0 A;  2YQJ A;  1V83 A;  1W55 A;  4O6M A;  1FXO A;  2BO7 A;  3SXE A;  4FRO A;  4EVW A;  4MIX A;  1YP4 A;  3SXD A;  1LZI A;  1OMX A;  5CQP A;  2D7I A;  2WVK A;  3GUE A;  5C47 A;  5EJZ A;  1H5S D;  1VGW A;  1MC3 A;  2Y4K A;  4P02 A;  4JD0 A;  4CJ8 A;  4ECM A;  1PZY B;  1FRW A;  1Z90 A;  2Y6P A;  2RJ9 A;  1NMM B;  4M28 A;  3F1C A;  3JUK A;  1R7X A;  5HS2 A;  3CKN A;  1SS9 A;  4B2W A;  2AM3 A;  4FRQ A;  1HM0 A;  2GGO A;  3PKQ A;  1VIC A;  3SX7 A;  2JCJ A;  5CMH A;  1NWG B;  2DPW A;  5FU8 A;  2NXV A;  1QG8 A;  4G3Q A;  3IOJ A;  1PZT A;  3I0I X;  4KNX A;  4FRD A;  2RJ0 A;  3NGW A;  2FYC B;  3Q80 A;  4LW6 A;  2O1H A;  1HM8 A;  2RJ6 A;  4CJC A;  1YRO B;  3OH0 A;  1FGG A;  2PGV A;  4NAL A;  1LL2 A;  2I5K A;  1R80 A;  4FRB A;  1ON6 A;  3U2T A;  3OH3 A;  4KC4 A;  4Y6N A;  4UEG A;  1G9R A;  4HO0 A;  5CQL X;  4Y63 A;  5DDT A;  4EEM A;  1V82 A;  3QVB A;  1WVC A;  1H7F A;  1QWJ A;  1EYR A;  1ZDF A;  1KWS A;  2YC5 A;  2QKX A;  4Y6U A;  4AC3 A;  4FRP A;  3KIA A;  4FIY A;  4P00 A;  3T7M A;  4Y7G A;  5C4D A;  2BO4 A;  1MP3 A;  4DE7 A;  4HO3 A;  5CMJ A;  3U0X A;  4Q7C A;  1R82 A;  4MND A;  3SX5 A;  1VGU A;  2YES A;  4D0T A;  1R7Y A;  2V0H A;  4G87 A;  3DUV A;  3T7O A;  2RIX A;  3ST8 A;  1H5R B;  2WGZ A;  4C2S A;  4EE3 A;  2VXL A;  1ZJ3 A;  2UX8 A;  1H5T B;  3ZLL A;  3V0L A;  4EE5 A;  3V8Y A;  4ZDQ A;  3USR A;  1JVD A;  1FZW A;  1R7T A;  2D7R A;  3I0C A;  2Q4J A;  3V91 A;  5AJP A;  3I0D A;  3IOI A;  5JQQ A;  4B4G A;  2GGQ A;  1IIN A;  4HO8 A;  1LL3 A;  2VFZ A;  3N9W A;  4K6R A;  1JV3 A;  1LZ7 A;  3K8E A;  4GBP A;  3JUJ A;  3OH4 A;  2RJ5 A;  1S4O A;  1ZI5 A;  2RIZ A;  1HJL A;  1VH1 A;  1TZF A;  1GX4 A;  2E3D A;  3SPT A;  3SXB A;  1H5S B;  3E25 A;  1GQ9 A;  2D0J A;  4M2B A;  4NAI A;  1H7G A;  2XMH A;  3BRK X;  4KRV A;  3DK5 A;  3USQ A;  3V0Q A;  2X65 A;  4FRE A;  4HO2 A;  4Y7V A;  4FRM A;  5C4E A;  5J49 A;  2RJ7 A;  3OC9 A;  3Q4S A;  3SX3 A;  1JVG A;  1ZI3 A;  2YCM A;  5C3B A;  1ZCV A;  4BMA A;  1LL0 A;  2FYD B;  5C36 A;  4KPZ A;  1G8O A;  1MP4 A;  4JIS A;  1JV1 A;  1H4E A;  2FFV A;  2W0W A;  2AM5 A;  2I5E A;  2YQC A;  5C4F A;  1O7O A;  3OAM A;  2RJ4 A;  3I0E A;  5C8R A;  5CQO A;  4Y64 A;  1LZJ A;  1LZ0 A;  2XWM A;  4IRP A;  2OEG A;  2VS4 A;  4FRH A;  2XME A;  2A8W A;  2V0K A;  1GQC A;  1INI A;  1ZCY A;  5L6S A;  1JYK A;  5FU0 A;  4D48 A;  1GA8 A;  4KT7 A;  1FR9 A;  3R3I A;  4HO5 A;  3T7N A;  4AYJ A;  3O3P A;  2V0L A;  1VZX A;  3CKO A;  1G97 A;  2VXM A;  3DJ4 A;  2J0B A;  1TVY A;  5D91 A;  3ZGG A;  4NAN A;  2ICX A;  3U2V A;  4CJB A;  2WE9 A;  1HV9 A;  4HO9 A;  1VM8 A;  2E8B A;  4KQL A;  4B4M A;  3SXA A;  2FYA A;  1HM9 A;  4FCU A;  4KNR A;  1H7Q A;  1G0R A;  2QGI A;  5C4B A;  2BO8 A;  4G3S A; 
#chains in the Genus database with same CATH homology
 2X60 A;  2ZU7 A;  4M4K A;  3CGX A;  4B4B A;  1R7V A;  3R2W A;  4AYL A;  4FIX A;  5CQN X;  2YQS A;  1ZI1 A;  1EZI A;  1H7H A;  5C49 A;  4D11 C;  4Y62 A;  4E1K A;  1YP2 A;  3PNN A;  3OKR A;  2ZU9 A;  5FTS A;  1FO8 A;  1VH3 A;  1GX0 A;  1ZJ2 A;  2P73 A;  2V0J A;  3SXC A;  4FRL A;  4B42 A;  4D11 A;  2I7B A;  4KPX A;  1H4C A;  3V90 A;  1G95 A;  5EIY A;  3FOQ A;  5I1F A;  3SXG A;  3ZLK A;  5C48 A;  5CMG X;  5EJ1 A;  3CKV A;  1H7E A;  2P6W A;  2VS5 A;  3I0K A;  4HCQ A;  1ZCT A;  2Z87 A;  1ZJO A;  3OGZ A;  3BCV A;  1QGS A;  3OH1 A;  5FTV A;  1WT1 A;  5DDV A;  1G1L A;  1FOA A;  1I52 A;  1VZU A;  2XWN A;  5D92 A;  1G93 A;  1LVW A;  3K8D A;  1WT3 A;  1W77 A;  4L41 C;  5IDS A;  2ZU8 A;  1VGT A;  1FO9 A;  1R7U A;  1VZT A;  2AGD A;  3CKQ A;  2FFU A;  4O6N A;  1G23 A;  2AM4 A;  4CVH A;  1H4D A;  5AJN A;  2RIY A;  3U2W A;  3V0M A;  2Y4M A;  5C1G A;  2QH5 A;  5FUH A;  2VSH A;  2APC A;  1FR8 A;  1ZDG A;  3U2U A;  3POL A;  1YP3 A;  4M2A A;  2XWL A;  1NQI B;  2VSI A;  3LW6 A;  1ZIZ A;  3FWW A;  2O1F A;  3RSB A;  3ZGF A;  2AE7 A;  5IDT A;  4KXO A;  2V0I A;  1FXJ A;  3CKJ A;  4BQH A;  2WVL A;  4HO6 A;  1GWW A;  5C38 A;  2OI6 A;  4EEG A;  4EEA A;  4B3U A;  2BO6 A;  3HL3 A;  1R81 A;  3V0O A;  4HOC A;  5FV9 A;  1VGZ A;  1FG5 N;  5C1H A;  4Y9X A;  2AH9 A;  5C4C A;  1ZJP A;  5L6V A;  1K4V A;  4XWI A;  3RMW A;  2FY7 A;  4NAK A;  1TW1 A;  3I0H A;  3OH2 A;  5C3D A;  2JCK A;  3V8Z A;  1OMZ A;  3RMV A;  1E5K A;  1ON8 A;  1INJ A;  1ZJ1 A;  1XHB A;  2YC3 A;  2C0N A;  4LW3 A;  5FYE A;  1G2V A;  2VK9 A;  4Y7F A;  2PA4 A;  1S4P A;  2JCO A;  5CMI A;  4R7P A;  3PKP A;  4ASJ A;  1NHE B;  1H7T A;  1H3M A;  2YQH A;  1S4N A;  4FQW A;  4KC2 A;  1IIM A;  2WEE A;  4KC1 A;  2FYB A;  1XZ6 A;  2AEC A;  3I0L A;  5CQM X;  1O23 B;  3SX8 A;  1H5R A;  2PGY A;  3TQD A;  5BXC A;  2AES A;  3Q7U A;  1H5T A;  1ZHJ A;  3CU0 A;  3F1Y A;  1ZCU A;  3IOH A;  4IRQ A;  2PX7 A;  1W57 A;  2J0A A;  2CU2 A;  3D8V A;  3E26 A;  4FCE A;  2VD4 A;  1OQM B;  2JCL A;  3I0F A;  2OI7 A;  4Y7T A;  4DDZ A;  2O1G A;  1ZI4 A;  2WAW A;  1QGQ A;  4HO4 A;  3I0G A;  1WT2 A;  4DEC A;  3I0J A;  1H5S C;  1HJJ A;  1FWY A;  1O0R A;  1H7L A;  5C1L A;  1WSZ A;  1WT0 A;  2MZB A;  2P72 A;  4EEO A;  2Y4J A;  4ARW A;  1V84 A;  3V0N A;  3U2X A;  3JTJ A;  4D0Z A;  4AAW A;  3V0P A;  1H5S A;  4MYB A;  2Y4L A;  3ZF8 A;  2VS3 A;  4J18 A;  3TZT A;  1NKH B;  3EE5 A;  5CMF X;  1FGX A;  2W0V A;  2Z86 A;  1VPA A;  5IFY A;  2WVM A;  1TW5 A;  3D5N A;  4EE4 A;  2OI5 A;  4FRA A;  2ICY A;  2Y7A A;  2RIT A;  2RJ8 A;  2A8U A;  4ASY A;  2OEF A;  1G3L A;  5AJO A;  2RJ1 A;  2X5Z A;  4Y7U A;  4G3P A;  1JYL A;  1MP5 A;  4B2X A;  4HG6 A;  4YS8 A;  3D98 A;  4B5B A;  1NF5 B;  5C3A A;  1O7Q A;  1GWV A;  2X5S A;  3U0Y A;  1ZJ0 A;  2YQJ A;  1V83 A;  1W55 A;  4O6M A;  1FXO A;  2BO7 A;  3SXE A;  4FRO A;  4EVW A;  4MIX A;  1YP4 A;  3SXD A;  1LZI A;  1OMX A;  5CQP A;  2D7I A;  2WVK A;  3GUE A;  5C47 A;  5EJZ A;  1H5S D;  1VGW A;  1MC3 A;  2Y4K A;  4P02 A;  4JD0 A;  4CJ8 A;  4ECM A;  1PZY B;  1FRW A;  1Z90 A;  2Y6P A;  2RJ9 A;  1NMM B;  4M28 A;  3F1C A;  3JUK A;  1R7X A;  5HS2 A;  3CKN A;  1SS9 A;  4B2W A;  2AM3 A;  4FRQ A;  1HM0 A;  2GGO A;  3PKQ A;  1VIC A;  3SX7 A;  2JCJ A;  5CMH A;  1NWG B;  2DPW A;  5FU8 A;  2NXV A;  1QG8 A;  4G3Q A;  3IOJ A;  1PZT A;  3I0I X;  4KNX A;  4FRD A;  2RJ0 A;  3NGW A;  2FYC B;  3Q80 A;  4LW6 A;  2O1H A;  1HM8 A;  2RJ6 A;  4CJC A;  1YRO B;  3OH0 A;  1FGG A;  2PGV A;  4NAL A;  1LL2 A;  2I5K A;  1R80 A;  4FRB A;  1ON6 A;  3U2T A;  3OH3 A;  4KC4 A;  4Y6N A;  4UEG A;  1G9R A;  4HO0 A;  5CQL X;  4Y63 A;  5DDT A;  4EEM A;  1V82 A;  3QVB A;  1WVC A;  1H7F A;  1QWJ A;  1EYR A;  1ZDF A;  1KWS A;  2YC5 A;  2QKX A;  4Y6U A;  4AC3 A;  4FRP A;  3KIA A;  4FIY A;  4P00 A;  3T7M A;  4Y7G A;  5C4D A;  2BO4 A;  1MP3 A;  4DE7 A;  4HO3 A;  5CMJ A;  3U0X A;  4Q7C A;  1R82 A;  4MND A;  3SX5 A;  1VGU A;  2YES A;  4D0T A;  1R7Y A;  2V0H A;  4G87 A;  3DUV A;  3T7O A;  2RIX A;  3ST8 A;  1H5R B;  2WGZ A;  4C2S A;  4EE3 A;  2VXL A;  1ZJ3 A;  2UX8 A;  1H5T B;  3ZLL A;  3V0L A;  4EE5 A;  3V8Y A;  4ZDQ A;  3USR A;  1JVD A;  1FZW A;  1R7T A;  2D7R A;  3I0C A;  2Q4J A;  3V91 A;  5AJP A;  3I0D A;  3IOI A;  5JQQ A;  4B4G A;  2GGQ A;  1IIN A;  4HO8 A;  1LL3 A;  2VFZ A;  3N9W A;  4K6R A;  1JV3 A;  1LZ7 A;  3K8E A;  4GBP A;  3JUJ A;  3OH4 A;  2RJ5 A;  1S4O A;  1ZI5 A;  2RIZ A;  1HJL A;  1VH1 A;  1TZF A;  1GX4 A;  2E3D A;  3SPT A;  3SXB A;  1H5S B;  3E25 A;  1GQ9 A;  2D0J A;  4M2B A;  4NAI A;  1H7G A;  2XMH A;  3BRK X;  4KRV A;  3DK5 A;  3USQ A;  3V0Q A;  2X65 A;  4FRE A;  4HO2 A;  4Y7V A;  4FRM A;  5C4E A;  5J49 A;  2RJ7 A;  3OC9 A;  3Q4S A;  3SX3 A;  1JVG A;  1ZI3 A;  2YCM A;  5C3B A;  1ZCV A;  4BMA A;  1LL0 A;  2FYD B;  5C36 A;  4KPZ A;  1G8O A;  1MP4 A;  4JIS A;  1JV1 A;  1H4E A;  2FFV A;  2W0W A;  2AM5 A;  2I5E A;  2YQC A;  5C4F A;  1O7O A;  3OAM A;  2RJ4 A;  3I0E A;  5C8R A;  5CQO A;  4Y64 A;  1LZJ A;  1LZ0 A;  2XWM A;  4IRP A;  2OEG A;  2VS4 A;  4FRH A;  2XME A;  2A8W A;  2V0K A;  1GQC A;  1INI A;  1ZCY A;  5L6S A;  1JYK A;  5FU0 A;  4D48 A;  1GA8 A;  4KT7 A;  1FR9 A;  3R3I A;  4HO5 A;  3T7N A;  4AYJ A;  3O3P A;  2V0L A;  1VZX A;  3CKO A;  1G97 A;  2VXM A;  3DJ4 A;  2J0B A;  1TVY A;  5D91 A;  3ZGG A;  4NAN A;  2ICX A;  3U2V A;  4CJB A;  2WE9 A;  1HV9 A;  4HO9 A;  1VM8 A;  2E8B A;  4KQL A;  4B4M A;  3SXA A;  2FYA A;  1HM9 A;  4FCU A;  4KNR A;  1H7Q A;  1G0R A;  2QGI A;  5C4B A;  2BO8 A;  4G3S A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...