3V0MA

Crystal structure of the fucosylgalactoside alpha n-acetylgalactosaminyltransferase (gta, cisab mutant l266g, g268a) in complex with a novel udp-gal derived inhibitor (5gw) and h-antigen acceptor
Total Genus 97
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
97
sequence length
289
structure length
289
Chain Sequence
AIGEFMVSLPRMVYPQPKVLTPCRKDVLVVTPWLAPIVWEGTFNIDILNEQFRLQNTTIGLTVFAIKKYVAFLKLFLETAEKHFMVGHRVHYYVFTDQPAAVPRVTLGTGRQLSVLEVRAYKRWQDVSMRRMEMISDFCERRFLSEVDYLVCVDVDMEFRDHVGVEILTPLFGTLHPGFYGSSREAFTYERRPQSQAYIPKDEGDFYYGGAFFGGSVQEVQRLTRACHQAMMVDQANGIEAVWHDESHLNKYLLRHKPTKVLSPEYLWDQQLLGWPAVLRKLRFTAVPK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase/transferase inhibitor
molecule keywords Histo-blood group ABO system transferase
publication title Base-modified Donor Analogues Reveal Novel Dynamic Features of a Glycosyltransferase.
pubmed doi rcsb
source organism Homo sapiens
total genus 97
structure length 289
sequence length 289
chains with identical sequence B
ec nomenclature ec 2.4.1.37: Fucosylgalactoside 3-alpha-galactosyltransferase.
pdb deposition date 2011-12-08
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.550.10 Alpha Beta Alpha-Beta Complex Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A 3v0mA00
1H5SB 2QH5A 3SXCA 1ZJOA 5FU0A 4M28A 3I0DA 1R7VA 1G3LA 3RSBA 4Y6NA 3USRA 4NAIA 2A8WA 2ZU8A 4KNXA 1WT1A 4FRHA 4R7PA 4D0TA 2A8UA 1QGQA 1ON6A 1ZJ3A 2OI6A 2QKXA 3ZLLA 2FYCB 4D11A 3DK5A 3F1CA 1WT0A 3PKQA 1G9RA 1E5KA 2O1GA 3R3IA 5FU8A 1ZI3A 1H4EA 4KPZA 5C49A 1ZIZA 4HG6A 4B5BA 2VXMA 3I0LA 2ZU9A 1LVWA 3BCVA 2YC5A 1G0RA 1OQMB 3CKQA 3T7OA 3U0YA 1VZUA 1ON8A 3CKJA 5C1GA 1FXJA 4DE7A 5IDSA 1H7TA 2X5SA 3CGXA 4AC3A 2I5EA 2WAWA 1WVCA 2AH9A 5L6SA 2PGVA 1JYLA 4KRVA 4B42A 1H5SA 2Y4MA 2AE7A 4LW6A 2E8BA 2P73A 1H7HA 3SXGA 2RIYA 1I52A 1LZ0A 3TQDA 1QG8A 5CQLX 4FCUA 4HO4A 4KC4A 5C1LA 1NMMB 1VICA 5CMFX 1H7GA 2NXVA 2Z87A 4M2AA 2Z86A 3SPTA 1ZHJA 4E1KA 1ZI5A 5CQNX 3V90A 1V84A 1NF5B 1XZ6A 1ZJ1A 4J18A 1H7EA 4B2XA 1MP4A 2MZBA 4FRLA 3I0IX 5C47A 1HM0A 3HL3A 3NGWA 1V82A 2XMHA 1G2VA 1Z90A 3OH1A 4EE3A 3SX7A 2ICYA 1FR8A 3SXAA 2DPWA 3SX5A 4ZDQA 5AJNA 3CU0A 2ZU7A 1ZDGA 3Q80A 4G3PA 1QWJA 3OKRA 4G3SA 5FUHA 1R7YA 3U2VA 2BO7A 3POLA 1YP4A 5FTVA 3CKOA 3PNNA 2OI7A 1GWVA 4CVHA 2D7IA 2Q4JA 4AYLA 2AESA 4D48A 3SX8A 2WEEA 2VFZA 2JCOA 1FZWA 2FFVA 4ECMA 2I5KA 1G95A 1WSZA 1FWYA 1VH1A 3SXBA 3JTJA 3OH4A 4KNRA 4NANA 3I0JA 2ICXA 1OMXA 5L6VA 4L41C 4D11C 3OAMA 1LZIA 3DUVA 5C4BA 4B4MA 3EE5A 3OC9A 5C4EA 3TZTA 4EEOA 3Q4SA 1S4OA 4P02A 1ZI4A 5C4CA 1O0RA 1H4CA 1FGXA 2AGDA 3GUEA 4DDZA 5EJZA 1H7QA 2VS5A 4EEMA 3RMWA 1G1LA 1ZDFA 3V91A 2RJ1A 2RJ9A 3N9WA 4KC2A 2WVMA 3SXDA 1W77A 4KC1A 2RJ8A 2V0JA 1EZIA 2Y4KA 1FR9A 2E3DA 5DDVA 5C3AA 5EJ1A 4Y7VA 1WT3A 1ZJ0A 4EE4A 3ZGFA 2FYAA 2RITA 5C4FA 1MP3A 3V0PA 3IOIA 1LL0A 3I0KA 2WVLA 2Y6PA 4XWIA 2O1HA 4K6RA 2V0HA 1JV1A 1JVGA 3KIAA 1IINA 1VH3A 2W0WA 5C3BA 1IIMA 2JCKA 1H7FA 2YQHA 2VSHA 4ARWA 4G3QA 1R81A 3FOQA 1H7LA 1FRWA 2WVKA 4HOCA 1H3MA 1MC3A 4CJ8A 5FTSA 4MYBA 1NHEB 4P00A 4B4GA 1TVYA 4MNDA 2FYBA 3I0HA 4Y7GA 5C36A 2BO8A 1S4PA 1HJJA 1INIA 4FRQA 4BMAA 3DJ4A 2VD4A 4G87A 5C3DA 2APCA 4Y62A 3CKNA 1R7TA 4Y7FA 3V8ZA 1H4DA 3V0LA 2YESA 1H5RB 3I0FA 3U0XA 2D7RA 4LW3A 2RJ7A 3ZF8A 1GQCA 1VPAA 2PX7A 3ZGGA 5EIYA 2VS4A 1H5SD 2RIZA 1G23A 1KWSA 2W0VA 4HO6A 3FWWA 1VGUA 2WE9A 1GWWA 1LL3A 1O7OA 2BO4A 1VZXA 3PKPA 1K4VA 4Y9XA 1FG5N 3OGZA 2AM5A 2UX8A 3RMVA 2Y7AA 3E25A 2RIXA 1NKHB 2Y4LA 4FRBA 3BRKX 1FGGA 1VGZA 1ZCVA 2XMEA 3O3PA 4YS8A 1WT2A 1O23B 1R82A 2XWLA 5BXCA 1GA8A 1H5RA 1S4NA 3QVBA 2X60A 1NWGB 4DECA 4FRMA 2RJ0A 1PZTA 2WGZA 2QGIA 2XWNA 2OEGA 4JISA 1QGSA 5AJOA 1ZCUA 1JV3A 2FY7A 1ZJPA 2V0IA 5C4DA 3V0QA 1JYKA 1G8OA 4NALA 4FCEA 2D0JA 3I0CA 1O7QA 4ASYA 1R7UA 3U2TA 3ST8A 1YP2A 4M2BA 4FRDA 1FO8A 3U2XA 1H5SC 5HS2A 2VSIA 4HCQA 5FYEA 1YP3A 1H5TB 2GGOA 4FRPA 5CMHA 1TW1A 1G93A 3IOHA 3R2WA 4Y7TA 5CQMX 4HO9A 5DDTA 1LL2A 5AJPA 3T7NA 4FREA 3OH3A 4BQHA 1YROB 3IOJA 3OH2A 2AECA 1R7XA 1ZJ2A 4UEGA 2P6WA 1V83A 2RJ4A 2RJ6A 4KXOA 2JCLA 1FO9A 5C1HA 5C48A 4FRAA 5CQOA 4CJBA 5FV9A 2PA4A 1SS9A 1INJA 4Y7UA 2X5ZA 4HO3A 2PGYA 3I0GA 4AYJA 3E26A 3I0EA 1VGTA 1R80A 2YQJA 4KT7A 1VZTA 2VXLA 1FOAA 2YCMA 4IRPA 5JQQA 1GQ9A 3V0NA 1G97A 4HO8A 1EYRA 3D8VA 5CQPA 5C38A 2OI5A 1H5TA 1W57A 1GX4A 5IFYA 3U2UA 5C8RA 1HV9A 1VM8A 4Y64A 4FROA 4C2SA 1HM9A 2RJ5A 2AM3A 2O1FA 2OEFA 1FXOA 3Q7UA 4Y63A 4HO5A 2XWMA 1VGWA 4JD0A 3OH0A 4B4BA 1LZJA 1MP5A 4Y6UA 2JCJA 2AM4A 3V0OA 3JUJA 5CMGX 1PZYB 3CKVA 2V0KA 5IDTA 3D98A 4AAWA 3SXEA 5I1FA 4B2WA 4HO0A 2X65A 3JUKA 3K8DA 1ZCYA 3SX3A 4CJCA 2FFUA 1GX0A 4FQWA 4KQLA 4NAKA 5CMIA 1TZFA 1HM8A 1LZ7A 4GBPA 3F1YA 1TW5A 4ASJA 3LW6A 2P72A 2YQCA 4D0ZA 3ZLKA 1OMZA 2BO6A 4IRQA 3D5NA 2YQSA 1HJLA 4EEAA 3USQA 4KPXA 2V0LA 2YC3A 4HO2A 2I7BA 1ZI1A 5CMJA 4EE5A 5J49A 3T7MA 2CU2A 1ZCTA 2Y4JA 2GGQA 1JVDA 1NQIB 3V8YA 3V0MA 4M4KA 1XHBA 2VS3A 4B3UA 4EVWA 3K8EA 1W55A 2FYDB 4EEGA 3U2WA
chains in the Genus database with same CATH superfamily
1H5SB 2QH5A 3SXCA 1ZJOA 5FU0A 4M28A 3I0DA 1R7VA 1G3LA 3RSBA 4Y6NA 3USRA 4NAIA 2A8WA 2ZU8A 4KNXA 1WT1A 4FRHA 4R7PA 4D0TA 2A8UA 1QGQA 1ON6A 1ZJ3A 2OI6A 2QKXA 3ZLLA 2FYCB 4D11A 3DK5A 3F1CA 1WT0A 3PKQA 1G9RA 1E5KA 2O1GA 3R3IA 5FU8A 1ZI3A 1H4EA 4KPZA 5C49A 1ZIZA 4HG6A 4B5BA 2VXMA 3I0LA 2ZU9A 1LVWA 3BCVA 2YC5A 1G0RA 1OQMB 3CKQA 3T7OA 3U0YA 1VZUA 1ON8A 3CKJA 5C1GA 1FXJA 4DE7A 5IDSA 1H7TA 2X5SA 3CGXA 4AC3A 2I5EA 2WAWA 1WVCA 2AH9A 5L6SA 2PGVA 1JYLA 4KRVA 4B42A 1H5SA 2Y4MA 2AE7A 4LW6A 2E8BA 2P73A 1H7HA 3SXGA 2RIYA 1I52A 1LZ0A 3TQDA 1QG8A 5D91A 5CQLX 4FCUA 4HO4A 4KC4A 5C1LA 1NMMB 1VICA 5CMFX 1H7GA 2NXVA 2Z87A 4M2AA 2Z86A 3SPTA 1ZHJA 4E1KA 1ZI5A 5CQNX 3V90A 1V84A 1NF5B 1XZ6A 1ZJ1A 4J18A 1H7EA 4B2XA 1MP4A 2MZBA 4FRLA 3I0IX 5C47A 1HM0A 3HL3A 3NGWA 1V82A 2XMHA 1G2VA 1Z90A 3OH1A 4EE3A 3SX7A 2ICYA 1FR8A 3SXAA 2DPWA 3SX5A 4ZDQA 5AJNA 3CU0A 2ZU7A 1ZDGA 3Q80A 4G3PA 1QWJA 3OKRA 4G3SA 5FUHA 1R7YA 3U2VA 2BO7A 3POLA 1YP4A 5FTVA 3CKOA 3PNNA 2OI7A 1GWVA 4CVHA 2D7IA 2Q4JA 4AYLA 2AESA 4D48A 3SX8A 2C0NA 2WEEA 2VFZA 2JCOA 1FZWA 2FFVA 4ECMA 2I5KA 1G95A 1WSZA 1FWYA 1VH1A 3SXBA 3JTJA 3OH4A 4KNRA 4NANA 3I0JA 2ICXA 1OMXA 5L6VA 4L41C 4D11C 3OAMA 1LZIA 3DUVA 5C4BA 4B4MA 3EE5A 3OC9A 5C4EA 3TZTA 4EEOA 3Q4SA 1S4OA 4P02A 1ZI4A 5C4CA 1O0RA 1H4CA 1FGXA 2AGDA 3GUEA 4DDZA 5EJZA 1H7QA 2VS5A 4EEMA 3RMWA 1G1LA 1ZDFA 3V91A 2RJ1A 2RJ9A 3N9WA 4KC2A 2WVMA 3SXDA 1W77A 4KC1A 2RJ8A 2V0JA 2J0BA 1EZIA 2Y4KA 1FR9A 2E3DA 5DDVA 5C3AA 5EJ1A 4Y7VA 1WT3A 1ZJ0A 4EE4A 3ZGFA 2FYAA 2RITA 5C4FA 1MP3A 3V0PA 3IOIA 1LL0A 3I0KA 2WVLA 2Y6PA 4XWIA 2O1HA 4K6RA 2V0HA 1JV1A 1JVGA 3KIAA 1IINA 1VH3A 2W0WA 5C3BA 1IIMA 2JCKA 1H7FA 2YQHA 2VSHA 4MIXA 4ARWA 4G3QA 1R81A 3FOQA 1H7LA 1FRWA 2WVKA 4HOCA 1H3MA 1MC3A 4CJ8A 4O6MA 5FTSA 4MYBA 1NHEB 4P00A 4B4GA 1TVYA 4MNDA 2FYBA 3I0HA 4Y7GA 5C36A 2BO8A 1S4PA 1HJJA 1INIA 4FRQA 4BMAA 3DJ4A 2VD4A 4G87A 5C3DA 2APCA 4Y62A 3CKNA 1R7TA 4Y7FA 3V8ZA 1H4DA 3V0LA 2YESA 1H5RB 3I0FA 3U0XA 2D7RA 4LW3A 2RJ7A 3ZF8A 1GQCA 1VPAA 2PX7A 3ZGGA 5EIYA 2VS4A 1H5SD 2RIZA 1G23A 1KWSA 2W0VA 4HO6A 3FWWA 1VGUA 2WE9A 1GWWA 1LL3A 1O7OA 2BO4A 1VZXA 3PKPA 1K4VA 4Y9XA 1FG5N 3OGZA 2AM5A 2UX8A 3RMVA 4O6NA 2Y7AA 3E25A 2RIXA 1NKHB 2Y4LA 4FRBA 3BRKX 1FGGA 1VGZA 1ZCVA 4Q7CA 2XMEA 3O3PA 4YS8A 1WT2A 1O23B 1R82A 2VK9A 2XWLA 5BXCA 1GA8A 1H5RA 1S4NA 3QVBA 2X60A 1NWGB 4DECA 4FRMA 2RJ0A 1PZTA 2WGZA 2QGIA 2XWNA 2OEGA 4JISA 1QGSA 5AJOA 1ZCUA 1JV3A 2FY7A 1ZJPA 2V0IA 5C4DA 3V0QA 1JYKA 1G8OA 4NALA 4FCEA 2D0JA 3I0CA 1O7QA 4ASYA 1R7UA 3U2TA 3ST8A 1YP2A 4M2BA 4FRDA 1FO8A 3U2XA 1H5SC 5HS2A 2VSIA 4HCQA 5FYEA 1YP3A 1H5TB 2GGOA 4FRPA 5CMHA 1TW1A 1G93A 3IOHA 3R2WA 4Y7TA 5CQMX 4HO9A 5DDTA 1LL2A 5AJPA 3T7NA 4FREA 3OH3A 5D92A 4BQHA 1YROB 3IOJA 3OH2A 2AECA 1R7XA 1ZJ2A 4UEGA 2P6WA 1V83A 2RJ4A 2RJ6A 4KXOA 2JCLA 1FO9A 5C1HA 5C48A 4FRAA 5CQOA 4CJBA 5FV9A 2PA4A 1SS9A 1INJA 4Y7UA 2X5ZA 4HO3A 2PGYA 3I0GA 4AYJA 3E26A 3I0EA 1VGTA 1R80A 2YQJA 4KT7A 1VZTA 2VXLA 1FOAA 2YCMA 4IRPA 5JQQA 1GQ9A 3V0NA 1G97A 4HO8A 1EYRA 3D8VA 5CQPA 5C38A 2OI5A 1H5TA 1W57A 1GX4A 5IFYA 3U2UA 5C8RA 1HV9A 1VM8A 4Y64A 4FROA 4C2SA 1HM9A 2RJ5A 2AM3A 2O1FA 2OEFA 1FXOA 3Q7UA 4Y63A 4HO5A 2XWMA 1VGWA 4JD0A 3OH0A 4B4BA 1LZJA 1MP5A 4Y6UA 2JCJA 2AM4A 3V0OA 3JUJA 5CMGX 1PZYB 3CKVA 2V0KA 5IDTA 3D98A 4AAWA 4FIXA 4FIYA 3SXEA 5I1FA 4B2WA 4HO0A 2X65A 3JUKA 3K8DA 1ZCYA 3SX3A 4CJCA 2FFUA 1GX0A 4FQWA 4KQLA 4NAKA 5CMIA 1TZFA 1HM8A 1LZ7A 4GBPA 3F1YA 1TW5A 4ASJA 3LW6A 2P72A 2YQCA 4D0ZA 3ZLKA 1OMZA 2BO6A 4IRQA 2J0AA 3D5NA 2YQSA 1HJLA 4EEAA 3USQA 4KPXA 2V0LA 2YC3A 4HO2A 2I7BA 1ZI1A 5CMJA 4EE5A 5J49A 3T7MA 2CU2A 1ZCTA 2Y4JA 2GGQA 1JVDA 1NQIB 3V8YA 3V0MA 4M4KA 1XHBA 2VS3A 4B3UA 4EVWA 3K8EA 1W55A 2FYDB 4EEGA 3U2WA
chains in the Genus database with same CATH topology
1H5SB 2QH5A 3SXCA 1ZJOA 5FU0A 4M28A 3I0DA 1R7VA 1G3LA 3RSBA 4Y6NA 3USRA 4NAIA 2A8WA 2ZU8A 4KNXA 1WT1A 4FRHA 4R7PA 4D0TA 2A8UA 1QGQA 1ON6A 1ZJ3A 2OI6A 2QKXA 3ZLLA 2FYCB 4D11A 3DK5A 3F1CA 1WT0A 3PKQA 1G9RA 1E5KA 2O1GA 3R3IA 5FU8A 1ZI3A 1H4EA 4KPZA 5C49A 1ZIZA 4HG6A 4B5BA 2VXMA 3I0LA 2ZU9A 1LVWA 3BCVA 2YC5A 1G0RA 1OQMB 3CKQA 3T7OA 3U0YA 1VZUA 1ON8A 3CKJA 5C1GA 1FXJA 4DE7A 5IDSA 1H7TA 2X5SA 3CGXA 4AC3A 2I5EA 2WAWA 1WVCA 2AH9A 5L6SA 2PGVA 1JYLA 4KRVA 4B42A 1H5SA 2Y4MA 2AE7A 4LW6A 2E8BA 2P73A 1H7HA 3SXGA 2RIYA 1I52A 1LZ0A 3TQDA 1QG8A 5D91A 5CQLX 4FCUA 4HO4A 4KC4A 5C1LA 1NMMB 1VICA 5CMFX 1H7GA 2NXVA 2Z87A 4M2AA 2Z86A 3SPTA 1ZHJA 4E1KA 1ZI5A 5CQNX 3V90A 1V84A 1NF5B 1XZ6A 1ZJ1A 4J18A 1H7EA 4B2XA 1MP4A 2MZBA 4FRLA 3I0IX 5C47A 1HM0A 3HL3A 3NGWA 1V82A 2XMHA 1G2VA 1Z90A 3OH1A 4EE3A 3SX7A 2ICYA 1FR8A 3SXAA 2DPWA 3SX5A 4ZDQA 5AJNA 3CU0A 2ZU7A 1ZDGA 3Q80A 4G3PA 1QWJA 3OKRA 4G3SA 5FUHA 1R7YA 3U2VA 2BO7A 3POLA 1YP4A 5FTVA 3CKOA 3PNNA 2OI7A 1GWVA 4CVHA 2D7IA 2Q4JA 4AYLA 2AESA 4D48A 3SX8A 2C0NA 2WEEA 2VFZA 2JCOA 1FZWA 2FFVA 4ECMA 2I5KA 1G95A 1WSZA 1FWYA 1VH1A 3SXBA 3JTJA 3OH4A 4KNRA 4NANA 3I0JA 2ICXA 1OMXA 5L6VA 4L41C 4D11C 3OAMA 1LZIA 3DUVA 5C4BA 4B4MA 3EE5A 3OC9A 5C4EA 3TZTA 4EEOA 3Q4SA 1S4OA 4P02A 1ZI4A 5C4CA 1O0RA 1H4CA 1FGXA 2AGDA 3GUEA 4DDZA 5EJZA 1H7QA 2VS5A 4EEMA 3RMWA 1G1LA 1ZDFA 3V91A 2RJ1A 2RJ9A 3N9WA 4KC2A 2WVMA 3SXDA 1W77A 4KC1A 2RJ8A 2V0JA 2J0BA 1EZIA 2Y4KA 1FR9A 2E3DA 5DDVA 5C3AA 5EJ1A 4Y7VA 1WT3A 1ZJ0A 4EE4A 3ZGFA 2FYAA 2RITA 5C4FA 1MP3A 3V0PA 3IOIA 1LL0A 3I0KA 2WVLA 2Y6PA 4XWIA 2O1HA 4K6RA 2V0HA 1JV1A 1JVGA 3KIAA 1IINA 1VH3A 2W0WA 5C3BA 1IIMA 2JCKA 1H7FA 2YQHA 2VSHA 4MIXA 4ARWA 4G3QA 1R81A 3FOQA 1H7LA 1FRWA 2WVKA 4HOCA 1H3MA 1MC3A 4CJ8A 4O6MA 5FTSA 4MYBA 1NHEB 4P00A 4B4GA 1TVYA 4MNDA 2FYBA 3I0HA 4Y7GA 5C36A 2BO8A 1S4PA 1HJJA 1INIA 4FRQA 4BMAA 3DJ4A 2VD4A 4G87A 5C3DA 2APCA 4Y62A 3CKNA 1R7TA 4Y7FA 3V8ZA 1H4DA 3V0LA 2YESA 1H5RB 3I0FA 3U0XA 2D7RA 4LW3A 2RJ7A 3ZF8A 1GQCA 1VPAA 2PX7A 3ZGGA 5EIYA 2VS4A 1H5SD 2RIZA 1G23A 1KWSA 2W0VA 4HO6A 3FWWA 1VGUA 2WE9A 1GWWA 1LL3A 1O7OA 2BO4A 1VZXA 3PKPA 1K4VA 4Y9XA 1FG5N 3OGZA 2AM5A 2UX8A 3RMVA 4O6NA 2Y7AA 3E25A 2RIXA 1NKHB 2Y4LA 4FRBA 3BRKX 1FGGA 1VGZA 1ZCVA 4Q7CA 2XMEA 3O3PA 4YS8A 1WT2A 1O23B 1R82A 2VK9A 2XWLA 5BXCA 1GA8A 1H5RA 1S4NA 3QVBA 2X60A 1NWGB 4DECA 4FRMA 2RJ0A 1PZTA 2WGZA 2QGIA 2XWNA 2OEGA 4JISA 1QGSA 5AJOA 1ZCUA 1JV3A 2FY7A 1ZJPA 2V0IA 5C4DA 3V0QA 1JYKA 1G8OA 4NALA 4FCEA 2D0JA 3I0CA 1O7QA 4ASYA 1R7UA 3U2TA 3ST8A 1YP2A 4M2BA 4FRDA 1FO8A 3U2XA 1H5SC 5HS2A 2VSIA 4HCQA 5FYEA 1YP3A 1H5TB 2GGOA 4FRPA 5CMHA 1TW1A 1G93A 3IOHA 3R2WA 4Y7TA 5CQMX 4HO9A 5DDTA 1LL2A 5AJPA 3T7NA 4FREA 3OH3A 5D92A 4BQHA 1YROB 3IOJA 3OH2A 2AECA 1R7XA 1ZJ2A 4UEGA 2P6WA 1V83A 2RJ4A 2RJ6A 4KXOA 2JCLA 1FO9A 5C1HA 5C48A 4FRAA 5CQOA 4CJBA 5FV9A 2PA4A 1SS9A 1INJA 4Y7UA 2X5ZA 4HO3A 2PGYA 3I0GA 4AYJA 3E26A 3I0EA 1VGTA 1R80A 2YQJA 4KT7A 1VZTA 2VXLA 1FOAA 2YCMA 4IRPA 5JQQA 1GQ9A 3V0NA 1G97A 4HO8A 1EYRA 3D8VA 5CQPA 5C38A 2OI5A 1H5TA 1W57A 1GX4A 5IFYA 3U2UA 5C8RA 1HV9A 1VM8A 4Y64A 4FROA 4C2SA 1HM9A 2RJ5A 2AM3A 2O1FA 2OEFA 1FXOA 3Q7UA 4Y63A 4HO5A 2XWMA 1VGWA 4JD0A 3OH0A 4B4BA 1LZJA 1MP5A 4Y6UA 2JCJA 2AM4A 3V0OA 3JUJA 5CMGX 1PZYB 3CKVA 2V0KA 5IDTA 3D98A 4AAWA 4FIXA 4FIYA 3SXEA 5I1FA 4B2WA 4HO0A 2X65A 3JUKA 3K8DA 1ZCYA 3SX3A 4CJCA 2FFUA 1GX0A 4FQWA 4KQLA 4NAKA 5CMIA 1TZFA 1HM8A 1LZ7A 4GBPA 3F1YA 1TW5A 4ASJA 3LW6A 2P72A 2YQCA 4D0ZA 3ZLKA 1OMZA 2BO6A 4IRQA 2J0AA 3D5NA 2YQSA 1HJLA 4EEAA 3USQA 4KPXA 2V0LA 2YC3A 4HO2A 2I7BA 1ZI1A 5CMJA 4EE5A 5J49A 3T7MA 2CU2A 1ZCTA 2Y4JA 2GGQA 1JVDA 1NQIB 3V8YA 3V0MA 4M4KA 1XHBA 2VS3A 4B3UA 4EVWA 3K8EA 1W55A 2FYDB 4EEGA 3U2WA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1H5S B;  2QH5 A;  3SXC A;  1ZJO A;  5FU0 A;  4M28 A;  3I0D A;  1R7V A;  1G3L A;  3RSB A;  4Y6N A;  3USR A;  4NAI A;  2A8W A;  2ZU8 A;  4KNX A;  1WT1 A;  4FRH A;  4R7P A;  4D0T A;  2A8U A;  1QGQ A;  1ON6 A;  1ZJ3 A;  2OI6 A;  2QKX A;  3ZLL A;  2FYC B;  4D11 A;  3DK5 A;  3F1C A;  1WT0 A;  3PKQ A;  1G9R A;  1E5K A;  2O1G A;  3R3I A;  5FU8 A;  1ZI3 A;  1H4E A;  4KPZ A;  5C49 A;  1ZIZ A;  4HG6 A;  4B5B A;  2VXM A;  3I0L A;  2ZU9 A;  1LVW A;  3BCV A;  2YC5 A;  1G0R A;  1OQM B;  3CKQ A;  3T7O A;  3U0Y A;  1VZU A;  1ON8 A;  3CKJ A;  5C1G A;  1FXJ A;  4DE7 A;  5IDS A;  1H7T A;  2X5S A;  3CGX A;  4AC3 A;  2I5E A;  2WAW A;  1WVC A;  2AH9 A;  5L6S A;  2PGV A;  1JYL A;  4KRV A;  4B42 A;  1H5S A;  2Y4M A;  2AE7 A;  4LW6 A;  2E8B A;  2P73 A;  1H7H A;  3SXG A;  2RIY A;  1I52 A;  1LZ0 A;  3TQD A;  1QG8 A;  5CQL X;  4FCU A;  4HO4 A;  4KC4 A;  5C1L A;  1NMM B;  1VIC A;  5CMF X;  1H7G A;  2NXV A;  2Z87 A;  4M2A A;  2Z86 A;  3SPT A;  1ZHJ A;  4E1K A;  1ZI5 A;  5CQN X;  3V90 A;  1V84 A;  1NF5 B;  1XZ6 A;  1ZJ1 A;  4J18 A;  1H7E A;  4B2X A;  1MP4 A;  2MZB A;  4FRL A;  3I0I X;  5C47 A;  1HM0 A;  3HL3 A;  3NGW A;  1V82 A;  2XMH A;  1G2V A;  1Z90 A;  3OH1 A;  4EE3 A;  3SX7 A;  2ICY A;  1FR8 A;  3SXA A;  2DPW A;  3SX5 A;  4ZDQ A;  5AJN A;  3CU0 A;  2ZU7 A;  1ZDG A;  3Q80 A;  4G3P A;  1QWJ A;  3OKR A;  4G3S A;  5FUH A;  1R7Y A;  3U2V A;  2BO7 A;  3POL A;  1YP4 A;  5FTV A;  3CKO A;  3PNN A;  2OI7 A;  1GWV A;  4CVH A;  2D7I A;  2Q4J A;  4AYL A;  2AES A;  4D48 A;  3SX8 A;  2WEE A;  2VFZ A;  2JCO A;  1FZW A;  2FFV A;  4ECM A;  2I5K A;  1G95 A;  1WSZ A;  1FWY A;  1VH1 A;  3SXB A;  3JTJ A;  3OH4 A;  4KNR A;  4NAN A;  3I0J A;  2ICX A;  1OMX A;  5L6V A;  4L41 C;  4D11 C;  3OAM A;  1LZI A;  3DUV A;  5C4B A;  4B4M A;  3EE5 A;  3OC9 A;  5C4E A;  3TZT A;  4EEO A;  3Q4S A;  1S4O A;  4P02 A;  1ZI4 A;  5C4C A;  1O0R A;  1H4C A;  1FGX A;  2AGD A;  3GUE A;  4DDZ A;  5EJZ A;  1H7Q A;  2VS5 A;  4EEM A;  3RMW A;  1G1L A;  1ZDF A;  3V91 A;  2RJ1 A;  2RJ9 A;  3N9W A;  4KC2 A;  2WVM A;  3SXD A;  1W77 A;  4KC1 A;  2RJ8 A;  2V0J A;  1EZI A;  2Y4K A;  1FR9 A;  2E3D A;  5DDV A;  5C3A A;  5EJ1 A;  4Y7V A;  1WT3 A;  1ZJ0 A;  4EE4 A;  3ZGF A;  2FYA A;  2RIT A;  5C4F A;  1MP3 A;  3V0P A;  3IOI A;  1LL0 A;  3I0K A;  2WVL A;  2Y6P A;  4XWI A;  2O1H A;  4K6R A;  2V0H A;  1JV1 A;  1JVG A;  3KIA A;  1IIN A;  1VH3 A;  2W0W A;  5C3B A;  1IIM A;  2JCK A;  1H7F A;  2YQH A;  2VSH A;  4ARW A;  4G3Q A;  1R81 A;  3FOQ A;  1H7L A;  1FRW A;  2WVK A;  4HOC A;  1H3M A;  1MC3 A;  4CJ8 A;  5FTS A;  4MYB A;  1NHE B;  4P00 A;  4B4G A;  1TVY A;  4MND A;  2FYB A;  3I0H A;  4Y7G A;  5C36 A;  2BO8 A;  1S4P A;  1HJJ A;  1INI A;  4FRQ A;  4BMA A;  3DJ4 A;  2VD4 A;  4G87 A;  5C3D A;  2APC A;  4Y62 A;  3CKN A;  1R7T A;  4Y7F A;  3V8Z A;  1H4D A;  3V0L A;  2YES A;  1H5R B;  3I0F A;  3U0X A;  2D7R A;  4LW3 A;  2RJ7 A;  3ZF8 A;  1GQC A;  1VPA A;  2PX7 A;  3ZGG A;  5EIY A;  2VS4 A;  1H5S D;  2RIZ A;  1G23 A;  1KWS A;  2W0V A;  4HO6 A;  3FWW A;  1VGU A;  2WE9 A;  1GWW A;  1LL3 A;  1O7O A;  2BO4 A;  1VZX A;  3PKP A;  1K4V A;  4Y9X A;  1FG5 N;  3OGZ A;  2AM5 A;  2UX8 A;  3RMV A;  2Y7A A;  3E25 A;  2RIX A;  1NKH B;  2Y4L A;  4FRB A;  3BRK X;  1FGG A;  1VGZ A;  1ZCV A;  2XME A;  3O3P A;  4YS8 A;  1WT2 A;  1O23 B;  1R82 A;  2XWL A;  5BXC A;  1GA8 A;  1H5R A;  1S4N A;  3QVB A;  2X60 A;  1NWG B;  4DEC A;  4FRM A;  2RJ0 A;  1PZT A;  2WGZ A;  2QGI A;  2XWN A;  2OEG A;  4JIS A;  1QGS A;  5AJO A;  1ZCU A;  1JV3 A;  2FY7 A;  1ZJP A;  2V0I A;  5C4D A;  3V0Q A;  1JYK A;  1G8O A;  4NAL A;  4FCE A;  2D0J A;  3I0C A;  1O7Q A;  4ASY A;  1R7U A;  3U2T A;  3ST8 A;  1YP2 A;  4M2B A;  4FRD A;  1FO8 A;  3U2X A;  1H5S C;  5HS2 A;  2VSI A;  4HCQ A;  5FYE A;  1YP3 A;  1H5T B;  2GGO A;  4FRP A;  5CMH A;  1TW1 A;  1G93 A;  3IOH A;  3R2W A;  4Y7T A;  5CQM X;  4HO9 A;  5DDT A;  1LL2 A;  5AJP A;  3T7N A;  4FRE A;  3OH3 A;  4BQH A;  1YRO B;  3IOJ A;  3OH2 A;  2AEC A;  1R7X A;  1ZJ2 A;  4UEG A;  2P6W A;  1V83 A;  2RJ4 A;  2RJ6 A;  4KXO A;  2JCL A;  1FO9 A;  5C1H A;  5C48 A;  4FRA A;  5CQO A;  4CJB A;  5FV9 A;  2PA4 A;  1SS9 A;  1INJ A;  4Y7U A;  2X5Z A;  4HO3 A;  2PGY A;  3I0G A;  4AYJ A;  3E26 A;  3I0E A;  1VGT A;  1R80 A;  2YQJ A;  4KT7 A;  1VZT A;  2VXL A;  1FOA A;  2YCM A;  4IRP A;  5JQQ A;  1GQ9 A;  3V0N A;  1G97 A;  4HO8 A;  1EYR A;  3D8V A;  5CQP A;  5C38 A;  2OI5 A;  1H5T A;  1W57 A;  1GX4 A;  5IFY A;  3U2U A;  5C8R A;  1HV9 A;  1VM8 A;  4Y64 A;  4FRO A;  4C2S A;  1HM9 A;  2RJ5 A;  2AM3 A;  2O1F A;  2OEF A;  1FXO A;  3Q7U A;  4Y63 A;  4HO5 A;  2XWM A;  1VGW A;  4JD0 A;  3OH0 A;  4B4B A;  1LZJ A;  1MP5 A;  4Y6U A;  2JCJ A;  2AM4 A;  3V0O A;  3JUJ A;  5CMG X;  1PZY B;  3CKV A;  2V0K A;  5IDT A;  3D98 A;  4AAW A;  3SXE A;  5I1F A;  4B2W A;  4HO0 A;  2X65 A;  3JUK A;  3K8D A;  1ZCY A;  3SX3 A;  4CJC A;  2FFU A;  1GX0 A;  4FQW A;  4KQL A;  4NAK A;  5CMI A;  1TZF A;  1HM8 A;  1LZ7 A;  4GBP A;  3F1Y A;  1TW5 A;  4ASJ A;  3LW6 A;  2P72 A;  2YQC A;  4D0Z A;  3ZLK A;  1OMZ A;  2BO6 A;  4IRQ A;  3D5N A;  2YQS A;  1HJL A;  4EEA A;  3USQ A;  4KPX A;  2V0L A;  2YC3 A;  4HO2 A;  2I7B A;  1ZI1 A;  5CMJ A;  4EE5 A;  5J49 A;  3T7M A;  2CU2 A;  1ZCT A;  2Y4J A;  2GGQ A;  1JVD A;  1NQI B;  3V8Y A;  3V0M A;  4M4K A;  1XHB A;  2VS3 A;  4B3U A;  4EVW A;  3K8E A;  1W55 A;  2FYD B;  4EEG A;  3U2W A; 
#chains in the Genus database with same CATH topology
 1H5S B;  2QH5 A;  3SXC A;  1ZJO A;  5FU0 A;  4M28 A;  3I0D A;  1R7V A;  1G3L A;  3RSB A;  4Y6N A;  3USR A;  4NAI A;  2A8W A;  2ZU8 A;  4KNX A;  1WT1 A;  4FRH A;  4R7P A;  4D0T A;  2A8U A;  1QGQ A;  1ON6 A;  1ZJ3 A;  2OI6 A;  2QKX A;  3ZLL A;  2FYC B;  4D11 A;  3DK5 A;  3F1C A;  1WT0 A;  3PKQ A;  1G9R A;  1E5K A;  2O1G A;  3R3I A;  5FU8 A;  1ZI3 A;  1H4E A;  4KPZ A;  5C49 A;  1ZIZ A;  4HG6 A;  4B5B A;  2VXM A;  3I0L A;  2ZU9 A;  1LVW A;  3BCV A;  2YC5 A;  1G0R A;  1OQM B;  3CKQ A;  3T7O A;  3U0Y A;  1VZU A;  1ON8 A;  3CKJ A;  5C1G A;  1FXJ A;  4DE7 A;  5IDS A;  1H7T A;  2X5S A;  3CGX A;  4AC3 A;  2I5E A;  2WAW A;  1WVC A;  2AH9 A;  5L6S A;  2PGV A;  1JYL A;  4KRV A;  4B42 A;  1H5S A;  2Y4M A;  2AE7 A;  4LW6 A;  2E8B A;  2P73 A;  1H7H A;  3SXG A;  2RIY A;  1I52 A;  1LZ0 A;  3TQD A;  1QG8 A;  5D91 A;  5CQL X;  4FCU A;  4HO4 A;  4KC4 A;  5C1L A;  1NMM B;  1VIC A;  5CMF X;  1H7G A;  2NXV A;  2Z87 A;  4M2A A;  2Z86 A;  3SPT A;  1ZHJ A;  4E1K A;  1ZI5 A;  5CQN X;  3V90 A;  1V84 A;  1NF5 B;  1XZ6 A;  1ZJ1 A;  4J18 A;  1H7E A;  4B2X A;  1MP4 A;  2MZB A;  4FRL A;  3I0I X;  5C47 A;  1HM0 A;  3HL3 A;  3NGW A;  1V82 A;  2XMH A;  1G2V A;  1Z90 A;  3OH1 A;  4EE3 A;  3SX7 A;  2ICY A;  1FR8 A;  3SXA A;  2DPW A;  3SX5 A;  4ZDQ A;  5AJN A;  3CU0 A;  2ZU7 A;  1ZDG A;  3Q80 A;  4G3P A;  1QWJ A;  3OKR A;  4G3S A;  5FUH A;  1R7Y A;  3U2V A;  2BO7 A;  3POL A;  1YP4 A;  5FTV A;  3CKO A;  3PNN A;  2OI7 A;  1GWV A;  4CVH A;  2D7I A;  2Q4J A;  4AYL A;  2AES A;  4D48 A;  3SX8 A;  2C0N A;  2WEE A;  2VFZ A;  2JCO A;  1FZW A;  2FFV A;  4ECM A;  2I5K A;  1G95 A;  1WSZ A;  1FWY A;  1VH1 A;  3SXB A;  3JTJ A;  3OH4 A;  4KNR A;  4NAN A;  3I0J A;  2ICX A;  1OMX A;  5L6V A;  4L41 C;  4D11 C;  3OAM A;  1LZI A;  3DUV A;  5C4B A;  4B4M A;  3EE5 A;  3OC9 A;  5C4E A;  3TZT A;  4EEO A;  3Q4S A;  1S4O A;  4P02 A;  1ZI4 A;  5C4C A;  1O0R A;  1H4C A;  1FGX A;  2AGD A;  3GUE A;  4DDZ A;  5EJZ A;  1H7Q A;  2VS5 A;  4EEM A;  3RMW A;  1G1L A;  1ZDF A;  3V91 A;  2RJ1 A;  2RJ9 A;  3N9W A;  4KC2 A;  2WVM A;  3SXD A;  1W77 A;  4KC1 A;  2RJ8 A;  2V0J A;  2J0B A;  1EZI A;  2Y4K A;  1FR9 A;  2E3D A;  5DDV A;  5C3A A;  5EJ1 A;  4Y7V A;  1WT3 A;  1ZJ0 A;  4EE4 A;  3ZGF A;  2FYA A;  2RIT A;  5C4F A;  1MP3 A;  3V0P A;  3IOI A;  1LL0 A;  3I0K A;  2WVL A;  2Y6P A;  4XWI A;  2O1H A;  4K6R A;  2V0H A;  1JV1 A;  1JVG A;  3KIA A;  1IIN A;  1VH3 A;  2W0W A;  5C3B A;  1IIM A;  2JCK A;  1H7F A;  2YQH A;  2VSH A;  4MIX A;  4ARW A;  4G3Q A;  1R81 A;  3FOQ A;  1H7L A;  1FRW A;  2WVK A;  4HOC A;  1H3M A;  1MC3 A;  4CJ8 A;  4O6M A;  5FTS A;  4MYB A;  1NHE B;  4P00 A;  4B4G A;  1TVY A;  4MND A;  2FYB A;  3I0H A;  4Y7G A;  5C36 A;  2BO8 A;  1S4P A;  1HJJ A;  1INI A;  4FRQ A;  4BMA A;  3DJ4 A;  2VD4 A;  4G87 A;  5C3D A;  2APC A;  4Y62 A;  3CKN A;  1R7T A;  4Y7F A;  3V8Z A;  1H4D A;  3V0L A;  2YES A;  1H5R B;  3I0F A;  3U0X A;  2D7R A;  4LW3 A;  2RJ7 A;  3ZF8 A;  1GQC A;  1VPA A;  2PX7 A;  3ZGG A;  5EIY A;  2VS4 A;  1H5S D;  2RIZ A;  1G23 A;  1KWS A;  2W0V A;  4HO6 A;  3FWW A;  1VGU A;  2WE9 A;  1GWW A;  1LL3 A;  1O7O A;  2BO4 A;  1VZX A;  3PKP A;  1K4V A;  4Y9X A;  1FG5 N;  3OGZ A;  2AM5 A;  2UX8 A;  3RMV A;  4O6N A;  2Y7A A;  3E25 A;  2RIX A;  1NKH B;  2Y4L A;  4FRB A;  3BRK X;  1FGG A;  1VGZ A;  1ZCV A;  4Q7C A;  2XME A;  3O3P A;  4YS8 A;  1WT2 A;  1O23 B;  1R82 A;  2VK9 A;  2XWL A;  5BXC A;  1GA8 A;  1H5R A;  1S4N A;  3QVB A;  2X60 A;  1NWG B;  4DEC A;  4FRM A;  2RJ0 A;  1PZT A;  2WGZ A;  2QGI A;  2XWN A;  2OEG A;  4JIS A;  1QGS A;  5AJO A;  1ZCU A;  1JV3 A;  2FY7 A;  1ZJP A;  2V0I A;  5C4D A;  3V0Q A;  1JYK A;  1G8O A;  4NAL A;  4FCE A;  2D0J A;  3I0C A;  1O7Q A;  4ASY A;  1R7U A;  3U2T A;  3ST8 A;  1YP2 A;  4M2B A;  4FRD A;  1FO8 A;  3U2X A;  1H5S C;  5HS2 A;  2VSI A;  4HCQ A;  5FYE A;  1YP3 A;  1H5T B;  2GGO A;  4FRP A;  5CMH A;  1TW1 A;  1G93 A;  3IOH A;  3R2W A;  4Y7T A;  5CQM X;  4HO9 A;  5DDT A;  1LL2 A;  5AJP A;  3T7N A;  4FRE A;  3OH3 A;  5D92 A;  4BQH A;  1YRO B;  3IOJ A;  3OH2 A;  2AEC A;  1R7X A;  1ZJ2 A;  4UEG A;  2P6W A;  1V83 A;  2RJ4 A;  2RJ6 A;  4KXO A;  2JCL A;  1FO9 A;  5C1H A;  5C48 A;  4FRA A;  5CQO A;  4CJB A;  5FV9 A;  2PA4 A;  1SS9 A;  1INJ A;  4Y7U A;  2X5Z A;  4HO3 A;  2PGY A;  3I0G A;  4AYJ A;  3E26 A;  3I0E A;  1VGT A;  1R80 A;  2YQJ A;  4KT7 A;  1VZT A;  2VXL A;  1FOA A;  2YCM A;  4IRP A;  5JQQ A;  1GQ9 A;  3V0N A;  1G97 A;  4HO8 A;  1EYR A;  3D8V A;  5CQP A;  5C38 A;  2OI5 A;  1H5T A;  1W57 A;  1GX4 A;  5IFY A;  3U2U A;  5C8R A;  1HV9 A;  1VM8 A;  4Y64 A;  4FRO A;  4C2S A;  1HM9 A;  2RJ5 A;  2AM3 A;  2O1F A;  2OEF A;  1FXO A;  3Q7U A;  4Y63 A;  4HO5 A;  2XWM A;  1VGW A;  4JD0 A;  3OH0 A;  4B4B A;  1LZJ A;  1MP5 A;  4Y6U A;  2JCJ A;  2AM4 A;  3V0O A;  3JUJ A;  5CMG X;  1PZY B;  3CKV A;  2V0K A;  5IDT A;  3D98 A;  4AAW A;  4FIX A;  4FIY A;  3SXE A;  5I1F A;  4B2W A;  4HO0 A;  2X65 A;  3JUK A;  3K8D A;  1ZCY A;  3SX3 A;  4CJC A;  2FFU A;  1GX0 A;  4FQW A;  4KQL A;  4NAK A;  5CMI A;  1TZF A;  1HM8 A;  1LZ7 A;  4GBP A;  3F1Y A;  1TW5 A;  4ASJ A;  3LW6 A;  2P72 A;  2YQC A;  4D0Z A;  3ZLK A;  1OMZ A;  2BO6 A;  4IRQ A;  2J0A A;  3D5N A;  2YQS A;  1HJL A;  4EEA A;  3USQ A;  4KPX A;  2V0L A;  2YC3 A;  4HO2 A;  2I7B A;  1ZI1 A;  5CMJ A;  4EE5 A;  5J49 A;  3T7M A;  2CU2 A;  1ZCT A;  2Y4J A;  2GGQ A;  1JVD A;  1NQI B;  3V8Y A;  3V0M A;  4M4K A;  1XHB A;  2VS3 A;  4B3U A;  4EVW A;  3K8E A;  1W55 A;  2FYD B;  4EEG A;  3U2W A; 
#chains in the Genus database with same CATH homology
 1H5S B;  2QH5 A;  3SXC A;  1ZJO A;  5FU0 A;  4M28 A;  3I0D A;  1R7V A;  1G3L A;  3RSB A;  4Y6N A;  3USR A;  4NAI A;  2A8W A;  2ZU8 A;  4KNX A;  1WT1 A;  4FRH A;  4R7P A;  4D0T A;  2A8U A;  1QGQ A;  1ON6 A;  1ZJ3 A;  2OI6 A;  2QKX A;  3ZLL A;  2FYC B;  4D11 A;  3DK5 A;  3F1C A;  1WT0 A;  3PKQ A;  1G9R A;  1E5K A;  2O1G A;  3R3I A;  5FU8 A;  1ZI3 A;  1H4E A;  4KPZ A;  5C49 A;  1ZIZ A;  4HG6 A;  4B5B A;  2VXM A;  3I0L A;  2ZU9 A;  1LVW A;  3BCV A;  2YC5 A;  1G0R A;  1OQM B;  3CKQ A;  3T7O A;  3U0Y A;  1VZU A;  1ON8 A;  3CKJ A;  5C1G A;  1FXJ A;  4DE7 A;  5IDS A;  1H7T A;  2X5S A;  3CGX A;  4AC3 A;  2I5E A;  2WAW A;  1WVC A;  2AH9 A;  5L6S A;  2PGV A;  1JYL A;  4KRV A;  4B42 A;  1H5S A;  2Y4M A;  2AE7 A;  4LW6 A;  2E8B A;  2P73 A;  1H7H A;  3SXG A;  2RIY A;  1I52 A;  1LZ0 A;  3TQD A;  1QG8 A;  5D91 A;  5CQL X;  4FCU A;  4HO4 A;  4KC4 A;  5C1L A;  1NMM B;  1VIC A;  5CMF X;  1H7G A;  2NXV A;  2Z87 A;  4M2A A;  2Z86 A;  3SPT A;  1ZHJ A;  4E1K A;  1ZI5 A;  5CQN X;  3V90 A;  1V84 A;  1NF5 B;  1XZ6 A;  1ZJ1 A;  4J18 A;  1H7E A;  4B2X A;  1MP4 A;  2MZB A;  4FRL A;  3I0I X;  5C47 A;  1HM0 A;  3HL3 A;  3NGW A;  1V82 A;  2XMH A;  1G2V A;  1Z90 A;  3OH1 A;  4EE3 A;  3SX7 A;  2ICY A;  1FR8 A;  3SXA A;  2DPW A;  3SX5 A;  4ZDQ A;  5AJN A;  3CU0 A;  2ZU7 A;  1ZDG A;  3Q80 A;  4G3P A;  1QWJ A;  3OKR A;  4G3S A;  5FUH A;  1R7Y A;  3U2V A;  2BO7 A;  3POL A;  1YP4 A;  5FTV A;  3CKO A;  3PNN A;  2OI7 A;  1GWV A;  4CVH A;  2D7I A;  2Q4J A;  4AYL A;  2AES A;  4D48 A;  3SX8 A;  2C0N A;  2WEE A;  2VFZ A;  2JCO A;  1FZW A;  2FFV A;  4ECM A;  2I5K A;  1G95 A;  1WSZ A;  1FWY A;  1VH1 A;  3SXB A;  3JTJ A;  3OH4 A;  4KNR A;  4NAN A;  3I0J A;  2ICX A;  1OMX A;  5L6V A;  4L41 C;  4D11 C;  3OAM A;  1LZI A;  3DUV A;  5C4B A;  4B4M A;  3EE5 A;  3OC9 A;  5C4E A;  3TZT A;  4EEO A;  3Q4S A;  1S4O A;  4P02 A;  1ZI4 A;  5C4C A;  1O0R A;  1H4C A;  1FGX A;  2AGD A;  3GUE A;  4DDZ A;  5EJZ A;  1H7Q A;  2VS5 A;  4EEM A;  3RMW A;  1G1L A;  1ZDF A;  3V91 A;  2RJ1 A;  2RJ9 A;  3N9W A;  4KC2 A;  2WVM A;  3SXD A;  1W77 A;  4KC1 A;  2RJ8 A;  2V0J A;  2J0B A;  1EZI A;  2Y4K A;  1FR9 A;  2E3D A;  5DDV A;  5C3A A;  5EJ1 A;  4Y7V A;  1WT3 A;  1ZJ0 A;  4EE4 A;  3ZGF A;  2FYA A;  2RIT A;  5C4F A;  1MP3 A;  3V0P A;  3IOI A;  1LL0 A;  3I0K A;  2WVL A;  2Y6P A;  4XWI A;  2O1H A;  4K6R A;  2V0H A;  1JV1 A;  1JVG A;  3KIA A;  1IIN A;  1VH3 A;  2W0W A;  5C3B A;  1IIM A;  2JCK A;  1H7F A;  2YQH A;  2VSH A;  4MIX A;  4ARW A;  4G3Q A;  1R81 A;  3FOQ A;  1H7L A;  1FRW A;  2WVK A;  4HOC A;  1H3M A;  1MC3 A;  4CJ8 A;  4O6M A;  5FTS A;  4MYB A;  1NHE B;  4P00 A;  4B4G A;  1TVY A;  4MND A;  2FYB A;  3I0H A;  4Y7G A;  5C36 A;  2BO8 A;  1S4P A;  1HJJ A;  1INI A;  4FRQ A;  4BMA A;  3DJ4 A;  2VD4 A;  4G87 A;  5C3D A;  2APC A;  4Y62 A;  3CKN A;  1R7T A;  4Y7F A;  3V8Z A;  1H4D A;  3V0L A;  2YES A;  1H5R B;  3I0F A;  3U0X A;  2D7R A;  4LW3 A;  2RJ7 A;  3ZF8 A;  1GQC A;  1VPA A;  2PX7 A;  3ZGG A;  5EIY A;  2VS4 A;  1H5S D;  2RIZ A;  1G23 A;  1KWS A;  2W0V A;  4HO6 A;  3FWW A;  1VGU A;  2WE9 A;  1GWW A;  1LL3 A;  1O7O A;  2BO4 A;  1VZX A;  3PKP A;  1K4V A;  4Y9X A;  1FG5 N;  3OGZ A;  2AM5 A;  2UX8 A;  3RMV A;  4O6N A;  2Y7A A;  3E25 A;  2RIX A;  1NKH B;  2Y4L A;  4FRB A;  3BRK X;  1FGG A;  1VGZ A;  1ZCV A;  4Q7C A;  2XME A;  3O3P A;  4YS8 A;  1WT2 A;  1O23 B;  1R82 A;  2VK9 A;  2XWL A;  5BXC A;  1GA8 A;  1H5R A;  1S4N A;  3QVB A;  2X60 A;  1NWG B;  4DEC A;  4FRM A;  2RJ0 A;  1PZT A;  2WGZ A;  2QGI A;  2XWN A;  2OEG A;  4JIS A;  1QGS A;  5AJO A;  1ZCU A;  1JV3 A;  2FY7 A;  1ZJP A;  2V0I A;  5C4D A;  3V0Q A;  1JYK A;  1G8O A;  4NAL A;  4FCE A;  2D0J A;  3I0C A;  1O7Q A;  4ASY A;  1R7U A;  3U2T A;  3ST8 A;  1YP2 A;  4M2B A;  4FRD A;  1FO8 A;  3U2X A;  1H5S C;  5HS2 A;  2VSI A;  4HCQ A;  5FYE A;  1YP3 A;  1H5T B;  2GGO A;  4FRP A;  5CMH A;  1TW1 A;  1G93 A;  3IOH A;  3R2W A;  4Y7T A;  5CQM X;  4HO9 A;  5DDT A;  1LL2 A;  5AJP A;  3T7N A;  4FRE A;  3OH3 A;  5D92 A;  4BQH A;  1YRO B;  3IOJ A;  3OH2 A;  2AEC A;  1R7X A;  1ZJ2 A;  4UEG A;  2P6W A;  1V83 A;  2RJ4 A;  2RJ6 A;  4KXO A;  2JCL A;  1FO9 A;  5C1H A;  5C48 A;  4FRA A;  5CQO A;  4CJB A;  5FV9 A;  2PA4 A;  1SS9 A;  1INJ A;  4Y7U A;  2X5Z A;  4HO3 A;  2PGY A;  3I0G A;  4AYJ A;  3E26 A;  3I0E A;  1VGT A;  1R80 A;  2YQJ A;  4KT7 A;  1VZT A;  2VXL A;  1FOA A;  2YCM A;  4IRP A;  5JQQ A;  1GQ9 A;  3V0N A;  1G97 A;  4HO8 A;  1EYR A;  3D8V A;  5CQP A;  5C38 A;  2OI5 A;  1H5T A;  1W57 A;  1GX4 A;  5IFY A;  3U2U A;  5C8R A;  1HV9 A;  1VM8 A;  4Y64 A;  4FRO A;  4C2S A;  1HM9 A;  2RJ5 A;  2AM3 A;  2O1F A;  2OEF A;  1FXO A;  3Q7U A;  4Y63 A;  4HO5 A;  2XWM A;  1VGW A;  4JD0 A;  3OH0 A;  4B4B A;  1LZJ A;  1MP5 A;  4Y6U A;  2JCJ A;  2AM4 A;  3V0O A;  3JUJ A;  5CMG X;  1PZY B;  3CKV A;  2V0K A;  5IDT A;  3D98 A;  4AAW A;  4FIX A;  4FIY A;  3SXE A;  5I1F A;  4B2W A;  4HO0 A;  2X65 A;  3JUK A;  3K8D A;  1ZCY A;  3SX3 A;  4CJC A;  2FFU A;  1GX0 A;  4FQW A;  4KQL A;  4NAK A;  5CMI A;  1TZF A;  1HM8 A;  1LZ7 A;  4GBP A;  3F1Y A;  1TW5 A;  4ASJ A;  3LW6 A;  2P72 A;  2YQC A;  4D0Z A;  3ZLK A;  1OMZ A;  2BO6 A;  4IRQ A;  2J0A A;  3D5N A;  2YQS A;  1HJL A;  4EEA A;  3USQ A;  4KPX A;  2V0L A;  2YC3 A;  4HO2 A;  2I7B A;  1ZI1 A;  5CMJ A;  4EE5 A;  5J49 A;  3T7M A;  2CU2 A;  1ZCT A;  2Y4J A;  2GGQ A;  1JVD A;  1NQI B;  3V8Y A;  3V0M A;  4M4K A;  1XHB A;  2VS3 A;  4B3U A;  4EVW A;  3K8E A;  1W55 A;  2FYD B;  4EEG A;  3U2W A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...