1R7XA

Glycosyltransferase b in complex with 3-amino-acceptor analog inhibitor
Total Genus 81
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
81
sequence length
283
structure length
263
Chain Sequence
MVSLPRMVYPQPKVLTPCRKDVLVVTPWLAPIVWEGTFNIDILNEQFRLQNTTIGLTVFAIKKYVAFLKLFLETAEKHFMVGHRVHYYVFTDQPAAVPRVTLGTGRQLSVLEVCERRFLSEVDYLVCVDVDMEFRDHVGVEILTPLFGTLHPSFYGSSREAFTYERRPQSQAYIPKDEGDFYYMGAFFGGSVQEVQRLTRACHQAMMVDQANGIEAVWHDESHLNKYLLRHKPTKVLSPEYLWDQQLLGWPAVLRKLRFTAVP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Glycoprotein-fucosylgalactoside alpha-galactosyltransferase
publication title The influence of an intramolecular hydrogen bond in differential recognition of inhibitory acceptor analogs by human ABO(H) blood group A and B glycosyltransferases
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 81
structure length 263
sequence length 283
ec nomenclature ec 2.4.1.37: Fucosylgalactoside 3-alpha-galactosyltransferase.
pdb deposition date 2003-10-22
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.550.10 Alpha Beta Alpha-Beta Complex Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A 1r7xA00
2RJ9A 3K8EA 2Y4JA 2E3DA 2MZBA 3OKRA 1R7VA 1NF5B 2WE9A 2X65A 5CQMX 4D11A 1R7UA 3U2XA 1ZCTA 2WEEA 4Y9XA 2RITA 4HO2A 4B5BA 4FQWA 1WT3A 2YCMA 4EEMA 5CMFX 5C1LA 2V0JA 3Q4SA 2AESA 1MP5A 4HOCA 4AAWA 4L41C 2VD4A 2VXMA 2RJ1A 3I0HA 5AJOA 5CQNX 1Z90A 1NWGB 4JD0A 1R7YA 1ZI3A 4Y7VA 3JUKA 4G87A 1G2VA 1TVYA 3CKNA 2AGDA 2BO8A 3CKJA 3I0EA 1I52A 1H7QA 5L6VA 3U2UA 2AECA 5C4CA 4HG6A 4KNRA 1O23B 2X60A 4B3UA 1JVGA 4CJBA 5IDTA 3IOIA 3SXCA 3RMVA 1TZFA 2XWNA 1H4CA 3V0PA 2ICXA 2QKXA 3SXAA 3R2WA 2Y4LA 1JV3A 2ZU7A 1GQ9A 2ZU9A 3ZGFA 4B42A 5C38A 2OEGA 3IOJA 4NAKA 3ZF8A 4KRVA 2Q4JA 4IRPA 2BO6A 3CKQA 1FG5N 4M4KA 2O1HA 2AH9A 5DDVA 1FRWA 2I5EA 1G1LA 1W77A 3PNNA 1TW5A 3O3PA 2W0VA 4HO6A 3I0KA 2YQSA 5FUHA 3ZGGA 4EEAA 1WT0A 3SX5A 3T7MA 4KPZA 4MYBA 4KQLA 1FR8A 1LZ0A 4FCEA 2V0IA 5C47A 2APCA 2VS5A 2FYCB 4KT7A 2XWMA 5EJ1A 3V0NA 1NKHB 2NXVA 1ZCUA 2YQHA 1PZTA 1ZIZA 3I0DA 5HS2A 5C8RA 5DDTA 5C1HA 4HO5A 1H3MA 1INIA 1PZYB 2ZU8A 2X5ZA 2VSIA 4EE3A 1FO9A 5JQQA 4KC4A 3OH3A 3V0MA 1R81A 1H7FA 4FRBA 5CQPA 1WVCA 1HV9A 1WT1A 3Q7UA 4FCUA 5FU8A 5IFYA 4NANA 5C1GA 1HM9A 3BCVA 4CJ8A 3V0OA 4KC2A 5CMGX 1ZJOA 3RMWA 3SX7A 3V0LA 4DECA 4C2SA 1VICA 4Y7GA 3E25A 2Y7AA 3JTJA 5EIYA 1HJJA 4M28A 3R3IA 2RIXA 3NGWA 1G8OA 2GGQA 1H5TB 2I7BA 1JVDA 4G3SA 3SX8A 1G97A 2QH5A 5CMIA 2RIZA 3DUVA 1NQIB 4D0ZA 1GQCA 1K4VA 1VH3A 4Y62A 2WAWA 3PKPA 2V0KA 1OMZA 4GBPA 1SS9A 4FROA 1W57A 4JISA 2FY7A 3USRA 3D8VA 3SXBA 1O7OA 2AM5A 4Y7TA 4B2XA 3SXEA 4IRQA 1OQMB 1FGGA 2YC5A 1G95A 3RSBA 2A8WA 2XMHA 5AJPA 5CMJA 1NMMB 4YS8A 3KIAA 4D11C 3F1CA 3QVBA 3U2WA 1JV1A 1VPAA 3JUJA 2RJ6A 3I0LA 4ARWA 3TZTA 5C3DA 1ZJ1A 4Y7FA 1YP3A 2OI7A 4FRQA 4M2BA 5FV9A 1GWWA 2RJ5A 3USQA 4ECMA 3CU0A 4FRAA 2DPWA 3U2TA 2YESA 1LVWA 1G3LA 1W55A 4J18A 1H5SA 3I0FA 4P02A 3V8ZA 1GWVA 5J49A 5FU0A 3POLA 3SPTA 2RJ8A 1R82A 4HO9A 3CGXA 1XHBA 1QG8A 2JCKA 3TQDA 2PA4A 1S4OA 1H4EA 2WVLA 2FYAA 4HO3A 2AM4A 1ZI1A 2VXLA 4KC1A 2W0WA 1YP4A 3U0YA 4BQHA 1ZJ0A 3PKQA 1H5RB 4Y64A 1O7QA 5CQLX 1H7GA 1VZUA 1QGQA 1VGUA 1HJLA 1LZJA 1G23A 2YQJA 1LZIA 2ICYA 3I0IX 4KXOA 1LL3A 2BO7A 2Y6PA 4EEOA 1H4DA 3FWWA 2FFUA 2X5SA 3FOQA 2V0HA 4KNXA 4B4BA 2RJ4A 2CU2A 3BRKX 1G9RA 1VGWA 3V90A 2RIYA 2GGOA 1E5KA 4XWIA 4FRPA 1ZJ3A 2AM3A 2VSHA 4FRMA 1ZDFA 4AC3A 1GX4A 1H5SD 3DK5A 4B4MA 5C48A 2VS4A 2P72A 4AYLA 1YROB 1FR9A 1H5SC 3CKVA 2OI5A 5C4DA 1S4PA 2P73A 4Y6NA 5C3AA 3OH4A 1VM8A 1H7TA 2P6WA 3OH1A 3D98A 5C49A 1ZI4A 1V84A 4BMAA 1JYLA 1MC3A 1LL0A 2VFZA 4Y63A 5CMHA 2WVKA 3HL3A 1WSZA 1MP3A 3OAMA 3OH2A 5AJNA 1R80A 4CVHA 3CKOA 1EYRA 3I0GA 5C3BA 4G3PA 4HO0A 4EVWA 4HCQA 4NALA 1VGTA 1IIMA 2V0LA 5EJZA 4HO4A 3D5NA 2UX8A 1OMXA 1G93A 3F1YA 4FRHA 4AYJA 2JCOA 4E1KA 1FXOA 4EEGA 4ASYA 4K6RA 4ASJA 4B4GA 2YC3A 4FREA 2FYDB 3T7OA 4EE4A 1R7XA 4ZDQA 1ZDGA 3V91A 4KPXA 1V82A 2D7RA 3I0CA 5FYEA 1H7LA 3DJ4A 2PGYA 4DE7A 1FXJA 1MP4A 4G3QA 2XMEA 1H5TA 1V83A 4B2WA 1O0RA 1KWSA 1IINA 2I5KA 2JCJA 1FZWA 2Y4KA 3V8YA 5BXCA 1H5SB 2O1GA 1ZCYA 3IOHA 5CQOA 4P00A 1G0RA 1HM8A 1ZHJA 3ZLLA 3E26A 1ZI5A 2RJ0A 3U0XA 4R7PA 2AE7A 2OI6A 4UEGA 4CJCA 3LW6A 1GA8A 3V0QA 4Y7UA 2D7IA 2A8UA 1FO8A 1ON8A 2FFVA 2XWLA 1INJA 1ZCVA 2E8BA 5C4FA 2PX7A 1TW1A 3U2VA 3Q80A 3I0JA 2PGVA 5FTVA 4MNDA 4FRDA 4HO8A 3SX3A 5IDSA 1LL2A 5C36A 2O1FA 1GX0A 3OGZA 3SXGA 1R7TA 3N9WA 5FTSA 4Y6UA 1JYKA 1YP2A 2RJ7A 2FYBA 1NHEB 5C4EA 2JCLA 1QGSA 1ZJ2A 4D0TA 4DDZA 4LW3A 1XZ6A 1ZJPA 1VH1A 3ZLKA 1H7EA 1HM0A 2Y4MA 1ON6A 1S4NA 3OC9A 1FOAA 3K8DA 5C4BA 1LZ7A 3EE5A 4EE5A 2BO4A 4D48A 3T7NA 2WVMA 4NAIA 2D0JA 1WT2A 2QGIA 1EZIA 5I1FA 4LW6A 2OEFA 4M2AA 1VGZA 2VS3A 2Z87A 1VZTA 1VZXA 1FWYA 2YQCA 1FGXA 1QWJA 4FRLA 2Z86A 3OH0A 1H7HA 2WGZA 5L6SA 3GUEA 1H5RA 3ST8A 3SXDA
chains in the Genus database with same CATH superfamily
2RJ9A 3K8EA 2Y4JA 2E3DA 2MZBA 3OKRA 1R7VA 1NF5B 2WE9A 2X65A 2J0BA 5CQMX 4O6MA 4D11A 1R7UA 3U2XA 1ZCTA 2WEEA 4Y9XA 5D91A 2RITA 4HO2A 4B5BA 4FQWA 1WT3A 2YCMA 4EEMA 5CMFX 5C1LA 2V0JA 3Q4SA 2AESA 1MP5A 4HOCA 4AAWA 4L41C 2VD4A 2VXMA 2RJ1A 3I0HA 5AJOA 5CQNX 1Z90A 1NWGB 4JD0A 1R7YA 1ZI3A 4Y7VA 3JUKA 4G87A 1G2VA 1TVYA 3CKNA 2AGDA 2BO8A 3CKJA 3I0EA 1I52A 1H7QA 5L6VA 3U2UA 2AECA 5C4CA 4HG6A 4KNRA 1O23B 2X60A 4B3UA 1JVGA 4CJBA 5IDTA 3IOIA 3SXCA 3RMVA 1TZFA 2XWNA 1H4CA 3V0PA 2ICXA 2QKXA 3SXAA 3R2WA 2Y4LA 1JV3A 2ZU7A 1GQ9A 2ZU9A 3ZGFA 4B42A 5C38A 2OEGA 3IOJA 4NAKA 3ZF8A 4KRVA 2Q4JA 4IRPA 2BO6A 3CKQA 1FG5N 4M4KA 2O1HA 2AH9A 5DDVA 4FIYA 1FRWA 2I5EA 1G1LA 1W77A 3PNNA 1TW5A 3O3PA 2W0VA 4HO6A 3I0KA 2YQSA 5FUHA 3ZGGA 4EEAA 1WT0A 3SX5A 3T7MA 4KPZA 4MYBA 4Q7CA 4KQLA 1FR8A 1LZ0A 4FCEA 2V0IA 5D92A 5C47A 2APCA 2VS5A 2FYCB 4KT7A 2XWMA 2J0AA 5EJ1A 3V0NA 1NKHB 2NXVA 1ZCUA 2YQHA 1PZTA 1ZIZA 3I0DA 5HS2A 5C8RA 5DDTA 5C1HA 4HO5A 1H3MA 1INIA 1PZYB 2ZU8A 2X5ZA 2VSIA 4EE3A 1FO9A 5JQQA 4KC4A 3OH3A 3V0MA 1R81A 1H7FA 4FRBA 5CQPA 1WVCA 1HV9A 1WT1A 3Q7UA 4FCUA 5FU8A 5IFYA 4NANA 5C1GA 1HM9A 3BCVA 4CJ8A 3V0OA 4KC2A 5CMGX 1ZJOA 3RMWA 3SX7A 3V0LA 4DECA 4C2SA 1VICA 4Y7GA 3E25A 2Y7AA 3JTJA 5EIYA 1HJJA 4M28A 3R3IA 2RIXA 3NGWA 1G8OA 2GGQA 1H5TB 2I7BA 1JVDA 4G3SA 3SX8A 1G97A 2QH5A 2VK9A 5CMIA 2RIZA 3DUVA 1NQIB 4D0ZA 1GQCA 1K4VA 1VH3A 4Y62A 2WAWA 3PKPA 2V0KA 2C0NA 1OMZA 4GBPA 1SS9A 4FROA 1W57A 4JISA 2FY7A 3USRA 3D8VA 3SXBA 1O7OA 2AM5A 4Y7TA 4B2XA 3SXEA 4IRQA 1OQMB 1FGGA 2YC5A 1G95A 3RSBA 2A8WA 2XMHA 5AJPA 5CMJA 1NMMB 4YS8A 3KIAA 4D11C 3F1CA 3QVBA 3U2WA 1JV1A 1VPAA 3JUJA 2RJ6A 3I0LA 4ARWA 3TZTA 5C3DA 1ZJ1A 4Y7FA 1YP3A 2OI7A 4FRQA 4M2BA 5FV9A 1GWWA 2RJ5A 3USQA 4ECMA 3CU0A 4FRAA 2DPWA 3U2TA 2YESA 1LVWA 1G3LA 1W55A 4J18A 1H5SA 3I0FA 4P02A 3V8ZA 1GWVA 5J49A 5FU0A 3POLA 3SPTA 2RJ8A 1R82A 4HO9A 3CGXA 1XHBA 1QG8A 2JCKA 3TQDA 2PA4A 1S4OA 1H4EA 2WVLA 2FYAA 4HO3A 2AM4A 1ZI1A 2VXLA 4KC1A 2W0WA 1YP4A 3U0YA 4BQHA 1ZJ0A 3PKQA 1H5RB 4Y64A 1O7QA 5CQLX 1H7GA 1VZUA 1QGQA 1VGUA 1HJLA 1LZJA 1G23A 2YQJA 1LZIA 2ICYA 3I0IX 4KXOA 1LL3A 2BO7A 2Y6PA 4EEOA 1H4DA 3FWWA 2FFUA 2X5SA 3FOQA 2V0HA 4KNXA 4B4BA 2RJ4A 2CU2A 3BRKX 1G9RA 1VGWA 3V90A 2RIYA 2GGOA 1E5KA 4XWIA 4FRPA 1ZJ3A 2AM3A 2VSHA 4FRMA 1ZDFA 4AC3A 1GX4A 1H5SD 3DK5A 4B4MA 5C48A 2VS4A 2P72A 4AYLA 1YROB 1FR9A 1H5SC 3CKVA 2OI5A 5C4DA 1S4PA 2P73A 4Y6NA 5C3AA 3OH4A 1VM8A 1H7TA 2P6WA 3OH1A 3D98A 5C49A 1ZI4A 1V84A 4BMAA 1JYLA 1MC3A 1LL0A 2VFZA 4Y63A 5CMHA 2WVKA 3HL3A 1WSZA 1MP3A 3OAMA 3OH2A 5AJNA 1R80A 4CVHA 3CKOA 1EYRA 3I0GA 5C3BA 4G3PA 4HO0A 4EVWA 4HCQA 4NALA 1VGTA 1IIMA 2V0LA 5EJZA 4HO4A 3D5NA 2UX8A 1OMXA 1G93A 3F1YA 4FRHA 4AYJA 2JCOA 4E1KA 1FXOA 4EEGA 4ASYA 4K6RA 4ASJA 4B4GA 2YC3A 4FREA 2FYDB 3T7OA 4EE4A 1R7XA 4ZDQA 1ZDGA 3V91A 4KPXA 1V82A 2D7RA 3I0CA 5FYEA 1H7LA 3DJ4A 2PGYA 4DE7A 1FXJA 1MP4A 4G3QA 2XMEA 1H5TA 1V83A 4B2WA 1O0RA 1KWSA 1IINA 2I5KA 2JCJA 1FZWA 2Y4KA 3V8YA 5BXCA 1H5SB 2O1GA 1ZCYA 3IOHA 4MIXA 4P00A 5CQOA 1G0RA 1HM8A 1ZHJA 3ZLLA 3E26A 1ZI5A 2RJ0A 3U0XA 4R7PA 2AE7A 2OI6A 4UEGA 4CJCA 3LW6A 1GA8A 3V0QA 4Y7UA 2D7IA 2A8UA 1FO8A 1ON8A 2FFVA 2XWLA 1INJA 1ZCVA 2E8BA 5C4FA 2PX7A 1TW1A 3U2VA 3Q80A 3I0JA 2PGVA 5FTVA 4MNDA 4FRDA 4HO8A 3SX3A 5IDSA 1LL2A 5C36A 2O1FA 1GX0A 3OGZA 3SXGA 1R7TA 3N9WA 5FTSA 4Y6UA 1JYKA 1YP2A 2RJ7A 4FIXA 2FYBA 1NHEB 5C4EA 2JCLA 1QGSA 1ZJ2A 4D0TA 4DDZA 4LW3A 1XZ6A 1ZJPA 1VH1A 3ZLKA 1H7EA 1HM0A 2Y4MA 1ON6A 1S4NA 3OC9A 4O6NA 1FOAA 3K8DA 5C4BA 1LZ7A 3EE5A 4EE5A 2BO4A 4D48A 3T7NA 2WVMA 4NAIA 2D0JA 1WT2A 2QGIA 1EZIA 5I1FA 4LW6A 2OEFA 4M2AA 1VGZA 2VS3A 2Z87A 1VZTA 1VZXA 1FWYA 2YQCA 1FGXA 1QWJA 4FRLA 2Z86A 3OH0A 1H7HA 2WGZA 5L6SA 3GUEA 1H5RA 3ST8A 3SXDA
chains in the Genus database with same CATH topology
2RJ9A 3K8EA 2Y4JA 2E3DA 2MZBA 3OKRA 1R7VA 1NF5B 2WE9A 2X65A 2J0BA 5CQMX 4O6MA 4D11A 1R7UA 3U2XA 1ZCTA 2WEEA 4Y9XA 5D91A 2RITA 4HO2A 4B5BA 4FQWA 1WT3A 2YCMA 4EEMA 5CMFX 5C1LA 2V0JA 3Q4SA 2AESA 1MP5A 4HOCA 4AAWA 4L41C 2VD4A 2VXMA 2RJ1A 3I0HA 5AJOA 5CQNX 1Z90A 1NWGB 4JD0A 1R7YA 1ZI3A 4Y7VA 3JUKA 4G87A 1G2VA 1TVYA 3CKNA 2AGDA 2BO8A 3CKJA 3I0EA 1I52A 1H7QA 5L6VA 3U2UA 2AECA 5C4CA 4HG6A 4KNRA 1O23B 2X60A 4B3UA 1JVGA 4CJBA 5IDTA 3IOIA 3SXCA 3RMVA 1TZFA 2XWNA 1H4CA 3V0PA 2ICXA 2QKXA 3SXAA 3R2WA 2Y4LA 1JV3A 2ZU7A 1GQ9A 2ZU9A 3ZGFA 4B42A 5C38A 2OEGA 3IOJA 4NAKA 3ZF8A 4KRVA 2Q4JA 4IRPA 2BO6A 3CKQA 1FG5N 4M4KA 2O1HA 2AH9A 5DDVA 4FIYA 1FRWA 2I5EA 1G1LA 1W77A 3PNNA 1TW5A 3O3PA 2W0VA 4HO6A 3I0KA 2YQSA 5FUHA 3ZGGA 4EEAA 1WT0A 3SX5A 3T7MA 4KPZA 4MYBA 4Q7CA 4KQLA 1FR8A 1LZ0A 4FCEA 2V0IA 5D92A 5C47A 2APCA 2VS5A 2FYCB 4KT7A 2XWMA 2J0AA 5EJ1A 3V0NA 1NKHB 2NXVA 1ZCUA 2YQHA 1PZTA 1ZIZA 3I0DA 5HS2A 5C8RA 5DDTA 5C1HA 4HO5A 1H3MA 1INIA 1PZYB 2ZU8A 2X5ZA 2VSIA 4EE3A 1FO9A 5JQQA 4KC4A 3OH3A 3V0MA 1R81A 1H7FA 4FRBA 5CQPA 1WVCA 1HV9A 1WT1A 3Q7UA 4FCUA 5FU8A 5IFYA 4NANA 5C1GA 1HM9A 3BCVA 4CJ8A 3V0OA 4KC2A 5CMGX 1ZJOA 3RMWA 3SX7A 3V0LA 4DECA 4C2SA 1VICA 4Y7GA 3E25A 2Y7AA 3JTJA 5EIYA 1HJJA 4M28A 3R3IA 2RIXA 3NGWA 1G8OA 2GGQA 1H5TB 2I7BA 1JVDA 4G3SA 3SX8A 1G97A 2QH5A 2VK9A 5CMIA 2RIZA 3DUVA 1NQIB 4D0ZA 1GQCA 1K4VA 1VH3A 4Y62A 2WAWA 3PKPA 2V0KA 2C0NA 1OMZA 4GBPA 1SS9A 4FROA 1W57A 4JISA 2FY7A 3USRA 3D8VA 3SXBA 1O7OA 2AM5A 4Y7TA 4B2XA 3SXEA 4IRQA 1OQMB 1FGGA 2YC5A 1G95A 3RSBA 2A8WA 2XMHA 5AJPA 5CMJA 1NMMB 4YS8A 3KIAA 4D11C 3F1CA 3QVBA 3U2WA 1JV1A 1VPAA 3JUJA 2RJ6A 3I0LA 4ARWA 3TZTA 5C3DA 1ZJ1A 4Y7FA 1YP3A 2OI7A 4FRQA 4M2BA 5FV9A 1GWWA 2RJ5A 3USQA 4ECMA 3CU0A 4FRAA 2DPWA 3U2TA 2YESA 1LVWA 1G3LA 1W55A 4J18A 1H5SA 3I0FA 4P02A 3V8ZA 1GWVA 5J49A 5FU0A 3POLA 3SPTA 2RJ8A 1R82A 4HO9A 3CGXA 1XHBA 1QG8A 2JCKA 3TQDA 2PA4A 1S4OA 1H4EA 2WVLA 2FYAA 4HO3A 2AM4A 1ZI1A 2VXLA 4KC1A 2W0WA 1YP4A 3U0YA 4BQHA 1ZJ0A 3PKQA 1H5RB 4Y64A 1O7QA 5CQLX 1H7GA 1VZUA 1QGQA 1VGUA 1HJLA 1LZJA 1G23A 2YQJA 1LZIA 2ICYA 3I0IX 4KXOA 1LL3A 2BO7A 2Y6PA 4EEOA 1H4DA 3FWWA 2FFUA 2X5SA 3FOQA 2V0HA 4KNXA 4B4BA 2RJ4A 2CU2A 3BRKX 1G9RA 1VGWA 3V90A 2RIYA 2GGOA 1E5KA 4XWIA 4FRPA 1ZJ3A 2AM3A 2VSHA 4FRMA 1ZDFA 4AC3A 1GX4A 1H5SD 3DK5A 4B4MA 5C48A 2VS4A 2P72A 4AYLA 1YROB 1FR9A 1H5SC 3CKVA 2OI5A 5C4DA 1S4PA 2P73A 4Y6NA 5C3AA 3OH4A 1VM8A 1H7TA 2P6WA 3OH1A 3D98A 5C49A 1ZI4A 1V84A 4BMAA 1JYLA 1MC3A 1LL0A 2VFZA 4Y63A 5CMHA 2WVKA 3HL3A 1WSZA 1MP3A 3OAMA 3OH2A 5AJNA 1R80A 4CVHA 3CKOA 1EYRA 3I0GA 5C3BA 4G3PA 4HO0A 4EVWA 4HCQA 4NALA 1VGTA 1IIMA 2V0LA 5EJZA 4HO4A 3D5NA 2UX8A 1OMXA 1G93A 3F1YA 4FRHA 4AYJA 2JCOA 4E1KA 1FXOA 4EEGA 4ASYA 4K6RA 4ASJA 4B4GA 2YC3A 4FREA 2FYDB 3T7OA 4EE4A 1R7XA 4ZDQA 1ZDGA 3V91A 4KPXA 1V82A 2D7RA 3I0CA 5FYEA 1H7LA 3DJ4A 2PGYA 4DE7A 1FXJA 1MP4A 4G3QA 2XMEA 1H5TA 1V83A 4B2WA 1O0RA 1KWSA 1IINA 2I5KA 2JCJA 1FZWA 2Y4KA 3V8YA 5BXCA 1H5SB 2O1GA 1ZCYA 3IOHA 4MIXA 4P00A 5CQOA 1G0RA 1HM8A 1ZHJA 3ZLLA 3E26A 1ZI5A 2RJ0A 3U0XA 4R7PA 2AE7A 2OI6A 4UEGA 4CJCA 3LW6A 1GA8A 3V0QA 4Y7UA 2D7IA 2A8UA 1FO8A 1ON8A 2FFVA 2XWLA 1INJA 1ZCVA 2E8BA 5C4FA 2PX7A 1TW1A 3U2VA 3Q80A 3I0JA 2PGVA 5FTVA 4MNDA 4FRDA 4HO8A 3SX3A 5IDSA 1LL2A 5C36A 2O1FA 1GX0A 3OGZA 3SXGA 1R7TA 3N9WA 5FTSA 4Y6UA 1JYKA 1YP2A 2RJ7A 4FIXA 2FYBA 1NHEB 5C4EA 2JCLA 1QGSA 1ZJ2A 4D0TA 4DDZA 4LW3A 1XZ6A 1ZJPA 1VH1A 3ZLKA 1H7EA 1HM0A 2Y4MA 1ON6A 1S4NA 3OC9A 4O6NA 1FOAA 3K8DA 5C4BA 1LZ7A 3EE5A 4EE5A 2BO4A 4D48A 3T7NA 2WVMA 4NAIA 2D0JA 1WT2A 2QGIA 1EZIA 5I1FA 4LW6A 2OEFA 4M2AA 1VGZA 2VS3A 2Z87A 1VZTA 1VZXA 1FWYA 2YQCA 1FGXA 1QWJA 4FRLA 2Z86A 3OH0A 1H7HA 2WGZA 5L6SA 3GUEA 1H5RA 3ST8A 3SXDA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2RJ9 A;  3K8E A;  2Y4J A;  2E3D A;  2MZB A;  3OKR A;  1R7V A;  1NF5 B;  2WE9 A;  2X65 A;  5CQM X;  4D11 A;  1R7U A;  3U2X A;  1ZCT A;  2WEE A;  4Y9X A;  2RIT A;  4HO2 A;  4B5B A;  4FQW A;  1WT3 A;  2YCM A;  4EEM A;  5CMF X;  5C1L A;  2V0J A;  3Q4S A;  2AES A;  1MP5 A;  4HOC A;  4AAW A;  4L41 C;  2VD4 A;  2VXM A;  2RJ1 A;  3I0H A;  5AJO A;  5CQN X;  1Z90 A;  1NWG B;  4JD0 A;  1R7Y A;  1ZI3 A;  4Y7V A;  3JUK A;  4G87 A;  1G2V A;  1TVY A;  3CKN A;  2AGD A;  2BO8 A;  3CKJ A;  3I0E A;  1I52 A;  1H7Q A;  5L6V A;  3U2U A;  2AEC A;  5C4C A;  4HG6 A;  4KNR A;  1O23 B;  2X60 A;  4B3U A;  1JVG A;  4CJB A;  5IDT A;  3IOI A;  3SXC A;  3RMV A;  1TZF A;  2XWN A;  1H4C A;  3V0P A;  2ICX A;  2QKX A;  3SXA A;  3R2W A;  2Y4L A;  1JV3 A;  2ZU7 A;  1GQ9 A;  2ZU9 A;  3ZGF A;  4B42 A;  5C38 A;  2OEG A;  3IOJ A;  4NAK A;  3ZF8 A;  4KRV A;  2Q4J A;  4IRP A;  2BO6 A;  3CKQ A;  1FG5 N;  4M4K A;  2O1H A;  2AH9 A;  5DDV A;  1FRW A;  2I5E A;  1G1L A;  1W77 A;  3PNN A;  1TW5 A;  3O3P A;  2W0V A;  4HO6 A;  3I0K A;  2YQS A;  5FUH A;  3ZGG A;  4EEA A;  1WT0 A;  3SX5 A;  3T7M A;  4KPZ A;  4MYB A;  4KQL A;  1FR8 A;  1LZ0 A;  4FCE A;  2V0I A;  5C47 A;  2APC A;  2VS5 A;  2FYC B;  4KT7 A;  2XWM A;  5EJ1 A;  3V0N A;  1NKH B;  2NXV A;  1ZCU A;  2YQH A;  1PZT A;  1ZIZ A;  3I0D A;  5HS2 A;  5C8R A;  5DDT A;  5C1H A;  4HO5 A;  1H3M A;  1INI A;  1PZY B;  2ZU8 A;  2X5Z A;  2VSI A;  4EE3 A;  1FO9 A;  5JQQ A;  4KC4 A;  3OH3 A;  3V0M A;  1R81 A;  1H7F A;  4FRB A;  5CQP A;  1WVC A;  1HV9 A;  1WT1 A;  3Q7U A;  4FCU A;  5FU8 A;  5IFY A;  4NAN A;  5C1G A;  1HM9 A;  3BCV A;  4CJ8 A;  3V0O A;  4KC2 A;  5CMG X;  1ZJO A;  3RMW A;  3SX7 A;  3V0L A;  4DEC A;  4C2S A;  1VIC A;  4Y7G A;  3E25 A;  2Y7A A;  3JTJ A;  5EIY A;  1HJJ A;  4M28 A;  3R3I A;  2RIX A;  3NGW A;  1G8O A;  2GGQ A;  1H5T B;  2I7B A;  1JVD A;  4G3S A;  3SX8 A;  1G97 A;  2QH5 A;  5CMI A;  2RIZ A;  3DUV A;  1NQI B;  4D0Z A;  1GQC A;  1K4V A;  1VH3 A;  4Y62 A;  2WAW A;  3PKP A;  2V0K A;  1OMZ A;  4GBP A;  1SS9 A;  4FRO A;  1W57 A;  4JIS A;  2FY7 A;  3USR A;  3D8V A;  3SXB A;  1O7O A;  2AM5 A;  4Y7T A;  4B2X A;  3SXE A;  4IRQ A;  1OQM B;  1FGG A;  2YC5 A;  1G95 A;  3RSB A;  2A8W A;  2XMH A;  5AJP A;  5CMJ A;  1NMM B;  4YS8 A;  3KIA A;  4D11 C;  3F1C A;  3QVB A;  3U2W A;  1JV1 A;  1VPA A;  3JUJ A;  2RJ6 A;  3I0L A;  4ARW A;  3TZT A;  5C3D A;  1ZJ1 A;  4Y7F A;  1YP3 A;  2OI7 A;  4FRQ A;  4M2B A;  5FV9 A;  1GWW A;  2RJ5 A;  3USQ A;  4ECM A;  3CU0 A;  4FRA A;  2DPW A;  3U2T A;  2YES A;  1LVW A;  1G3L A;  1W55 A;  4J18 A;  1H5S A;  3I0F A;  4P02 A;  3V8Z A;  1GWV A;  5J49 A;  5FU0 A;  3POL A;  3SPT A;  2RJ8 A;  1R82 A;  4HO9 A;  3CGX A;  1XHB A;  1QG8 A;  2JCK A;  3TQD A;  2PA4 A;  1S4O A;  1H4E A;  2WVL A;  2FYA A;  4HO3 A;  2AM4 A;  1ZI1 A;  2VXL A;  4KC1 A;  2W0W A;  1YP4 A;  3U0Y A;  4BQH A;  1ZJ0 A;  3PKQ A;  1H5R B;  4Y64 A;  1O7Q A;  5CQL X;  1H7G A;  1VZU A;  1QGQ A;  1VGU A;  1HJL A;  1LZJ A;  1G23 A;  2YQJ A;  1LZI A;  2ICY A;  3I0I X;  4KXO A;  1LL3 A;  2BO7 A;  2Y6P A;  4EEO A;  1H4D A;  3FWW A;  2FFU A;  2X5S A;  3FOQ A;  2V0H A;  4KNX A;  4B4B A;  2RJ4 A;  2CU2 A;  3BRK X;  1G9R A;  1VGW A;  3V90 A;  2RIY A;  2GGO A;  1E5K A;  4XWI A;  4FRP A;  1ZJ3 A;  2AM3 A;  2VSH A;  4FRM A;  1ZDF A;  4AC3 A;  1GX4 A;  1H5S D;  3DK5 A;  4B4M A;  5C48 A;  2VS4 A;  2P72 A;  4AYL A;  1YRO B;  1FR9 A;  1H5S C;  3CKV A;  2OI5 A;  5C4D A;  1S4P A;  2P73 A;  4Y6N A;  5C3A A;  3OH4 A;  1VM8 A;  1H7T A;  2P6W A;  3OH1 A;  3D98 A;  5C49 A;  1ZI4 A;  1V84 A;  4BMA A;  1JYL A;  1MC3 A;  1LL0 A;  2VFZ A;  4Y63 A;  5CMH A;  2WVK A;  3HL3 A;  1WSZ A;  1MP3 A;  3OAM A;  3OH2 A;  5AJN A;  1R80 A;  4CVH A;  3CKO A;  1EYR A;  3I0G A;  5C3B A;  4G3P A;  4HO0 A;  4EVW A;  4HCQ A;  4NAL A;  1VGT A;  1IIM A;  2V0L A;  5EJZ A;  4HO4 A;  3D5N A;  2UX8 A;  1OMX A;  1G93 A;  3F1Y A;  4FRH A;  4AYJ A;  2JCO A;  4E1K A;  1FXO A;  4EEG A;  4ASY A;  4K6R A;  4ASJ A;  4B4G A;  2YC3 A;  4FRE A;  2FYD B;  3T7O A;  4EE4 A;  1R7X A;  4ZDQ A;  1ZDG A;  3V91 A;  4KPX A;  1V82 A;  2D7R A;  3I0C A;  5FYE A;  1H7L A;  3DJ4 A;  2PGY A;  4DE7 A;  1FXJ A;  1MP4 A;  4G3Q A;  2XME A;  1H5T A;  1V83 A;  4B2W A;  1O0R A;  1KWS A;  1IIN A;  2I5K A;  2JCJ A;  1FZW A;  2Y4K A;  3V8Y A;  5BXC A;  1H5S B;  2O1G A;  1ZCY A;  3IOH A;  5CQO A;  4P00 A;  1G0R A;  1HM8 A;  1ZHJ A;  3ZLL A;  3E26 A;  1ZI5 A;  2RJ0 A;  3U0X A;  4R7P A;  2AE7 A;  2OI6 A;  4UEG A;  4CJC A;  3LW6 A;  1GA8 A;  3V0Q A;  4Y7U A;  2D7I A;  2A8U A;  1FO8 A;  1ON8 A;  2FFV A;  2XWL A;  1INJ A;  1ZCV A;  2E8B A;  5C4F A;  2PX7 A;  1TW1 A;  3U2V A;  3Q80 A;  3I0J A;  2PGV A;  5FTV A;  4MND A;  4FRD A;  4HO8 A;  3SX3 A;  5IDS A;  1LL2 A;  5C36 A;  2O1F A;  1GX0 A;  3OGZ A;  3SXG A;  1R7T A;  3N9W A;  5FTS A;  4Y6U A;  1JYK A;  1YP2 A;  2RJ7 A;  2FYB A;  1NHE B;  5C4E A;  2JCL A;  1QGS A;  1ZJ2 A;  4D0T A;  4DDZ A;  4LW3 A;  1XZ6 A;  1ZJP A;  1VH1 A;  3ZLK A;  1H7E A;  1HM0 A;  2Y4M A;  1ON6 A;  1S4N A;  3OC9 A;  1FOA A;  3K8D A;  5C4B A;  1LZ7 A;  3EE5 A;  4EE5 A;  2BO4 A;  4D48 A;  3T7N A;  2WVM A;  4NAI A;  2D0J A;  1WT2 A;  2QGI A;  1EZI A;  5I1F A;  4LW6 A;  2OEF A;  4M2A A;  1VGZ A;  2VS3 A;  2Z87 A;  1VZT A;  1VZX A;  1FWY A;  2YQC A;  1FGX A;  1QWJ A;  4FRL A;  2Z86 A;  3OH0 A;  1H7H A;  2WGZ A;  5L6S A;  3GUE A;  1H5R A;  3ST8 A;  3SXD A; 
#chains in the Genus database with same CATH topology
 2RJ9 A;  3K8E A;  2Y4J A;  2E3D A;  2MZB A;  3OKR A;  1R7V A;  1NF5 B;  2WE9 A;  2X65 A;  2J0B A;  5CQM X;  4O6M A;  4D11 A;  1R7U A;  3U2X A;  1ZCT A;  2WEE A;  4Y9X A;  5D91 A;  2RIT A;  4HO2 A;  4B5B A;  4FQW A;  1WT3 A;  2YCM A;  4EEM A;  5CMF X;  5C1L A;  2V0J A;  3Q4S A;  2AES A;  1MP5 A;  4HOC A;  4AAW A;  4L41 C;  2VD4 A;  2VXM A;  2RJ1 A;  3I0H A;  5AJO A;  5CQN X;  1Z90 A;  1NWG B;  4JD0 A;  1R7Y A;  1ZI3 A;  4Y7V A;  3JUK A;  4G87 A;  1G2V A;  1TVY A;  3CKN A;  2AGD A;  2BO8 A;  3CKJ A;  3I0E A;  1I52 A;  1H7Q A;  5L6V A;  3U2U A;  2AEC A;  5C4C A;  4HG6 A;  4KNR A;  1O23 B;  2X60 A;  4B3U A;  1JVG A;  4CJB A;  5IDT A;  3IOI A;  3SXC A;  3RMV A;  1TZF A;  2XWN A;  1H4C A;  3V0P A;  2ICX A;  2QKX A;  3SXA A;  3R2W A;  2Y4L A;  1JV3 A;  2ZU7 A;  1GQ9 A;  2ZU9 A;  3ZGF A;  4B42 A;  5C38 A;  2OEG A;  3IOJ A;  4NAK A;  3ZF8 A;  4KRV A;  2Q4J A;  4IRP A;  2BO6 A;  3CKQ A;  1FG5 N;  4M4K A;  2O1H A;  2AH9 A;  5DDV A;  4FIY A;  1FRW A;  2I5E A;  1G1L A;  1W77 A;  3PNN A;  1TW5 A;  3O3P A;  2W0V A;  4HO6 A;  3I0K A;  2YQS A;  5FUH A;  3ZGG A;  4EEA A;  1WT0 A;  3SX5 A;  3T7M A;  4KPZ A;  4MYB A;  4Q7C A;  4KQL A;  1FR8 A;  1LZ0 A;  4FCE A;  2V0I A;  5D92 A;  5C47 A;  2APC A;  2VS5 A;  2FYC B;  4KT7 A;  2XWM A;  2J0A A;  5EJ1 A;  3V0N A;  1NKH B;  2NXV A;  1ZCU A;  2YQH A;  1PZT A;  1ZIZ A;  3I0D A;  5HS2 A;  5C8R A;  5DDT A;  5C1H A;  4HO5 A;  1H3M A;  1INI A;  1PZY B;  2ZU8 A;  2X5Z A;  2VSI A;  4EE3 A;  1FO9 A;  5JQQ A;  4KC4 A;  3OH3 A;  3V0M A;  1R81 A;  1H7F A;  4FRB A;  5CQP A;  1WVC A;  1HV9 A;  1WT1 A;  3Q7U A;  4FCU A;  5FU8 A;  5IFY A;  4NAN A;  5C1G A;  1HM9 A;  3BCV A;  4CJ8 A;  3V0O A;  4KC2 A;  5CMG X;  1ZJO A;  3RMW A;  3SX7 A;  3V0L A;  4DEC A;  4C2S A;  1VIC A;  4Y7G A;  3E25 A;  2Y7A A;  3JTJ A;  5EIY A;  1HJJ A;  4M28 A;  3R3I A;  2RIX A;  3NGW A;  1G8O A;  2GGQ A;  1H5T B;  2I7B A;  1JVD A;  4G3S A;  3SX8 A;  1G97 A;  2QH5 A;  2VK9 A;  5CMI A;  2RIZ A;  3DUV A;  1NQI B;  4D0Z A;  1GQC A;  1K4V A;  1VH3 A;  4Y62 A;  2WAW A;  3PKP A;  2V0K A;  2C0N A;  1OMZ A;  4GBP A;  1SS9 A;  4FRO A;  1W57 A;  4JIS A;  2FY7 A;  3USR A;  3D8V A;  3SXB A;  1O7O A;  2AM5 A;  4Y7T A;  4B2X A;  3SXE A;  4IRQ A;  1OQM B;  1FGG A;  2YC5 A;  1G95 A;  3RSB A;  2A8W A;  2XMH A;  5AJP A;  5CMJ A;  1NMM B;  4YS8 A;  3KIA A;  4D11 C;  3F1C A;  3QVB A;  3U2W A;  1JV1 A;  1VPA A;  3JUJ A;  2RJ6 A;  3I0L A;  4ARW A;  3TZT A;  5C3D A;  1ZJ1 A;  4Y7F A;  1YP3 A;  2OI7 A;  4FRQ A;  4M2B A;  5FV9 A;  1GWW A;  2RJ5 A;  3USQ A;  4ECM A;  3CU0 A;  4FRA A;  2DPW A;  3U2T A;  2YES A;  1LVW A;  1G3L A;  1W55 A;  4J18 A;  1H5S A;  3I0F A;  4P02 A;  3V8Z A;  1GWV A;  5J49 A;  5FU0 A;  3POL A;  3SPT A;  2RJ8 A;  1R82 A;  4HO9 A;  3CGX A;  1XHB A;  1QG8 A;  2JCK A;  3TQD A;  2PA4 A;  1S4O A;  1H4E A;  2WVL A;  2FYA A;  4HO3 A;  2AM4 A;  1ZI1 A;  2VXL A;  4KC1 A;  2W0W A;  1YP4 A;  3U0Y A;  4BQH A;  1ZJ0 A;  3PKQ A;  1H5R B;  4Y64 A;  1O7Q A;  5CQL X;  1H7G A;  1VZU A;  1QGQ A;  1VGU A;  1HJL A;  1LZJ A;  1G23 A;  2YQJ A;  1LZI A;  2ICY A;  3I0I X;  4KXO A;  1LL3 A;  2BO7 A;  2Y6P A;  4EEO A;  1H4D A;  3FWW A;  2FFU A;  2X5S A;  3FOQ A;  2V0H A;  4KNX A;  4B4B A;  2RJ4 A;  2CU2 A;  3BRK X;  1G9R A;  1VGW A;  3V90 A;  2RIY A;  2GGO A;  1E5K A;  4XWI A;  4FRP A;  1ZJ3 A;  2AM3 A;  2VSH A;  4FRM A;  1ZDF A;  4AC3 A;  1GX4 A;  1H5S D;  3DK5 A;  4B4M A;  5C48 A;  2VS4 A;  2P72 A;  4AYL A;  1YRO B;  1FR9 A;  1H5S C;  3CKV A;  2OI5 A;  5C4D A;  1S4P A;  2P73 A;  4Y6N A;  5C3A A;  3OH4 A;  1VM8 A;  1H7T A;  2P6W A;  3OH1 A;  3D98 A;  5C49 A;  1ZI4 A;  1V84 A;  4BMA A;  1JYL A;  1MC3 A;  1LL0 A;  2VFZ A;  4Y63 A;  5CMH A;  2WVK A;  3HL3 A;  1WSZ A;  1MP3 A;  3OAM A;  3OH2 A;  5AJN A;  1R80 A;  4CVH A;  3CKO A;  1EYR A;  3I0G A;  5C3B A;  4G3P A;  4HO0 A;  4EVW A;  4HCQ A;  4NAL A;  1VGT A;  1IIM A;  2V0L A;  5EJZ A;  4HO4 A;  3D5N A;  2UX8 A;  1OMX A;  1G93 A;  3F1Y A;  4FRH A;  4AYJ A;  2JCO A;  4E1K A;  1FXO A;  4EEG A;  4ASY A;  4K6R A;  4ASJ A;  4B4G A;  2YC3 A;  4FRE A;  2FYD B;  3T7O A;  4EE4 A;  1R7X A;  4ZDQ A;  1ZDG A;  3V91 A;  4KPX A;  1V82 A;  2D7R A;  3I0C A;  5FYE A;  1H7L A;  3DJ4 A;  2PGY A;  4DE7 A;  1FXJ A;  1MP4 A;  4G3Q A;  2XME A;  1H5T A;  1V83 A;  4B2W A;  1O0R A;  1KWS A;  1IIN A;  2I5K A;  2JCJ A;  1FZW A;  2Y4K A;  3V8Y A;  5BXC A;  1H5S B;  2O1G A;  1ZCY A;  3IOH A;  4MIX A;  4P00 A;  5CQO A;  1G0R A;  1HM8 A;  1ZHJ A;  3ZLL A;  3E26 A;  1ZI5 A;  2RJ0 A;  3U0X A;  4R7P A;  2AE7 A;  2OI6 A;  4UEG A;  4CJC A;  3LW6 A;  1GA8 A;  3V0Q A;  4Y7U A;  2D7I A;  2A8U A;  1FO8 A;  1ON8 A;  2FFV A;  2XWL A;  1INJ A;  1ZCV A;  2E8B A;  5C4F A;  2PX7 A;  1TW1 A;  3U2V A;  3Q80 A;  3I0J A;  2PGV A;  5FTV A;  4MND A;  4FRD A;  4HO8 A;  3SX3 A;  5IDS A;  1LL2 A;  5C36 A;  2O1F A;  1GX0 A;  3OGZ A;  3SXG A;  1R7T A;  3N9W A;  5FTS A;  4Y6U A;  1JYK A;  1YP2 A;  2RJ7 A;  4FIX A;  2FYB A;  1NHE B;  5C4E A;  2JCL A;  1QGS A;  1ZJ2 A;  4D0T A;  4DDZ A;  4LW3 A;  1XZ6 A;  1ZJP A;  1VH1 A;  3ZLK A;  1H7E A;  1HM0 A;  2Y4M A;  1ON6 A;  1S4N A;  3OC9 A;  4O6N A;  1FOA A;  3K8D A;  5C4B A;  1LZ7 A;  3EE5 A;  4EE5 A;  2BO4 A;  4D48 A;  3T7N A;  2WVM A;  4NAI A;  2D0J A;  1WT2 A;  2QGI A;  1EZI A;  5I1F A;  4LW6 A;  2OEF A;  4M2A A;  1VGZ A;  2VS3 A;  2Z87 A;  1VZT A;  1VZX A;  1FWY A;  2YQC A;  1FGX A;  1QWJ A;  4FRL A;  2Z86 A;  3OH0 A;  1H7H A;  2WGZ A;  5L6S A;  3GUE A;  1H5R A;  3ST8 A;  3SXD A; 
#chains in the Genus database with same CATH homology
 2RJ9 A;  3K8E A;  2Y4J A;  2E3D A;  2MZB A;  3OKR A;  1R7V A;  1NF5 B;  2WE9 A;  2X65 A;  2J0B A;  5CQM X;  4O6M A;  4D11 A;  1R7U A;  3U2X A;  1ZCT A;  2WEE A;  4Y9X A;  5D91 A;  2RIT A;  4HO2 A;  4B5B A;  4FQW A;  1WT3 A;  2YCM A;  4EEM A;  5CMF X;  5C1L A;  2V0J A;  3Q4S A;  2AES A;  1MP5 A;  4HOC A;  4AAW A;  4L41 C;  2VD4 A;  2VXM A;  2RJ1 A;  3I0H A;  5AJO A;  5CQN X;  1Z90 A;  1NWG B;  4JD0 A;  1R7Y A;  1ZI3 A;  4Y7V A;  3JUK A;  4G87 A;  1G2V A;  1TVY A;  3CKN A;  2AGD A;  2BO8 A;  3CKJ A;  3I0E A;  1I52 A;  1H7Q A;  5L6V A;  3U2U A;  2AEC A;  5C4C A;  4HG6 A;  4KNR A;  1O23 B;  2X60 A;  4B3U A;  1JVG A;  4CJB A;  5IDT A;  3IOI A;  3SXC A;  3RMV A;  1TZF A;  2XWN A;  1H4C A;  3V0P A;  2ICX A;  2QKX A;  3SXA A;  3R2W A;  2Y4L A;  1JV3 A;  2ZU7 A;  1GQ9 A;  2ZU9 A;  3ZGF A;  4B42 A;  5C38 A;  2OEG A;  3IOJ A;  4NAK A;  3ZF8 A;  4KRV A;  2Q4J A;  4IRP A;  2BO6 A;  3CKQ A;  1FG5 N;  4M4K A;  2O1H A;  2AH9 A;  5DDV A;  4FIY A;  1FRW A;  2I5E A;  1G1L A;  1W77 A;  3PNN A;  1TW5 A;  3O3P A;  2W0V A;  4HO6 A;  3I0K A;  2YQS A;  5FUH A;  3ZGG A;  4EEA A;  1WT0 A;  3SX5 A;  3T7M A;  4KPZ A;  4MYB A;  4Q7C A;  4KQL A;  1FR8 A;  1LZ0 A;  4FCE A;  2V0I A;  5D92 A;  5C47 A;  2APC A;  2VS5 A;  2FYC B;  4KT7 A;  2XWM A;  2J0A A;  5EJ1 A;  3V0N A;  1NKH B;  2NXV A;  1ZCU A;  2YQH A;  1PZT A;  1ZIZ A;  3I0D A;  5HS2 A;  5C8R A;  5DDT A;  5C1H A;  4HO5 A;  1H3M A;  1INI A;  1PZY B;  2ZU8 A;  2X5Z A;  2VSI A;  4EE3 A;  1FO9 A;  5JQQ A;  4KC4 A;  3OH3 A;  3V0M A;  1R81 A;  1H7F A;  4FRB A;  5CQP A;  1WVC A;  1HV9 A;  1WT1 A;  3Q7U A;  4FCU A;  5FU8 A;  5IFY A;  4NAN A;  5C1G A;  1HM9 A;  3BCV A;  4CJ8 A;  3V0O A;  4KC2 A;  5CMG X;  1ZJO A;  3RMW A;  3SX7 A;  3V0L A;  4DEC A;  4C2S A;  1VIC A;  4Y7G A;  3E25 A;  2Y7A A;  3JTJ A;  5EIY A;  1HJJ A;  4M28 A;  3R3I A;  2RIX A;  3NGW A;  1G8O A;  2GGQ A;  1H5T B;  2I7B A;  1JVD A;  4G3S A;  3SX8 A;  1G97 A;  2QH5 A;  2VK9 A;  5CMI A;  2RIZ A;  3DUV A;  1NQI B;  4D0Z A;  1GQC A;  1K4V A;  1VH3 A;  4Y62 A;  2WAW A;  3PKP A;  2V0K A;  2C0N A;  1OMZ A;  4GBP A;  1SS9 A;  4FRO A;  1W57 A;  4JIS A;  2FY7 A;  3USR A;  3D8V A;  3SXB A;  1O7O A;  2AM5 A;  4Y7T A;  4B2X A;  3SXE A;  4IRQ A;  1OQM B;  1FGG A;  2YC5 A;  1G95 A;  3RSB A;  2A8W A;  2XMH A;  5AJP A;  5CMJ A;  1NMM B;  4YS8 A;  3KIA A;  4D11 C;  3F1C A;  3QVB A;  3U2W A;  1JV1 A;  1VPA A;  3JUJ A;  2RJ6 A;  3I0L A;  4ARW A;  3TZT A;  5C3D A;  1ZJ1 A;  4Y7F A;  1YP3 A;  2OI7 A;  4FRQ A;  4M2B A;  5FV9 A;  1GWW A;  2RJ5 A;  3USQ A;  4ECM A;  3CU0 A;  4FRA A;  2DPW A;  3U2T A;  2YES A;  1LVW A;  1G3L A;  1W55 A;  4J18 A;  1H5S A;  3I0F A;  4P02 A;  3V8Z A;  1GWV A;  5J49 A;  5FU0 A;  3POL A;  3SPT A;  2RJ8 A;  1R82 A;  4HO9 A;  3CGX A;  1XHB A;  1QG8 A;  2JCK A;  3TQD A;  2PA4 A;  1S4O A;  1H4E A;  2WVL A;  2FYA A;  4HO3 A;  2AM4 A;  1ZI1 A;  2VXL A;  4KC1 A;  2W0W A;  1YP4 A;  3U0Y A;  4BQH A;  1ZJ0 A;  3PKQ A;  1H5R B;  4Y64 A;  1O7Q A;  5CQL X;  1H7G A;  1VZU A;  1QGQ A;  1VGU A;  1HJL A;  1LZJ A;  1G23 A;  2YQJ A;  1LZI A;  2ICY A;  3I0I X;  4KXO A;  1LL3 A;  2BO7 A;  2Y6P A;  4EEO A;  1H4D A;  3FWW A;  2FFU A;  2X5S A;  3FOQ A;  2V0H A;  4KNX A;  4B4B A;  2RJ4 A;  2CU2 A;  3BRK X;  1G9R A;  1VGW A;  3V90 A;  2RIY A;  2GGO A;  1E5K A;  4XWI A;  4FRP A;  1ZJ3 A;  2AM3 A;  2VSH A;  4FRM A;  1ZDF A;  4AC3 A;  1GX4 A;  1H5S D;  3DK5 A;  4B4M A;  5C48 A;  2VS4 A;  2P72 A;  4AYL A;  1YRO B;  1FR9 A;  1H5S C;  3CKV A;  2OI5 A;  5C4D A;  1S4P A;  2P73 A;  4Y6N A;  5C3A A;  3OH4 A;  1VM8 A;  1H7T A;  2P6W A;  3OH1 A;  3D98 A;  5C49 A;  1ZI4 A;  1V84 A;  4BMA A;  1JYL A;  1MC3 A;  1LL0 A;  2VFZ A;  4Y63 A;  5CMH A;  2WVK A;  3HL3 A;  1WSZ A;  1MP3 A;  3OAM A;  3OH2 A;  5AJN A;  1R80 A;  4CVH A;  3CKO A;  1EYR A;  3I0G A;  5C3B A;  4G3P A;  4HO0 A;  4EVW A;  4HCQ A;  4NAL A;  1VGT A;  1IIM A;  2V0L A;  5EJZ A;  4HO4 A;  3D5N A;  2UX8 A;  1OMX A;  1G93 A;  3F1Y A;  4FRH A;  4AYJ A;  2JCO A;  4E1K A;  1FXO A;  4EEG A;  4ASY A;  4K6R A;  4ASJ A;  4B4G A;  2YC3 A;  4FRE A;  2FYD B;  3T7O A;  4EE4 A;  1R7X A;  4ZDQ A;  1ZDG A;  3V91 A;  4KPX A;  1V82 A;  2D7R A;  3I0C A;  5FYE A;  1H7L A;  3DJ4 A;  2PGY A;  4DE7 A;  1FXJ A;  1MP4 A;  4G3Q A;  2XME A;  1H5T A;  1V83 A;  4B2W A;  1O0R A;  1KWS A;  1IIN A;  2I5K A;  2JCJ A;  1FZW A;  2Y4K A;  3V8Y A;  5BXC A;  1H5S B;  2O1G A;  1ZCY A;  3IOH A;  4MIX A;  4P00 A;  5CQO A;  1G0R A;  1HM8 A;  1ZHJ A;  3ZLL A;  3E26 A;  1ZI5 A;  2RJ0 A;  3U0X A;  4R7P A;  2AE7 A;  2OI6 A;  4UEG A;  4CJC A;  3LW6 A;  1GA8 A;  3V0Q A;  4Y7U A;  2D7I A;  2A8U A;  1FO8 A;  1ON8 A;  2FFV A;  2XWL A;  1INJ A;  1ZCV A;  2E8B A;  5C4F A;  2PX7 A;  1TW1 A;  3U2V A;  3Q80 A;  3I0J A;  2PGV A;  5FTV A;  4MND A;  4FRD A;  4HO8 A;  3SX3 A;  5IDS A;  1LL2 A;  5C36 A;  2O1F A;  1GX0 A;  3OGZ A;  3SXG A;  1R7T A;  3N9W A;  5FTS A;  4Y6U A;  1JYK A;  1YP2 A;  2RJ7 A;  4FIX A;  2FYB A;  1NHE B;  5C4E A;  2JCL A;  1QGS A;  1ZJ2 A;  4D0T A;  4DDZ A;  4LW3 A;  1XZ6 A;  1ZJP A;  1VH1 A;  3ZLK A;  1H7E A;  1HM0 A;  2Y4M A;  1ON6 A;  1S4N A;  3OC9 A;  4O6N A;  1FOA A;  3K8D A;  5C4B A;  1LZ7 A;  3EE5 A;  4EE5 A;  2BO4 A;  4D48 A;  3T7N A;  2WVM A;  4NAI A;  2D0J A;  1WT2 A;  2QGI A;  1EZI A;  5I1F A;  4LW6 A;  2OEF A;  4M2A A;  1VGZ A;  2VS3 A;  2Z87 A;  1VZT A;  1VZX A;  1FWY A;  2YQC A;  1FGX A;  1QWJ A;  4FRL A;  2Z86 A;  3OH0 A;  1H7H A;  2WGZ A;  5L6S A;  3GUE A;  1H5R A;  3ST8 A;  3SXD A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...