3V0MA

Crystal structure of the fucosylgalactoside alpha n-acetylgalactosaminyltransferase (gta, cisab mutant l266g, g268a) in complex with a novel udp-gal derived inhibitor (5gw) and h-antigen acceptor
Total Genus 97
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
97
sequence length
289
structure length
289
Chain Sequence
AIGEFMVSLPRMVYPQPKVLTPCRKDVLVVTPWLAPIVWEGTFNIDILNEQFRLQNTTIGLTVFAIKKYVAFLKLFLETAEKHFMVGHRVHYYVFTDQPAAVPRVTLGTGRQLSVLEVRAYKRWQDVSMRRMEMISDFCERRFLSEVDYLVCVDVDMEFRDHVGVEILTPLFGTLHPGFYGSSREAFTYERRPQSQAYIPKDEGDFYYGGAFFGGSVQEVQRLTRACHQAMMVDQANGIEAVWHDESHLNKYLLRHKPTKVLSPEYLWDQQLLGWPAVLRKLRFTAVPK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Histo-blood group ABO system transferase
publication title Base-modified Donor Analogues Reveal Novel Dynamic Features of a Glycosyltransferase.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase/transferase inhibitor
total genus 97
structure length 289
sequence length 289
chains with identical sequence B
ec nomenclature ec 2.4.1.37: Fucosylgalactoside 3-alpha-galactosyltransferase.
pdb deposition date 2011-12-08
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.550.10 Alpha Beta Alpha-Beta Complex Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A 3v0mA00
5IFYA 1XZ6A 2V0HA 3Q7UA 3O3PA 2RJ9A 5CQMX 2YQCA 5C47A 3U2WA 2VS5A 1FXJA 1H7GA 1S4NA 1V84A 1JYLA 3RMVA 1H5TB 2VD4A 5DDVA 1W55A 3SXCA 1R81A 4D0TA 2BO7A 4FCUA 1LL0A 4G87A 4FRDA 4LW6A 1ZI4A 3F1CA 3D5NA 2X60A 4G3SA 2JCJA 2O1HA 3F1YA 4FQWA 5EIYA 3V8ZA 3CKOA 3NGWA 1TVYA 4FRMA 1ZCTA 4KC1A 3V0LA 2Z86A 2O1FA 4HO6A 3USQA 1LZJA 1YROB 5C49A 4EE3A 1VICA 1H7LA 5CMIA 2VXMA 1OMZA 1WT0A 1W57A 2YQJA 5CQNX 1GQCA 1ZDFA 1G93A 3CKNA 2AGDA 4NANA 2APCA 1VZXA 5C48A 2OI7A 4G3QA 1QGSA 4Y63A 1G97A 2I7BA 2A8WA 4B4BA 1ZHJA 1V82A 1H7EA 4JISA 3K8DA 2FYDB 1H5RB 2Q4JA 2WAWA 2WVLA 2QGIA 3V8YA 5BXCA 1NMMB 1HM8A 3D8VA 2RIYA 4FREA 3BCVA 5FTSA 1EZIA 4ASJA 4Y64A 2AE7A 5C3AA 1HV9A 5C4BA 1YP2A 4FRPA 2QKXA 1PZTA 1R7XA 1E5KA 5C4CA 1JVDA 2Z87A 3U2XA 4KXOA 4DE7A 3ZF8A 1MP3A 1VPAA 4KC4A 1VZTA 4EEMA 2FFUA 1ON6A 1KWSA 2YQHA 1VH3A 4EEGA 5C4DA 3T7OA 4E1KA 2RJ7A 2XWNA 2Y7AA 3SX3A 4FRHA 2XWMA 1I52A 2VS3A 4FRAA 4D11C 4ARWA 2P6WA 1G8OA 3OAMA 5FU8A 3RSBA 1MP5A 1WVCA 4Y7TA 2RJ5A 3POLA 2QH5A 2I5KA 1FRWA 4KNRA 4G3PA 2PGVA 4IRPA 3I0JA 5HS2A 3Q80A 4Y7UA 4KNXA 1XHBA 2V0JA 2ZU8A 1FO8A 2VSIA 3ZGGA 3BRKX 5L6VA 3RMWA 3JTJA 5C36A 4P02A 1GWVA 4Y9XA 1O23B 3V0OA 1QWJA 2RITA 2AH9A 4J18A 4AYLA 1QG8A 4HCQA 1LL2A 2Y4MA 4HO3A 2WVKA 3U0XA 3ZLLA 2FYCB 3R3IA 2RJ6A 2JCLA 3R2WA 1FXOA 4C2SA 2VFZA 1OMXA 4HO9A 1ZI1A 1HJLA 5C38A 5CQPA 3U0YA 5FU0A 1FG5N 1ZDGA 1FGGA 3SXDA 3CGXA 4CJCA 5CMGX 3GUEA 2AECA 1WT2A 2FY7A 3E25A 3K8EA 1NKHB 4M2BA 3IOIA 3JUJA 2O1GA 4HO2A 2OEFA 4EE4A 4Y6UA 2AESA 2YQSA 1LZ0A 2RJ4A 4XWIA 1H5SA 1SS9A 3OH0A 5EJZA 4FRBA 4EEAA 2ICXA 1NQIB 2RIZA 1S4PA 1R82A 3U2UA 1ZJ0A 3V0MA 1R7UA 1VM8A 2BO6A 3PKQA 4L41C 1H7TA 3TQDA 2GGQA 1EYRA 2YESA 1ON8A 4B42A 4D0ZA 1ZI5A 1HM0A 2ZU7A 4HG6A 4Y7VA 5C4EA 2P72A 4Y62A 5CMHA 2P73A 1HM9A 3DJ4A 4HOCA 1H3MA 1INJA 4AC3A 4BQHA 4MNDA 3OGZA 4K6RA 2YC5A 3CU0A 1WSZA 5IDTA 1R80A 1INIA 4HO0A 1NWGB 2RJ8A 1H5TA 3E26A 3HL3A 3D98A 1ZJPA 2XMEA 1LZ7A 3JUKA 1JVGA 4EEOA 4CJ8A 4EE5A 1R7VA 5CQOA 4ZDQA 2RJ1A 4DDZA 3OH4A 1WT1A 2V0LA 1ZCUA 2D0JA 2X5ZA 5AJNA 4D48A 1ZJ3A 2CU2A 3T7MA 2UX8A 2RIXA 1QGQA 2VS4A 1ZCVA 1G3LA 3OH2A 1R7YA 2XMHA 1G95A 1H5SD 2V0IA 3SXGA 1YP3A 3Q4SA 4BMAA 4KPXA 2AM3A 2E3DA 4M4KA 4AYJA 3ZLKA 4B2XA 1TZFA 3IOJA 2WGZA 2JCOA 3I0DA 4GBPA 2A8UA 1R7TA 1H7HA 3V0PA 3QVBA 1W77A 4B2WA 2AM5A 5CMJA 4KT7A 2WVMA 1Z90A 4FROA 3KIAA 5J49A 1IINA 2VSHA 3OKRA 4Y7GA 1ZJOA 1H5RA 1ZCYA 3I0HA 5C3DA 4NAIA 5AJOA 2W0VA 1FOAA 2X65A 4B4MA 3T7NA 3I0IX 4ECMA 2XWLA 1NHEB 2E8BA 3SXBA 2PX7A 4FRLA 1JV1A 1VGUA 3SXEA 2DPWA 3EE5A 4JD0A 5IDSA 2Y6PA 2D7RA 1YP4A 2YCMA 3IOHA 4B5BA 3DK5A 3N9WA 3I0LA 5CQLX 1NF5B 3V0NA 4NALA 2OI6A 1G1LA 4EVWA 1O0RA 4YS8A 4MYBA 4B4GA 3DUVA 1H7QA 1H7FA 1G2VA 1MP4A 4HO4A 4IRQA 1WT3A 5C1LA 3OH1A 1H4CA 1V83A 1H4DA 3I0CA 4FRQA 3SPTA 1ZIZA 1GQ9A 2NXVA 3I0EA 1LL3A 2VXLA 5C1GA 3U2TA 3V90A 1VZUA 3SX5A 1ZJ1A 2PGYA 1FGXA 2WEEA 1GWWA 3I0FA 1H5SC 1G9RA 4M28A 2MZBA 5CMFX 1S4OA 5C3BA 1LZIA 2D7IA 2Y4LA 3FWWA 1VGZA 2OI5A 2W0WA 4NAKA 4Y6NA 3V0QA 2BO8A 2V0KA 2RJ0A 3I0KA 2OEGA 4Y7FA 1JYKA 1O7QA 4FCEA 2FYBA 1FR9A 3SX8A 3TZTA 2JCKA 1H4EA 4R7PA 1GX4A 3CKQA 4KRVA 4P00A 1HJJA 2FFVA 2WE9A 5FTVA 1G23A 1ZJ2A 4CJBA 5C8RA 4B3UA 5EJ1A 1VGTA 3PNNA 1GA8A 2Y4JA 2FYAA 5FUHA 3OC9A 1FZWA 2I5EA 3OH3A 2AM4A 4CVHA 3SX7A 4KQLA 3CKJA 4D11A 3FOQA 1VH1A 1IIMA 1G0RA 1O7OA 2ZU9A 3V91A 3ZGFA 1VGWA 4ASYA 1JV3A 3ST8A 1ZI3A 5JQQA 1H5SB 2YC3A 1TW1A 3I0GA 5AJPA 4HO8A 2Y4KA 4HO5A 4AAWA 1TW5A 2ICYA 1FR8A 2BO4A 1FO9A 5C1HA 3CKVA 1GX0A 5FYEA 4M2AA 3LW6A 3USRA 4LW3A 2PA4A 3PKPA 3U2VA 1MC3A 5L6SA 5FV9A 5C4FA 5I1FA 4KPZA 1OQMB 4KC2A 2X5SA 5DDTA 2GGOA 4UEGA 1FWYA 1K4VA 1PZYB 4DECA 1LVWA 3SXAA
chains in the Genus database with same CATH superfamily
5IFYA 1XZ6A 2V0HA 3Q7UA 3O3PA 2RJ9A 5CQMX 2YQCA 5C47A 3U2WA 2VS5A 1FXJA 1H7GA 1S4NA 1V84A 1JYLA 3RMVA 1H5TB 2VD4A 5DDVA 1W55A 3SXCA 1R81A 4D0TA 2BO7A 4FCUA 1LL0A 4G87A 4O6NA 4FRDA 4LW6A 1ZI4A 3F1CA 3D5NA 2X60A 4G3SA 2JCJA 2O1HA 3F1YA 4FQWA 5EIYA 3V8ZA 3CKOA 3NGWA 1TVYA 4FRMA 1ZCTA 4KC1A 3V0LA 2Z86A 2O1FA 4HO6A 3USQA 1LZJA 1YROB 5C49A 4EE3A 1VICA 1H7LA 5CMIA 2VXMA 1OMZA 1WT0A 1W57A 2YQJA 5CQNX 1GQCA 1ZDFA 1G93A 3CKNA 2AGDA 4NANA 2APCA 1VZXA 5D91A 5C48A 2OI7A 4G3QA 2J0AA 1QGSA 4Y63A 1G97A 2I7BA 2A8WA 4B4BA 1ZHJA 1V82A 1H7EA 4JISA 3K8DA 2FYDB 1H5RB 2Q4JA 2WAWA 2WVLA 2QGIA 3V8YA 5BXCA 1NMMB 1HM8A 3D8VA 2RIYA 4FREA 3BCVA 5FTSA 1EZIA 4ASJA 4Y64A 2AE7A 5C3AA 1HV9A 5C4BA 1YP2A 4FRPA 2QKXA 1PZTA 1R7XA 1E5KA 5C4CA 1JVDA 2Z87A 3U2XA 4KXOA 4DE7A 3ZF8A 1MP3A 1VPAA 4KC4A 1VZTA 4EEMA 2FFUA 1ON6A 1KWSA 2YQHA 1VH3A 4EEGA 5C4DA 3T7OA 4E1KA 2RJ7A 2XWNA 2Y7AA 3SX3A 4FRHA 2XWMA 1I52A 2VS3A 4FRAA 4D11C 4ARWA 2P6WA 1G8OA 3OAMA 5FU8A 3RSBA 1MP5A 1WVCA 4Y7TA 2J0BA 2RJ5A 3POLA 2QH5A 2I5KA 1FRWA 4KNRA 4G3PA 2PGVA 4IRPA 3I0JA 5HS2A 3Q80A 4Y7UA 4KNXA 1XHBA 2V0JA 2ZU8A 1FO8A 2VSIA 3ZGGA 3BRKX 5L6VA 3RMWA 3JTJA 5C36A 4P02A 2VK9A 1GWVA 4Y9XA 1O23B 3V0OA 1QWJA 2RITA 2AH9A 4J18A 4AYLA 1QG8A 4HCQA 1LL2A 2Y4MA 4HO3A 2WVKA 3U0XA 3ZLLA 2FYCB 3R3IA 2RJ6A 2JCLA 3R2WA 1FXOA 4C2SA 2VFZA 1OMXA 4HO9A 1ZI1A 1HJLA 5C38A 5CQPA 3U0YA 5FU0A 1FG5N 1ZDGA 1FGGA 3SXDA 3CGXA 4CJCA 5CMGX 3GUEA 2AECA 1WT2A 2FY7A 3E25A 3K8EA 1NKHB 4M2BA 3IOIA 3JUJA 2O1GA 4HO2A 2OEFA 4EE4A 4Y6UA 2AESA 2YQSA 1LZ0A 2RJ4A 4XWIA 1H5SA 1SS9A 3OH0A 5EJZA 4FRBA 4EEAA 2ICXA 1NQIB 2RIZA 1S4PA 1R82A 3U2UA 1ZJ0A 3V0MA 1R7UA 1VM8A 2BO6A 3PKQA 4L41C 1H7TA 3TQDA 2GGQA 1EYRA 2YESA 1ON8A 4B42A 4D0ZA 1ZI5A 1HM0A 2ZU7A 4HG6A 4Y7VA 5C4EA 2P72A 4Y62A 5CMHA 2P73A 1HM9A 3DJ4A 4HOCA 1H3MA 1INJA 4AC3A 4BQHA 4MNDA 3OGZA 4K6RA 2YC5A 3CU0A 1WSZA 4FIYA 5IDTA 1R80A 1INIA 4HO0A 1NWGB 2RJ8A 1H5TA 3E26A 3HL3A 3D98A 1ZJPA 2XMEA 1LZ7A 3JUKA 1JVGA 4EEOA 4CJ8A 4EE5A 1R7VA 5CQOA 4ZDQA 2C0NA 2RJ1A 5D92A 4DDZA 3OH4A 1WT1A 2V0LA 1ZCUA 2D0JA 2X5ZA 5AJNA 4D48A 1ZJ3A 2CU2A 3T7MA 2UX8A 2RIXA 1QGQA 2VS4A 1ZCVA 1G3LA 3OH2A 1R7YA 2XMHA 1G95A 1H5SD 2V0IA 3SXGA 1YP3A 3Q4SA 4BMAA 4KPXA 2AM3A 2E3DA 4M4KA 4AYJA 3ZLKA 4B2XA 1TZFA 3IOJA 2WGZA 2JCOA 3I0DA 4GBPA 2A8UA 1R7TA 1H7HA 3V0PA 3QVBA 1W77A 4B2WA 2AM5A 5CMJA 4KT7A 2WVMA 1Z90A 4FROA 3KIAA 5J49A 1IINA 2VSHA 3OKRA 4Y7GA 1ZJOA 1H5RA 1ZCYA 3I0HA 5C3DA 4NAIA 5AJOA 2W0VA 1FOAA 2X65A 4B4MA 3T7NA 3I0IX 4ECMA 2XWLA 1NHEB 2E8BA 3SXBA 2PX7A 4FRLA 1JV1A 1VGUA 3SXEA 2DPWA 3EE5A 4JD0A 5IDSA 2Y6PA 2D7RA 4MIXA 1YP4A 4Q7CA 2YCMA 3IOHA 4B5BA 3DK5A 3N9WA 3I0LA 5CQLX 1NF5B 3V0NA 4NALA 2OI6A 1G1LA 4FIXA 4EVWA 1O0RA 4YS8A 4MYBA 4B4GA 3DUVA 1H7QA 1H7FA 1G2VA 1MP4A 4HO4A 4IRQA 1WT3A 5C1LA 3OH1A 1H4CA 1V83A 1H4DA 3I0CA 4FRQA 3SPTA 1ZIZA 1GQ9A 2NXVA 3I0EA 1LL3A 2VXLA 5C1GA 3U2TA 3V90A 1VZUA 3SX5A 1ZJ1A 2PGYA 1FGXA 2WEEA 1GWWA 3I0FA 1H5SC 1G9RA 4M28A 2MZBA 5CMFX 1S4OA 5C3BA 1LZIA 2D7IA 2Y4LA 3FWWA 1VGZA 2OI5A 2W0WA 4NAKA 4Y6NA 3V0QA 2BO8A 2V0KA 2RJ0A 3I0KA 2OEGA 4Y7FA 1JYKA 1O7QA 4FCEA 2FYBA 1FR9A 3SX8A 3TZTA 2JCKA 1H4EA 4R7PA 1GX4A 3CKQA 4KRVA 4P00A 1HJJA 2FFVA 2WE9A 5FTVA 1G23A 1ZJ2A 4CJBA 5C8RA 4B3UA 5EJ1A 1VGTA 3PNNA 1GA8A 2Y4JA 2FYAA 5FUHA 3OC9A 1FZWA 2I5EA 3OH3A 2AM4A 4CVHA 3SX7A 4KQLA 3CKJA 4D11A 3FOQA 1VH1A 1IIMA 1G0RA 1O7OA 2ZU9A 3V91A 3ZGFA 1VGWA 4ASYA 1JV3A 3ST8A 1ZI3A 5JQQA 1H5SB 2YC3A 1TW1A 3I0GA 5AJPA 4HO8A 2Y4KA 4HO5A 4AAWA 1TW5A 2ICYA 1FR8A 2BO4A 1FO9A 5C1HA 3CKVA 1GX0A 5FYEA 4M2AA 3LW6A 3USRA 4LW3A 2PA4A 3PKPA 4O6MA 3U2VA 1MC3A 5L6SA 5FV9A 5C4FA 5I1FA 4KPZA 1OQMB 4KC2A 2X5SA 5DDTA 2GGOA 4UEGA 1FWYA 1K4VA 1PZYB 4DECA 1LVWA 3SXAA
chains in the Genus database with same CATH topology
5IFYA 1XZ6A 2V0HA 3Q7UA 3O3PA 2RJ9A 5CQMX 2YQCA 5C47A 3U2WA 2VS5A 1FXJA 1H7GA 1S4NA 1V84A 1JYLA 3RMVA 1H5TB 2VD4A 5DDVA 1W55A 3SXCA 1R81A 4D0TA 2BO7A 4FCUA 1LL0A 4G87A 4O6NA 4FRDA 4LW6A 1ZI4A 3F1CA 3D5NA 2X60A 4G3SA 2JCJA 2O1HA 3F1YA 4FQWA 5EIYA 3V8ZA 3CKOA 3NGWA 1TVYA 4FRMA 1ZCTA 4KC1A 3V0LA 2Z86A 2O1FA 4HO6A 3USQA 1LZJA 1YROB 5C49A 4EE3A 1VICA 1H7LA 5CMIA 2VXMA 1OMZA 1WT0A 1W57A 2YQJA 5CQNX 1GQCA 1ZDFA 1G93A 3CKNA 2AGDA 4NANA 2APCA 1VZXA 5D91A 5C48A 2OI7A 4G3QA 2J0AA 1QGSA 4Y63A 1G97A 2I7BA 2A8WA 4B4BA 1ZHJA 1V82A 1H7EA 4JISA 3K8DA 2FYDB 1H5RB 2Q4JA 2WAWA 2WVLA 2QGIA 3V8YA 5BXCA 1NMMB 1HM8A 3D8VA 2RIYA 4FREA 3BCVA 5FTSA 1EZIA 4ASJA 4Y64A 2AE7A 5C3AA 1HV9A 5C4BA 1YP2A 4FRPA 2QKXA 1PZTA 1R7XA 1E5KA 5C4CA 1JVDA 2Z87A 3U2XA 4KXOA 4DE7A 3ZF8A 1MP3A 1VPAA 4KC4A 1VZTA 4EEMA 2FFUA 1ON6A 1KWSA 2YQHA 1VH3A 4EEGA 5C4DA 3T7OA 4E1KA 2RJ7A 2XWNA 2Y7AA 3SX3A 4FRHA 2XWMA 1I52A 2VS3A 4FRAA 4D11C 4ARWA 2P6WA 1G8OA 3OAMA 5FU8A 3RSBA 1MP5A 1WVCA 4Y7TA 2J0BA 2RJ5A 3POLA 2QH5A 2I5KA 1FRWA 4KNRA 4G3PA 2PGVA 4IRPA 3I0JA 5HS2A 3Q80A 4Y7UA 4KNXA 1XHBA 2V0JA 2ZU8A 1FO8A 2VSIA 3ZGGA 3BRKX 5L6VA 3RMWA 3JTJA 5C36A 4P02A 2VK9A 1GWVA 4Y9XA 1O23B 3V0OA 1QWJA 2RITA 2AH9A 4J18A 4AYLA 1QG8A 4HCQA 1LL2A 2Y4MA 4HO3A 2WVKA 3U0XA 3ZLLA 2FYCB 3R3IA 2RJ6A 2JCLA 3R2WA 1FXOA 4C2SA 2VFZA 1OMXA 4HO9A 1ZI1A 1HJLA 5C38A 5CQPA 3U0YA 5FU0A 1FG5N 1ZDGA 1FGGA 3SXDA 3CGXA 4CJCA 5CMGX 3GUEA 2AECA 1WT2A 2FY7A 3E25A 3K8EA 1NKHB 4M2BA 3IOIA 3JUJA 2O1GA 4HO2A 2OEFA 4EE4A 4Y6UA 2AESA 2YQSA 1LZ0A 2RJ4A 4XWIA 1H5SA 1SS9A 3OH0A 5EJZA 4FRBA 4EEAA 2ICXA 1NQIB 2RIZA 1S4PA 1R82A 3U2UA 1ZJ0A 3V0MA 1R7UA 1VM8A 2BO6A 3PKQA 4L41C 1H7TA 3TQDA 2GGQA 1EYRA 2YESA 1ON8A 4B42A 4D0ZA 1ZI5A 1HM0A 2ZU7A 4HG6A 4Y7VA 5C4EA 2P72A 4Y62A 5CMHA 2P73A 1HM9A 3DJ4A 4HOCA 1H3MA 1INJA 4AC3A 4BQHA 4MNDA 3OGZA 4K6RA 2YC5A 3CU0A 1WSZA 4FIYA 5IDTA 1R80A 1INIA 4HO0A 1NWGB 2RJ8A 1H5TA 3E26A 3HL3A 3D98A 1ZJPA 2XMEA 1LZ7A 3JUKA 1JVGA 4EEOA 4CJ8A 4EE5A 1R7VA 5CQOA 4ZDQA 2C0NA 2RJ1A 5D92A 4DDZA 3OH4A 1WT1A 2V0LA 1ZCUA 2D0JA 2X5ZA 5AJNA 4D48A 1ZJ3A 2CU2A 3T7MA 2UX8A 2RIXA 1QGQA 2VS4A 1ZCVA 1G3LA 3OH2A 1R7YA 2XMHA 1G95A 1H5SD 2V0IA 3SXGA 1YP3A 3Q4SA 4BMAA 4KPXA 2AM3A 2E3DA 4M4KA 4AYJA 3ZLKA 4B2XA 1TZFA 3IOJA 2WGZA 2JCOA 3I0DA 4GBPA 2A8UA 1R7TA 1H7HA 3V0PA 3QVBA 1W77A 4B2WA 2AM5A 5CMJA 4KT7A 2WVMA 1Z90A 4FROA 3KIAA 5J49A 1IINA 2VSHA 3OKRA 4Y7GA 1ZJOA 1H5RA 1ZCYA 3I0HA 5C3DA 4NAIA 5AJOA 2W0VA 1FOAA 2X65A 4B4MA 3T7NA 3I0IX 4ECMA 2XWLA 1NHEB 2E8BA 3SXBA 2PX7A 4FRLA 1JV1A 1VGUA 3SXEA 2DPWA 3EE5A 4JD0A 5IDSA 2Y6PA 2D7RA 4MIXA 1YP4A 4Q7CA 2YCMA 3IOHA 4B5BA 3DK5A 3N9WA 3I0LA 5CQLX 1NF5B 3V0NA 4NALA 2OI6A 1G1LA 4FIXA 4EVWA 1O0RA 4YS8A 4MYBA 4B4GA 3DUVA 1H7QA 1H7FA 1G2VA 1MP4A 4HO4A 4IRQA 1WT3A 5C1LA 3OH1A 1H4CA 1V83A 1H4DA 3I0CA 4FRQA 3SPTA 1ZIZA 1GQ9A 2NXVA 3I0EA 1LL3A 2VXLA 5C1GA 3U2TA 3V90A 1VZUA 3SX5A 1ZJ1A 2PGYA 1FGXA 2WEEA 1GWWA 3I0FA 1H5SC 1G9RA 4M28A 2MZBA 5CMFX 1S4OA 5C3BA 1LZIA 2D7IA 2Y4LA 3FWWA 1VGZA 2OI5A 2W0WA 4NAKA 4Y6NA 3V0QA 2BO8A 2V0KA 2RJ0A 3I0KA 2OEGA 4Y7FA 1JYKA 1O7QA 4FCEA 2FYBA 1FR9A 3SX8A 3TZTA 2JCKA 1H4EA 4R7PA 1GX4A 3CKQA 4KRVA 4P00A 1HJJA 2FFVA 2WE9A 5FTVA 1G23A 1ZJ2A 4CJBA 5C8RA 4B3UA 5EJ1A 1VGTA 3PNNA 1GA8A 2Y4JA 2FYAA 5FUHA 3OC9A 1FZWA 2I5EA 3OH3A 2AM4A 4CVHA 3SX7A 4KQLA 3CKJA 4D11A 3FOQA 1VH1A 1IIMA 1G0RA 1O7OA 2ZU9A 3V91A 3ZGFA 1VGWA 4ASYA 1JV3A 3ST8A 1ZI3A 5JQQA 1H5SB 2YC3A 1TW1A 3I0GA 5AJPA 4HO8A 2Y4KA 4HO5A 4AAWA 1TW5A 2ICYA 1FR8A 2BO4A 1FO9A 5C1HA 3CKVA 1GX0A 5FYEA 4M2AA 3LW6A 3USRA 4LW3A 2PA4A 3PKPA 4O6MA 3U2VA 1MC3A 5L6SA 5FV9A 5C4FA 5I1FA 4KPZA 1OQMB 4KC2A 2X5SA 5DDTA 2GGOA 4UEGA 1FWYA 1K4VA 1PZYB 4DECA 1LVWA 3SXAA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5IFY A;  1XZ6 A;  2V0H A;  3Q7U A;  3O3P A;  2RJ9 A;  5CQM X;  2YQC A;  5C47 A;  3U2W A;  2VS5 A;  1FXJ A;  1H7G A;  1S4N A;  1V84 A;  1JYL A;  3RMV A;  1H5T B;  2VD4 A;  5DDV A;  1W55 A;  3SXC A;  1R81 A;  4D0T A;  2BO7 A;  4FCU A;  1LL0 A;  4G87 A;  4FRD A;  4LW6 A;  1ZI4 A;  3F1C A;  3D5N A;  2X60 A;  4G3S A;  2JCJ A;  2O1H A;  3F1Y A;  4FQW A;  5EIY A;  3V8Z A;  3CKO A;  3NGW A;  1TVY A;  4FRM A;  1ZCT A;  4KC1 A;  3V0L A;  2Z86 A;  2O1F A;  4HO6 A;  3USQ A;  1LZJ A;  1YRO B;  5C49 A;  4EE3 A;  1VIC A;  1H7L A;  5CMI A;  2VXM A;  1OMZ A;  1WT0 A;  1W57 A;  2YQJ A;  5CQN X;  1GQC A;  1ZDF A;  1G93 A;  3CKN A;  2AGD A;  4NAN A;  2APC A;  1VZX A;  5C48 A;  2OI7 A;  4G3Q A;  1QGS A;  4Y63 A;  1G97 A;  2I7B A;  2A8W A;  4B4B A;  1ZHJ A;  1V82 A;  1H7E A;  4JIS A;  3K8D A;  2FYD B;  1H5R B;  2Q4J A;  2WAW A;  2WVL A;  2QGI A;  3V8Y A;  5BXC A;  1NMM B;  1HM8 A;  3D8V A;  2RIY A;  4FRE A;  3BCV A;  5FTS A;  1EZI A;  4ASJ A;  4Y64 A;  2AE7 A;  5C3A A;  1HV9 A;  5C4B A;  1YP2 A;  4FRP A;  2QKX A;  1PZT A;  1R7X A;  1E5K A;  5C4C A;  1JVD A;  2Z87 A;  3U2X A;  4KXO A;  4DE7 A;  3ZF8 A;  1MP3 A;  1VPA A;  4KC4 A;  1VZT A;  4EEM A;  2FFU A;  1ON6 A;  1KWS A;  2YQH A;  1VH3 A;  4EEG A;  5C4D A;  3T7O A;  4E1K A;  2RJ7 A;  2XWN A;  2Y7A A;  3SX3 A;  4FRH A;  2XWM A;  1I52 A;  2VS3 A;  4FRA A;  4D11 C;  4ARW A;  2P6W A;  1G8O A;  3OAM A;  5FU8 A;  3RSB A;  1MP5 A;  1WVC A;  4Y7T A;  2RJ5 A;  3POL A;  2QH5 A;  2I5K A;  1FRW A;  4KNR A;  4G3P A;  2PGV A;  4IRP A;  3I0J A;  5HS2 A;  3Q80 A;  4Y7U A;  4KNX A;  1XHB A;  2V0J A;  2ZU8 A;  1FO8 A;  2VSI A;  3ZGG A;  3BRK X;  5L6V A;  3RMW A;  3JTJ A;  5C36 A;  4P02 A;  1GWV A;  4Y9X A;  1O23 B;  3V0O A;  1QWJ A;  2RIT A;  2AH9 A;  4J18 A;  4AYL A;  1QG8 A;  4HCQ A;  1LL2 A;  2Y4M A;  4HO3 A;  2WVK A;  3U0X A;  3ZLL A;  2FYC B;  3R3I A;  2RJ6 A;  2JCL A;  3R2W A;  1FXO A;  4C2S A;  2VFZ A;  1OMX A;  4HO9 A;  1ZI1 A;  1HJL A;  5C38 A;  5CQP A;  3U0Y A;  5FU0 A;  1FG5 N;  1ZDG A;  1FGG A;  3SXD A;  3CGX A;  4CJC A;  5CMG X;  3GUE A;  2AEC A;  1WT2 A;  2FY7 A;  3E25 A;  3K8E A;  1NKH B;  4M2B A;  3IOI A;  3JUJ A;  2O1G A;  4HO2 A;  2OEF A;  4EE4 A;  4Y6U A;  2AES A;  2YQS A;  1LZ0 A;  2RJ4 A;  4XWI A;  1H5S A;  1SS9 A;  3OH0 A;  5EJZ A;  4FRB A;  4EEA A;  2ICX A;  1NQI B;  2RIZ A;  1S4P A;  1R82 A;  3U2U A;  1ZJ0 A;  3V0M A;  1R7U A;  1VM8 A;  2BO6 A;  3PKQ A;  4L41 C;  1H7T A;  3TQD A;  2GGQ A;  1EYR A;  2YES A;  1ON8 A;  4B42 A;  4D0Z A;  1ZI5 A;  1HM0 A;  2ZU7 A;  4HG6 A;  4Y7V A;  5C4E A;  2P72 A;  4Y62 A;  5CMH A;  2P73 A;  1HM9 A;  3DJ4 A;  4HOC A;  1H3M A;  1INJ A;  4AC3 A;  4BQH A;  4MND A;  3OGZ A;  4K6R A;  2YC5 A;  3CU0 A;  1WSZ A;  5IDT A;  1R80 A;  1INI A;  4HO0 A;  1NWG B;  2RJ8 A;  1H5T A;  3E26 A;  3HL3 A;  3D98 A;  1ZJP A;  2XME A;  1LZ7 A;  3JUK A;  1JVG A;  4EEO A;  4CJ8 A;  4EE5 A;  1R7V A;  5CQO A;  4ZDQ A;  2RJ1 A;  4DDZ A;  3OH4 A;  1WT1 A;  2V0L A;  1ZCU A;  2D0J A;  2X5Z A;  5AJN A;  4D48 A;  1ZJ3 A;  2CU2 A;  3T7M A;  2UX8 A;  2RIX A;  1QGQ A;  2VS4 A;  1ZCV A;  1G3L A;  3OH2 A;  1R7Y A;  2XMH A;  1G95 A;  1H5S D;  2V0I A;  3SXG A;  1YP3 A;  3Q4S A;  4BMA A;  4KPX A;  2AM3 A;  2E3D A;  4M4K A;  4AYJ A;  3ZLK A;  4B2X A;  1TZF A;  3IOJ A;  2WGZ A;  2JCO A;  3I0D A;  4GBP A;  2A8U A;  1R7T A;  1H7H A;  3V0P A;  3QVB A;  1W77 A;  4B2W A;  2AM5 A;  5CMJ A;  4KT7 A;  2WVM A;  1Z90 A;  4FRO A;  3KIA A;  5J49 A;  1IIN A;  2VSH A;  3OKR A;  4Y7G A;  1ZJO A;  1H5R A;  1ZCY A;  3I0H A;  5C3D A;  4NAI A;  5AJO A;  2W0V A;  1FOA A;  2X65 A;  4B4M A;  3T7N A;  3I0I X;  4ECM A;  2XWL A;  1NHE B;  2E8B A;  3SXB A;  2PX7 A;  4FRL A;  1JV1 A;  1VGU A;  3SXE A;  2DPW A;  3EE5 A;  4JD0 A;  5IDS A;  2Y6P A;  2D7R A;  1YP4 A;  2YCM A;  3IOH A;  4B5B A;  3DK5 A;  3N9W A;  3I0L A;  5CQL X;  1NF5 B;  3V0N A;  4NAL A;  2OI6 A;  1G1L A;  4EVW A;  1O0R A;  4YS8 A;  4MYB A;  4B4G A;  3DUV A;  1H7Q A;  1H7F A;  1G2V A;  1MP4 A;  4HO4 A;  4IRQ A;  1WT3 A;  5C1L A;  3OH1 A;  1H4C A;  1V83 A;  1H4D A;  3I0C A;  4FRQ A;  3SPT A;  1ZIZ A;  1GQ9 A;  2NXV A;  3I0E A;  1LL3 A;  2VXL A;  5C1G A;  3U2T A;  3V90 A;  1VZU A;  3SX5 A;  1ZJ1 A;  2PGY A;  1FGX A;  2WEE A;  1GWW A;  3I0F A;  1H5S C;  1G9R A;  4M28 A;  2MZB A;  5CMF X;  1S4O A;  5C3B A;  1LZI A;  2D7I A;  2Y4L A;  3FWW A;  1VGZ A;  2OI5 A;  2W0W A;  4NAK A;  4Y6N A;  3V0Q A;  2BO8 A;  2V0K A;  2RJ0 A;  3I0K A;  2OEG A;  4Y7F A;  1JYK A;  1O7Q A;  4FCE A;  2FYB A;  1FR9 A;  3SX8 A;  3TZT A;  2JCK A;  1H4E A;  4R7P A;  1GX4 A;  3CKQ A;  4KRV A;  4P00 A;  1HJJ A;  2FFV A;  2WE9 A;  5FTV A;  1G23 A;  1ZJ2 A;  4CJB A;  5C8R A;  4B3U A;  5EJ1 A;  1VGT A;  3PNN A;  1GA8 A;  2Y4J A;  2FYA A;  5FUH A;  3OC9 A;  1FZW A;  2I5E A;  3OH3 A;  2AM4 A;  4CVH A;  3SX7 A;  4KQL A;  3CKJ A;  4D11 A;  3FOQ A;  1VH1 A;  1IIM A;  1G0R A;  1O7O A;  2ZU9 A;  3V91 A;  3ZGF A;  1VGW A;  4ASY A;  1JV3 A;  3ST8 A;  1ZI3 A;  5JQQ A;  1H5S B;  2YC3 A;  1TW1 A;  3I0G A;  5AJP A;  4HO8 A;  2Y4K A;  4HO5 A;  4AAW A;  1TW5 A;  2ICY A;  1FR8 A;  2BO4 A;  1FO9 A;  5C1H A;  3CKV A;  1GX0 A;  5FYE A;  4M2A A;  3LW6 A;  3USR A;  4LW3 A;  2PA4 A;  3PKP A;  3U2V A;  1MC3 A;  5L6S A;  5FV9 A;  5C4F A;  5I1F A;  4KPZ A;  1OQM B;  4KC2 A;  2X5S A;  5DDT A;  2GGO A;  4UEG A;  1FWY A;  1K4V A;  1PZY B;  4DEC A;  1LVW A;  3SXA A; 
#chains in the Genus database with same CATH topology
 5IFY A;  1XZ6 A;  2V0H A;  3Q7U A;  3O3P A;  2RJ9 A;  5CQM X;  2YQC A;  5C47 A;  3U2W A;  2VS5 A;  1FXJ A;  1H7G A;  1S4N A;  1V84 A;  1JYL A;  3RMV A;  1H5T B;  2VD4 A;  5DDV A;  1W55 A;  3SXC A;  1R81 A;  4D0T A;  2BO7 A;  4FCU A;  1LL0 A;  4G87 A;  4O6N A;  4FRD A;  4LW6 A;  1ZI4 A;  3F1C A;  3D5N A;  2X60 A;  4G3S A;  2JCJ A;  2O1H A;  3F1Y A;  4FQW A;  5EIY A;  3V8Z A;  3CKO A;  3NGW A;  1TVY A;  4FRM A;  1ZCT A;  4KC1 A;  3V0L A;  2Z86 A;  2O1F A;  4HO6 A;  3USQ A;  1LZJ A;  1YRO B;  5C49 A;  4EE3 A;  1VIC A;  1H7L A;  5CMI A;  2VXM A;  1OMZ A;  1WT0 A;  1W57 A;  2YQJ A;  5CQN X;  1GQC A;  1ZDF A;  1G93 A;  3CKN A;  2AGD A;  4NAN A;  2APC A;  1VZX A;  5D91 A;  5C48 A;  2OI7 A;  4G3Q A;  2J0A A;  1QGS A;  4Y63 A;  1G97 A;  2I7B A;  2A8W A;  4B4B A;  1ZHJ A;  1V82 A;  1H7E A;  4JIS A;  3K8D A;  2FYD B;  1H5R B;  2Q4J A;  2WAW A;  2WVL A;  2QGI A;  3V8Y A;  5BXC A;  1NMM B;  1HM8 A;  3D8V A;  2RIY A;  4FRE A;  3BCV A;  5FTS A;  1EZI A;  4ASJ A;  4Y64 A;  2AE7 A;  5C3A A;  1HV9 A;  5C4B A;  1YP2 A;  4FRP A;  2QKX A;  1PZT A;  1R7X A;  1E5K A;  5C4C A;  1JVD A;  2Z87 A;  3U2X A;  4KXO A;  4DE7 A;  3ZF8 A;  1MP3 A;  1VPA A;  4KC4 A;  1VZT A;  4EEM A;  2FFU A;  1ON6 A;  1KWS A;  2YQH A;  1VH3 A;  4EEG A;  5C4D A;  3T7O A;  4E1K A;  2RJ7 A;  2XWN A;  2Y7A A;  3SX3 A;  4FRH A;  2XWM A;  1I52 A;  2VS3 A;  4FRA A;  4D11 C;  4ARW A;  2P6W A;  1G8O A;  3OAM A;  5FU8 A;  3RSB A;  1MP5 A;  1WVC A;  4Y7T A;  2J0B A;  2RJ5 A;  3POL A;  2QH5 A;  2I5K A;  1FRW A;  4KNR A;  4G3P A;  2PGV A;  4IRP A;  3I0J A;  5HS2 A;  3Q80 A;  4Y7U A;  4KNX A;  1XHB A;  2V0J A;  2ZU8 A;  1FO8 A;  2VSI A;  3ZGG A;  3BRK X;  5L6V A;  3RMW A;  3JTJ A;  5C36 A;  4P02 A;  2VK9 A;  1GWV A;  4Y9X A;  1O23 B;  3V0O A;  1QWJ A;  2RIT A;  2AH9 A;  4J18 A;  4AYL A;  1QG8 A;  4HCQ A;  1LL2 A;  2Y4M A;  4HO3 A;  2WVK A;  3U0X A;  3ZLL A;  2FYC B;  3R3I A;  2RJ6 A;  2JCL A;  3R2W A;  1FXO A;  4C2S A;  2VFZ A;  1OMX A;  4HO9 A;  1ZI1 A;  1HJL A;  5C38 A;  5CQP A;  3U0Y A;  5FU0 A;  1FG5 N;  1ZDG A;  1FGG A;  3SXD A;  3CGX A;  4CJC A;  5CMG X;  3GUE A;  2AEC A;  1WT2 A;  2FY7 A;  3E25 A;  3K8E A;  1NKH B;  4M2B A;  3IOI A;  3JUJ A;  2O1G A;  4HO2 A;  2OEF A;  4EE4 A;  4Y6U A;  2AES A;  2YQS A;  1LZ0 A;  2RJ4 A;  4XWI A;  1H5S A;  1SS9 A;  3OH0 A;  5EJZ A;  4FRB A;  4EEA A;  2ICX A;  1NQI B;  2RIZ A;  1S4P A;  1R82 A;  3U2U A;  1ZJ0 A;  3V0M A;  1R7U A;  1VM8 A;  2BO6 A;  3PKQ A;  4L41 C;  1H7T A;  3TQD A;  2GGQ A;  1EYR A;  2YES A;  1ON8 A;  4B42 A;  4D0Z A;  1ZI5 A;  1HM0 A;  2ZU7 A;  4HG6 A;  4Y7V A;  5C4E A;  2P72 A;  4Y62 A;  5CMH A;  2P73 A;  1HM9 A;  3DJ4 A;  4HOC A;  1H3M A;  1INJ A;  4AC3 A;  4BQH A;  4MND A;  3OGZ A;  4K6R A;  2YC5 A;  3CU0 A;  1WSZ A;  4FIY A;  5IDT A;  1R80 A;  1INI A;  4HO0 A;  1NWG B;  2RJ8 A;  1H5T A;  3E26 A;  3HL3 A;  3D98 A;  1ZJP A;  2XME A;  1LZ7 A;  3JUK A;  1JVG A;  4EEO A;  4CJ8 A;  4EE5 A;  1R7V A;  5CQO A;  4ZDQ A;  2C0N A;  2RJ1 A;  5D92 A;  4DDZ A;  3OH4 A;  1WT1 A;  2V0L A;  1ZCU A;  2D0J A;  2X5Z A;  5AJN A;  4D48 A;  1ZJ3 A;  2CU2 A;  3T7M A;  2UX8 A;  2RIX A;  1QGQ A;  2VS4 A;  1ZCV A;  1G3L A;  3OH2 A;  1R7Y A;  2XMH A;  1G95 A;  1H5S D;  2V0I A;  3SXG A;  1YP3 A;  3Q4S A;  4BMA A;  4KPX A;  2AM3 A;  2E3D A;  4M4K A;  4AYJ A;  3ZLK A;  4B2X A;  1TZF A;  3IOJ A;  2WGZ A;  2JCO A;  3I0D A;  4GBP A;  2A8U A;  1R7T A;  1H7H A;  3V0P A;  3QVB A;  1W77 A;  4B2W A;  2AM5 A;  5CMJ A;  4KT7 A;  2WVM A;  1Z90 A;  4FRO A;  3KIA A;  5J49 A;  1IIN A;  2VSH A;  3OKR A;  4Y7G A;  1ZJO A;  1H5R A;  1ZCY A;  3I0H A;  5C3D A;  4NAI A;  5AJO A;  2W0V A;  1FOA A;  2X65 A;  4B4M A;  3T7N A;  3I0I X;  4ECM A;  2XWL A;  1NHE B;  2E8B A;  3SXB A;  2PX7 A;  4FRL A;  1JV1 A;  1VGU A;  3SXE A;  2DPW A;  3EE5 A;  4JD0 A;  5IDS A;  2Y6P A;  2D7R A;  4MIX A;  1YP4 A;  4Q7C A;  2YCM A;  3IOH A;  4B5B A;  3DK5 A;  3N9W A;  3I0L A;  5CQL X;  1NF5 B;  3V0N A;  4NAL A;  2OI6 A;  1G1L A;  4FIX A;  4EVW A;  1O0R A;  4YS8 A;  4MYB A;  4B4G A;  3DUV A;  1H7Q A;  1H7F A;  1G2V A;  1MP4 A;  4HO4 A;  4IRQ A;  1WT3 A;  5C1L A;  3OH1 A;  1H4C A;  1V83 A;  1H4D A;  3I0C A;  4FRQ A;  3SPT A;  1ZIZ A;  1GQ9 A;  2NXV A;  3I0E A;  1LL3 A;  2VXL A;  5C1G A;  3U2T A;  3V90 A;  1VZU A;  3SX5 A;  1ZJ1 A;  2PGY A;  1FGX A;  2WEE A;  1GWW A;  3I0F A;  1H5S C;  1G9R A;  4M28 A;  2MZB A;  5CMF X;  1S4O A;  5C3B A;  1LZI A;  2D7I A;  2Y4L A;  3FWW A;  1VGZ A;  2OI5 A;  2W0W A;  4NAK A;  4Y6N A;  3V0Q A;  2BO8 A;  2V0K A;  2RJ0 A;  3I0K A;  2OEG A;  4Y7F A;  1JYK A;  1O7Q A;  4FCE A;  2FYB A;  1FR9 A;  3SX8 A;  3TZT A;  2JCK A;  1H4E A;  4R7P A;  1GX4 A;  3CKQ A;  4KRV A;  4P00 A;  1HJJ A;  2FFV A;  2WE9 A;  5FTV A;  1G23 A;  1ZJ2 A;  4CJB A;  5C8R A;  4B3U A;  5EJ1 A;  1VGT A;  3PNN A;  1GA8 A;  2Y4J A;  2FYA A;  5FUH A;  3OC9 A;  1FZW A;  2I5E A;  3OH3 A;  2AM4 A;  4CVH A;  3SX7 A;  4KQL A;  3CKJ A;  4D11 A;  3FOQ A;  1VH1 A;  1IIM A;  1G0R A;  1O7O A;  2ZU9 A;  3V91 A;  3ZGF A;  1VGW A;  4ASY A;  1JV3 A;  3ST8 A;  1ZI3 A;  5JQQ A;  1H5S B;  2YC3 A;  1TW1 A;  3I0G A;  5AJP A;  4HO8 A;  2Y4K A;  4HO5 A;  4AAW A;  1TW5 A;  2ICY A;  1FR8 A;  2BO4 A;  1FO9 A;  5C1H A;  3CKV A;  1GX0 A;  5FYE A;  4M2A A;  3LW6 A;  3USR A;  4LW3 A;  2PA4 A;  3PKP A;  4O6M A;  3U2V A;  1MC3 A;  5L6S A;  5FV9 A;  5C4F A;  5I1F A;  4KPZ A;  1OQM B;  4KC2 A;  2X5S A;  5DDT A;  2GGO A;  4UEG A;  1FWY A;  1K4V A;  1PZY B;  4DEC A;  1LVW A;  3SXA A; 
#chains in the Genus database with same CATH homology
 5IFY A;  1XZ6 A;  2V0H A;  3Q7U A;  3O3P A;  2RJ9 A;  5CQM X;  2YQC A;  5C47 A;  3U2W A;  2VS5 A;  1FXJ A;  1H7G A;  1S4N A;  1V84 A;  1JYL A;  3RMV A;  1H5T B;  2VD4 A;  5DDV A;  1W55 A;  3SXC A;  1R81 A;  4D0T A;  2BO7 A;  4FCU A;  1LL0 A;  4G87 A;  4O6N A;  4FRD A;  4LW6 A;  1ZI4 A;  3F1C A;  3D5N A;  2X60 A;  4G3S A;  2JCJ A;  2O1H A;  3F1Y A;  4FQW A;  5EIY A;  3V8Z A;  3CKO A;  3NGW A;  1TVY A;  4FRM A;  1ZCT A;  4KC1 A;  3V0L A;  2Z86 A;  2O1F A;  4HO6 A;  3USQ A;  1LZJ A;  1YRO B;  5C49 A;  4EE3 A;  1VIC A;  1H7L A;  5CMI A;  2VXM A;  1OMZ A;  1WT0 A;  1W57 A;  2YQJ A;  5CQN X;  1GQC A;  1ZDF A;  1G93 A;  3CKN A;  2AGD A;  4NAN A;  2APC A;  1VZX A;  5D91 A;  5C48 A;  2OI7 A;  4G3Q A;  2J0A A;  1QGS A;  4Y63 A;  1G97 A;  2I7B A;  2A8W A;  4B4B A;  1ZHJ A;  1V82 A;  1H7E A;  4JIS A;  3K8D A;  2FYD B;  1H5R B;  2Q4J A;  2WAW A;  2WVL A;  2QGI A;  3V8Y A;  5BXC A;  1NMM B;  1HM8 A;  3D8V A;  2RIY A;  4FRE A;  3BCV A;  5FTS A;  1EZI A;  4ASJ A;  4Y64 A;  2AE7 A;  5C3A A;  1HV9 A;  5C4B A;  1YP2 A;  4FRP A;  2QKX A;  1PZT A;  1R7X A;  1E5K A;  5C4C A;  1JVD A;  2Z87 A;  3U2X A;  4KXO A;  4DE7 A;  3ZF8 A;  1MP3 A;  1VPA A;  4KC4 A;  1VZT A;  4EEM A;  2FFU A;  1ON6 A;  1KWS A;  2YQH A;  1VH3 A;  4EEG A;  5C4D A;  3T7O A;  4E1K A;  2RJ7 A;  2XWN A;  2Y7A A;  3SX3 A;  4FRH A;  2XWM A;  1I52 A;  2VS3 A;  4FRA A;  4D11 C;  4ARW A;  2P6W A;  1G8O A;  3OAM A;  5FU8 A;  3RSB A;  1MP5 A;  1WVC A;  4Y7T A;  2J0B A;  2RJ5 A;  3POL A;  2QH5 A;  2I5K A;  1FRW A;  4KNR A;  4G3P A;  2PGV A;  4IRP A;  3I0J A;  5HS2 A;  3Q80 A;  4Y7U A;  4KNX A;  1XHB A;  2V0J A;  2ZU8 A;  1FO8 A;  2VSI A;  3ZGG A;  3BRK X;  5L6V A;  3RMW A;  3JTJ A;  5C36 A;  4P02 A;  2VK9 A;  1GWV A;  4Y9X A;  1O23 B;  3V0O A;  1QWJ A;  2RIT A;  2AH9 A;  4J18 A;  4AYL A;  1QG8 A;  4HCQ A;  1LL2 A;  2Y4M A;  4HO3 A;  2WVK A;  3U0X A;  3ZLL A;  2FYC B;  3R3I A;  2RJ6 A;  2JCL A;  3R2W A;  1FXO A;  4C2S A;  2VFZ A;  1OMX A;  4HO9 A;  1ZI1 A;  1HJL A;  5C38 A;  5CQP A;  3U0Y A;  5FU0 A;  1FG5 N;  1ZDG A;  1FGG A;  3SXD A;  3CGX A;  4CJC A;  5CMG X;  3GUE A;  2AEC A;  1WT2 A;  2FY7 A;  3E25 A;  3K8E A;  1NKH B;  4M2B A;  3IOI A;  3JUJ A;  2O1G A;  4HO2 A;  2OEF A;  4EE4 A;  4Y6U A;  2AES A;  2YQS A;  1LZ0 A;  2RJ4 A;  4XWI A;  1H5S A;  1SS9 A;  3OH0 A;  5EJZ A;  4FRB A;  4EEA A;  2ICX A;  1NQI B;  2RIZ A;  1S4P A;  1R82 A;  3U2U A;  1ZJ0 A;  3V0M A;  1R7U A;  1VM8 A;  2BO6 A;  3PKQ A;  4L41 C;  1H7T A;  3TQD A;  2GGQ A;  1EYR A;  2YES A;  1ON8 A;  4B42 A;  4D0Z A;  1ZI5 A;  1HM0 A;  2ZU7 A;  4HG6 A;  4Y7V A;  5C4E A;  2P72 A;  4Y62 A;  5CMH A;  2P73 A;  1HM9 A;  3DJ4 A;  4HOC A;  1H3M A;  1INJ A;  4AC3 A;  4BQH A;  4MND A;  3OGZ A;  4K6R A;  2YC5 A;  3CU0 A;  1WSZ A;  4FIY A;  5IDT A;  1R80 A;  1INI A;  4HO0 A;  1NWG B;  2RJ8 A;  1H5T A;  3E26 A;  3HL3 A;  3D98 A;  1ZJP A;  2XME A;  1LZ7 A;  3JUK A;  1JVG A;  4EEO A;  4CJ8 A;  4EE5 A;  1R7V A;  5CQO A;  4ZDQ A;  2C0N A;  2RJ1 A;  5D92 A;  4DDZ A;  3OH4 A;  1WT1 A;  2V0L A;  1ZCU A;  2D0J A;  2X5Z A;  5AJN A;  4D48 A;  1ZJ3 A;  2CU2 A;  3T7M A;  2UX8 A;  2RIX A;  1QGQ A;  2VS4 A;  1ZCV A;  1G3L A;  3OH2 A;  1R7Y A;  2XMH A;  1G95 A;  1H5S D;  2V0I A;  3SXG A;  1YP3 A;  3Q4S A;  4BMA A;  4KPX A;  2AM3 A;  2E3D A;  4M4K A;  4AYJ A;  3ZLK A;  4B2X A;  1TZF A;  3IOJ A;  2WGZ A;  2JCO A;  3I0D A;  4GBP A;  2A8U A;  1R7T A;  1H7H A;  3V0P A;  3QVB A;  1W77 A;  4B2W A;  2AM5 A;  5CMJ A;  4KT7 A;  2WVM A;  1Z90 A;  4FRO A;  3KIA A;  5J49 A;  1IIN A;  2VSH A;  3OKR A;  4Y7G A;  1ZJO A;  1H5R A;  1ZCY A;  3I0H A;  5C3D A;  4NAI A;  5AJO A;  2W0V A;  1FOA A;  2X65 A;  4B4M A;  3T7N A;  3I0I X;  4ECM A;  2XWL A;  1NHE B;  2E8B A;  3SXB A;  2PX7 A;  4FRL A;  1JV1 A;  1VGU A;  3SXE A;  2DPW A;  3EE5 A;  4JD0 A;  5IDS A;  2Y6P A;  2D7R A;  4MIX A;  1YP4 A;  4Q7C A;  2YCM A;  3IOH A;  4B5B A;  3DK5 A;  3N9W A;  3I0L A;  5CQL X;  1NF5 B;  3V0N A;  4NAL A;  2OI6 A;  1G1L A;  4FIX A;  4EVW A;  1O0R A;  4YS8 A;  4MYB A;  4B4G A;  3DUV A;  1H7Q A;  1H7F A;  1G2V A;  1MP4 A;  4HO4 A;  4IRQ A;  1WT3 A;  5C1L A;  3OH1 A;  1H4C A;  1V83 A;  1H4D A;  3I0C A;  4FRQ A;  3SPT A;  1ZIZ A;  1GQ9 A;  2NXV A;  3I0E A;  1LL3 A;  2VXL A;  5C1G A;  3U2T A;  3V90 A;  1VZU A;  3SX5 A;  1ZJ1 A;  2PGY A;  1FGX A;  2WEE A;  1GWW A;  3I0F A;  1H5S C;  1G9R A;  4M28 A;  2MZB A;  5CMF X;  1S4O A;  5C3B A;  1LZI A;  2D7I A;  2Y4L A;  3FWW A;  1VGZ A;  2OI5 A;  2W0W A;  4NAK A;  4Y6N A;  3V0Q A;  2BO8 A;  2V0K A;  2RJ0 A;  3I0K A;  2OEG A;  4Y7F A;  1JYK A;  1O7Q A;  4FCE A;  2FYB A;  1FR9 A;  3SX8 A;  3TZT A;  2JCK A;  1H4E A;  4R7P A;  1GX4 A;  3CKQ A;  4KRV A;  4P00 A;  1HJJ A;  2FFV A;  2WE9 A;  5FTV A;  1G23 A;  1ZJ2 A;  4CJB A;  5C8R A;  4B3U A;  5EJ1 A;  1VGT A;  3PNN A;  1GA8 A;  2Y4J A;  2FYA A;  5FUH A;  3OC9 A;  1FZW A;  2I5E A;  3OH3 A;  2AM4 A;  4CVH A;  3SX7 A;  4KQL A;  3CKJ A;  4D11 A;  3FOQ A;  1VH1 A;  1IIM A;  1G0R A;  1O7O A;  2ZU9 A;  3V91 A;  3ZGF A;  1VGW A;  4ASY A;  1JV3 A;  3ST8 A;  1ZI3 A;  5JQQ A;  1H5S B;  2YC3 A;  1TW1 A;  3I0G A;  5AJP A;  4HO8 A;  2Y4K A;  4HO5 A;  4AAW A;  1TW5 A;  2ICY A;  1FR8 A;  2BO4 A;  1FO9 A;  5C1H A;  3CKV A;  1GX0 A;  5FYE A;  4M2A A;  3LW6 A;  3USR A;  4LW3 A;  2PA4 A;  3PKP A;  4O6M A;  3U2V A;  1MC3 A;  5L6S A;  5FV9 A;  5C4F A;  5I1F A;  4KPZ A;  1OQM B;  4KC2 A;  2X5S A;  5DDT A;  2GGO A;  4UEG A;  1FWY A;  1K4V A;  1PZY B;  4DEC A;  1LVW A;  3SXA A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...