1R7XA

Glycosyltransferase b in complex with 3-amino-acceptor analog inhibitor
Total Genus 81
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
81
sequence length
283
structure length
263
Chain Sequence
MVSLPRMVYPQPKVLTPCRKDVLVVTPWLAPIVWEGTFNIDILNEQFRLQNTTIGLTVFAIKKYVAFLKLFLETAEKHFMVGHRVHYYVFTDQPAAVPRVTLGTGRQLSVLEVCERRFLSEVDYLVCVDVDMEFRDHVGVEILTPLFGTLHPSFYGSSREAFTYERRPQSQAYIPKDEGDFYYMGAFFGGSVQEVQRLTRACHQAMMVDQANGIEAVWHDESHLNKYLLRHKPTKVLSPEYLWDQQLLGWPAVLRKLRFTAVP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords Glycoprotein-fucosylgalactoside alpha-galactosyltransferase
publication title The influence of an intramolecular hydrogen bond in differential recognition of inhibitory acceptor analogs by human ABO(H) blood group A and B glycosyltransferases
pubmed doi rcsb
source organism Homo sapiens
total genus 81
structure length 263
sequence length 283
ec nomenclature ec 2.4.1.37: Fucosylgalactoside 3-alpha-galactosyltransferase.
pdb deposition date 2003-10-22
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.550.10 Alpha Beta Alpha-Beta Complex Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A 1r7xA00
2X5ZA 2YC5A 3FOQA 1O23B 1O0RA 2X65A 3V0PA 1G9RA 5I1FA 3V0QA 1H5RA 2VS4A 3Q4SA 1H5TB 2W0WA 2FYAA 4KXOA 1H7TA 3QVBA 5C1LA 1R7VA 1KWSA 1MP4A 2I5KA 4Y63A 2RJ1A 1FOAA 4B4GA 3N9WA 2D7RA 1LL2A 5CQPA 1H5SB 3Q80A 5AJOA 3ZLLA 1WT3A 3D5NA 1HM0A 4KPZA 4Y7GA 4AC3A 4EEMA 5JQQA 2FY7A 2XMEA 4G3QA 2P6WA 3I0JA 1NQIB 4NAIA 5C3AA 4B5BA 2RJ7A 4B42A 3SX8A 5FUHA 1VGTA 1VGUA 1H7FA 2Y4KA 4CVHA 3V8YA 3Q7UA 2VSHA 2ZU7A 2AM4A 2FYBA 1VPAA 1G1LA 2RJ4A 4FQWA 4CJ8A 2JCLA 4HO8A 5EJZA 4FRMA 1R7UA 1VGZA 1LZJA 2RIXA 2AM5A 4FRQA 1ZDFA 3I0FA 4Y6UA 1FO8A 4M4KA 2OEFA 1JV1A 1ON8A 4XWIA 2ZU9A 4FRBA 1IINA 4M2BA 4FRPA 5FV9A 3CU0A 1V83A 1W55A 3DJ4A 1O7OA 1H5SC 4FCEA 1ZCTA 1H3MA 1FWYA 2JCKA 2Y7AA 1S4NA 3GUEA 2OEGA 1FRWA 1QWJA 4HO6A 1ZJ1A 5C48A 1ZHJA 2AE7A 3ST8A 4BMAA 1G97A 3OKRA 1FXJA 2P72A 4D48A 4EE5A 2PX7A 3OH1A 4G3PA 4Y7FA 1Z90A 5FTVA 3SXGA 3U2TA 3I0KA 3V0OA 4YS8A 1VICA 3RMWA 2YQHA 1H5RB 4Y7VA 3SX5A 1HM9A 4HOCA 1WT0A 1GA8A 2RIZA 1INIA 2WVMA 2X60A 2X5SA 1FO9A 2V0KA 2WVKA 5L6VA 3SXBA 1INJA 3F1CA 2AECA 4EVWA 3FWWA 4HO3A 3JUJA 4KC1A 1S4OA 1H7GA 2AGDA 1MP3A 2JCOA 1ZJPA 4G87A 4E1KA 1PZYB 4J18A 5IDSA 1VM8A 2NXVA 2BO8A 3PKQA 2Z86A 3R2WA 2WVLA 3SPTA 1H5SD 2Y6PA 4HO2A 4ECMA 1NF5B 5C47A 1OQMB 3SXEA 3I0GA 4DE7A 2PGVA 3RSBA 4ZDQA 1G23A 2V0IA 2Y4JA 1LVWA 3T7NA 3V0LA 3TZTA 4HO5A 1JV3A 5HS2A 3IOIA 1WT2A 3DK5A 4NALA 2V0HA 1FGXA 1VZUA 1OMZA 2YQJA 1K4VA 1I52A 5FU0A 3OC9A 4Y64A 5EIYA 1H4EA 1QGQA 3JUKA 3U0YA 1HJLA 1H7QA 1GX0A 3CKVA 4D0TA 4AYLA 3I0EA 4FRLA 5CQNX 2Y4MA 4M28A 4KT7A 4B2XA 4FRHA 1SS9A 1LL0A 3EE5A 1NMMB 4KPXA 1JVGA 5IFYA 2QKXA 2AESA 1NKHB 4EEAA 3PNNA 3I0HA 4DECA 1V82A 4FREA 1XZ6A 3SXCA 3E26A 1H5TA 1FZWA 4JD0A 4P02A 2BO4A 1R81A 1OMXA 4NAKA 2O1HA 3IOJA 4FRDA 3USQA 4NANA 3NGWA 5C4BA 5FYEA 3OH3A 1ON6A 2W0VA 2QGIA 2YQSA 4Y7TA 4HO0A 3I0DA 2YESA 2JCJA 5CQOA 5C4EA 3CKQA 2VXLA 1TZFA 5L6SA 1HM8A 2XMHA 3I0IX 2WAWA 1W77A 1H7LA 1R7XA 2YQCA 3F1YA 2WGZA 3CKNA 2AM3A 3I0LA 5C1GA 1ZJ2A 4B3UA 3TQDA 2RJ6A 4L41C 1YP3A 4Y6NA 1ZI4A 1HJJA 4KQLA 2FYCB 2ICYA 3OGZA 3O3PA 4GBPA 1G0RA 3U2VA 5BXCA 5FU8A 4HCQA 1G3LA 1JYKA 3LW6A 1ZCYA 2DPWA 3V90A 3OH0A 4KC4A 5CMHA 1WSZA 1ZJ0A 3CGXA 4HO4A 4IRQA 2FYDB 2APCA 3CKJA 1HV9A 1PZTA 1XHBA 2I7BA 1W57A 2P73A 2YCMA 5CQMX 5C1HA 3D8VA 4HO9A 4MYBA 2GGQA 3JTJA 3POLA 1TW5A 1R80A 1H7HA 4EEOA 2E8BA 5C4FA 1FR8A 1NWGB 2OI7A 1VZTA 2CU2A 1LZ0A 5DDTA 5CMGX 1G93A 2RJ0A 2ZU8A 5C4CA 5C3DA 4FRAA 2OI5A 4IRPA 2Z87A 1ZI1A 4FCUA 4FROA 1LL3A 2A8WA 1R7TA 1GQCA 3ZF8A 2V0LA 1YP4A 4EE3A 5C8RA 1GX4A 3U0XA 1V84A 3U2WA 5C38A 4KRVA 1MP5A 3OAMA 1ZCVA 1G8OA 1VH3A 2AH9A 3ZGFA 3OH4A 4JISA 1QG8A 1GWVA 4ARWA 3HL3A 5EJ1A 1VGWA 2OI6A 2VS5A 1G2VA 5C36A 4G3SA 2BO6A 1WVCA 2D0JA 2YC3A 3V0NA 1JVDA 4AYJA 1G95A 5AJNA 4AAWA 2O1FA 2E3DA 1S4PA 3V0MA 2PGYA 3IOHA 3RMVA 1H4CA 1H4DA 2D7IA 3SXAA 4B2WA 1VZXA 5CMIA 4DDZA 3U2XA 2QH5A 4UEGA 4K6RA 4R7PA 3ZGGA 1ZDGA 1R82A 2VSIA 1ZI5A 4KNXA 2WEEA 3R3IA 4Y62A 4CJCA 3U2UA 3K8EA 2RJ9A 4CJBA 3BCVA 5CMFX 1GQ9A 1H5SA 2VFZA 4P00A 2RJ8A 5C4DA 1LZ7A 2I5EA 1YROB 3USRA 4EE4A 4M2AA 4EEGA 4D11A 2GGOA 2RJ5A 4MNDA 3T7MA 2PA4A 3CKOA 1R7YA 5IDTA 4KNRA 1TVYA 5AJPA 2VXMA 5C49A 3SXDA 3KIAA 3E25A 4B4MA 3OH2A 3DUVA 1MC3A 2Y4LA 1FR9A 2XWNA 4BQHA 2VS3A 2FFVA 1O7QA 2XWLA 3D98A 1ZCUA 1ZJOA 2WE9A 1FG5N 3K8DA 4ASYA 4LW6A 3T7OA 5CMJA 3V8ZA 4D11C 1LZIA 5FTSA 2XWMA 1QGSA 1ZI3A 1ZIZA 2FFUA 1TW1A 1EYRA 4LW3A 1EZIA 1E5KA 2O1GA 1YP2A 5C3BA 3ZLKA 1VH1A 1ZJ3A 5CQLX 1IIMA 2UX8A 1FGGA 3PKPA 3V91A 5DDVA 4B4BA 3BRKX 2VD4A 2RITA 2BO7A 2Q4JA 1WT1A 4C2SA 4KC2A 4Y9XA 2ICXA 1H7EA 1GWWA 1NHEB 2V0JA 2RIYA 4HG6A 4D0ZA 3I0CA 3SX7A 4ASJA 1JYLA 2MZBA 3SX3A 1FXOA 4Y7UA 2A8UA 5J49A
chains in the Genus database with same CATH superfamily
2X5ZA 2YC5A 3FOQA 4MIXA 1O23B 1O0RA 2X65A 2VK9A 3V0PA 1G9RA 5I1FA 3V0QA 1H5RA 2VS4A 3Q4SA 1H5TB 2W0WA 2FYAA 4KXOA 1H7TA 3QVBA 5C1LA 1R7VA 1KWSA 1MP4A 2I5KA 4Y63A 2RJ1A 1FOAA 4B4GA 3N9WA 2D7RA 1LL2A 5CQPA 1H5SB 3Q80A 5AJOA 3ZLLA 1WT3A 3D5NA 1HM0A 4KPZA 4Y7GA 4AC3A 4EEMA 5JQQA 2FY7A 2XMEA 4G3QA 2P6WA 3I0JA 1NQIB 4NAIA 5C3AA 4B5BA 2RJ7A 4B42A 3SX8A 5FUHA 1VGTA 1VGUA 1H7FA 2Y4KA 4CVHA 3V8YA 3Q7UA 2VSHA 2ZU7A 2AM4A 2FYBA 1VPAA 1G1LA 2RJ4A 4FQWA 4CJ8A 2JCLA 4HO8A 5EJZA 4FRMA 1R7UA 1VGZA 1LZJA 2RIXA 2AM5A 4FRQA 1ZDFA 3I0FA 4Y6UA 1FO8A 4M4KA 2OEFA 1JV1A 1ON8A 4XWIA 2ZU9A 4FRBA 1IINA 4M2BA 4FRPA 5FV9A 3CU0A 1V83A 1W55A 3DJ4A 1O7OA 1H5SC 4FCEA 1ZCTA 1H3MA 1FWYA 2JCKA 2Y7AA 1S4NA 3GUEA 2OEGA 1FRWA 1QWJA 4HO6A 1ZJ1A 5C48A 1ZHJA 2AE7A 3ST8A 4BMAA 1G97A 3OKRA 1FXJA 2P72A 4D48A 4EE5A 2PX7A 3OH1A 4G3PA 4Y7FA 1Z90A 5FTVA 3SXGA 3U2TA 3I0KA 3V0OA 4YS8A 1VICA 3RMWA 2YQHA 1H5RB 4Y7VA 3SX5A 1HM9A 4Q7CA 4HOCA 1WT0A 1GA8A 2RIZA 1INIA 2WVMA 2X60A 2X5SA 4FIYA 1FO9A 2V0KA 2WVKA 5L6VA 3SXBA 1INJA 3F1CA 2AECA 4EVWA 3FWWA 4HO3A 3JUJA 4KC1A 1S4OA 1H7GA 2AGDA 1MP3A 2JCOA 1ZJPA 4G87A 4E1KA 1PZYB 4J18A 5IDSA 1VM8A 2NXVA 2BO8A 3PKQA 2Z86A 3R2WA 4O6NA 2WVLA 3SPTA 1H5SD 2Y6PA 4HO2A 4ECMA 1NF5B 5C47A 1OQMB 3SXEA 3I0GA 4DE7A 2PGVA 3RSBA 4ZDQA 1G23A 2V0IA 2Y4JA 1LVWA 3T7NA 3V0LA 3TZTA 4HO5A 1JV3A 5HS2A 3IOIA 1WT2A 3DK5A 4NALA 2V0HA 1FGXA 1VZUA 1OMZA 2YQJA 5D91A 1K4VA 1I52A 5FU0A 3OC9A 4Y64A 5EIYA 1H4EA 1QGQA 3JUKA 3U0YA 1HJLA 1H7QA 1GX0A 3CKVA 4D0TA 4AYLA 3I0EA 4FRLA 5CQNX 2Y4MA 4M28A 4KT7A 4B2XA 4FRHA 1SS9A 1LL0A 3EE5A 1NMMB 4KPXA 1JVGA 5IFYA 2QKXA 2AESA 1NKHB 4EEAA 3PNNA 3I0HA 4DECA 1V82A 4FREA 1XZ6A 3SXCA 3E26A 1H5TA 1FZWA 4JD0A 4P02A 2BO4A 1R81A 1OMXA 4NAKA 2O1HA 3IOJA 4FRDA 3USQA 4NANA 3NGWA 5C4BA 5FYEA 3OH3A 1ON6A 2W0VA 2QGIA 2YQSA 4Y7TA 4HO0A 3I0DA 2YESA 2JCJA 5CQOA 5C4EA 3CKQA 2VXLA 1TZFA 5L6SA 1HM8A 2XMHA 3I0IX 2WAWA 1W77A 1H7LA 1R7XA 2YQCA 3F1YA 2WGZA 3CKNA 2AM3A 3I0LA 5C1GA 1ZJ2A 4B3UA 3TQDA 2RJ6A 4L41C 1YP3A 4Y6NA 5D92A 1ZI4A 1HJJA 4KQLA 2FYCB 2ICYA 3OGZA 3O3PA 4GBPA 1G0RA 3U2VA 5BXCA 5FU8A 4HCQA 1G3LA 1JYKA 3LW6A 1ZCYA 2DPWA 3V90A 3OH0A 4KC4A 5CMHA 1WSZA 2J0BA 1ZJ0A 3CGXA 4HO4A 4IRQA 2FYDB 2APCA 3CKJA 1HV9A 1PZTA 1XHBA 2I7BA 1W57A 2P73A 2YCMA 5CQMX 5C1HA 3D8VA 4HO9A 4MYBA 2GGQA 3JTJA 3POLA 1TW5A 1R80A 1H7HA 4EEOA 2E8BA 5C4FA 1FR8A 1NWGB 2OI7A 1VZTA 2CU2A 1LZ0A 5DDTA 5CMGX 1G93A 2RJ0A 2ZU8A 5C4CA 5C3DA 4FRAA 2OI5A 4IRPA 2Z87A 1ZI1A 4FCUA 4FROA 1LL3A 2A8WA 1R7TA 1GQCA 3ZF8A 2V0LA 1YP4A 4EE3A 5C8RA 1GX4A 3U0XA 1V84A 3U2WA 5C38A 4KRVA 1MP5A 3OAMA 1ZCVA 1G8OA 1VH3A 2AH9A 3ZGFA 3OH4A 4JISA 1QG8A 1GWVA 4ARWA 3HL3A 5EJ1A 1VGWA 2OI6A 2VS5A 1G2VA 5C36A 4G3SA 2BO6A 1WVCA 2D0JA 2YC3A 3V0NA 1JVDA 4AYJA 1G95A 5AJNA 4AAWA 2O1FA 2E3DA 1S4PA 3V0MA 2PGYA 3IOHA 3RMVA 1H4CA 1H4DA 2D7IA 3SXAA 4B2WA 1VZXA 5CMIA 4DDZA 3U2XA 2QH5A 4UEGA 4K6RA 4R7PA 3ZGGA 1ZDGA 1R82A 2VSIA 1ZI5A 4KNXA 2WEEA 3R3IA 4Y62A 4CJCA 3U2UA 3K8EA 2RJ9A 4CJBA 2J0AA 3BCVA 5CMFX 1GQ9A 1H5SA 2VFZA 4P00A 2RJ8A 5C4DA 1LZ7A 2I5EA 1YROB 3USRA 4EE4A 4M2AA 4EEGA 4D11A 2GGOA 2RJ5A 4MNDA 3T7MA 2PA4A 3CKOA 1R7YA 5IDTA 4KNRA 2C0NA 1TVYA 5AJPA 2VXMA 5C49A 3SXDA 3KIAA 3E25A 4B4MA 3OH2A 4O6MA 3DUVA 1MC3A 2Y4LA 1FR9A 2XWNA 4BQHA 2VS3A 2FFVA 1O7QA 2XWLA 3D98A 1ZCUA 1ZJOA 2WE9A 1FG5N 3K8DA 4ASYA 4LW6A 3T7OA 5CMJA 3V8ZA 4D11C 1LZIA 5FTSA 2XWMA 1QGSA 1ZI3A 1ZIZA 2FFUA 1TW1A 1EYRA 4LW3A 1EZIA 1E5KA 2O1GA 1YP2A 5C3BA 3ZLKA 1VH1A 1ZJ3A 5CQLX 1IIMA 2UX8A 1FGGA 3PKPA 3V91A 5DDVA 4B4BA 3BRKX 2VD4A 2RITA 2BO7A 2Q4JA 1WT1A 4C2SA 4KC2A 4Y9XA 2ICXA 1H7EA 1GWWA 1NHEB 2V0JA 2RIYA 4FIXA 4HG6A 4D0ZA 3I0CA 3SX7A 4ASJA 1JYLA 2MZBA 3SX3A 1FXOA 4Y7UA 2A8UA 5J49A
chains in the Genus database with same CATH topology
2X5ZA 2YC5A 3FOQA 4MIXA 1O23B 1O0RA 2X65A 2VK9A 3V0PA 1G9RA 5I1FA 3V0QA 1H5RA 2VS4A 3Q4SA 1H5TB 2W0WA 2FYAA 4KXOA 1H7TA 3QVBA 5C1LA 1R7VA 1KWSA 1MP4A 2I5KA 4Y63A 2RJ1A 1FOAA 4B4GA 3N9WA 2D7RA 1LL2A 5CQPA 1H5SB 3Q80A 5AJOA 3ZLLA 1WT3A 3D5NA 1HM0A 4KPZA 4Y7GA 4AC3A 4EEMA 5JQQA 2FY7A 2XMEA 4G3QA 2P6WA 3I0JA 1NQIB 4NAIA 5C3AA 4B5BA 2RJ7A 4B42A 3SX8A 5FUHA 1VGTA 1VGUA 1H7FA 2Y4KA 4CVHA 3V8YA 3Q7UA 2VSHA 2ZU7A 2AM4A 2FYBA 1VPAA 1G1LA 2RJ4A 4FQWA 4CJ8A 2JCLA 4HO8A 5EJZA 4FRMA 1R7UA 1VGZA 1LZJA 2RIXA 2AM5A 4FRQA 1ZDFA 3I0FA 4Y6UA 1FO8A 4M4KA 2OEFA 1JV1A 1ON8A 4XWIA 2ZU9A 4FRBA 1IINA 4M2BA 4FRPA 5FV9A 3CU0A 1V83A 1W55A 3DJ4A 1O7OA 1H5SC 4FCEA 1ZCTA 1H3MA 1FWYA 2JCKA 2Y7AA 1S4NA 3GUEA 2OEGA 1FRWA 1QWJA 4HO6A 1ZJ1A 5C48A 1ZHJA 2AE7A 3ST8A 4BMAA 1G97A 3OKRA 1FXJA 2P72A 4D48A 4EE5A 2PX7A 3OH1A 4G3PA 4Y7FA 1Z90A 5FTVA 3SXGA 3U2TA 3I0KA 3V0OA 4YS8A 1VICA 3RMWA 2YQHA 1H5RB 4Y7VA 3SX5A 1HM9A 4Q7CA 4HOCA 1WT0A 1GA8A 2RIZA 1INIA 2WVMA 2X60A 2X5SA 4FIYA 1FO9A 2V0KA 2WVKA 5L6VA 3SXBA 1INJA 3F1CA 2AECA 4EVWA 3FWWA 4HO3A 3JUJA 4KC1A 1S4OA 1H7GA 2AGDA 1MP3A 2JCOA 1ZJPA 4G87A 4E1KA 1PZYB 4J18A 5IDSA 1VM8A 2NXVA 2BO8A 3PKQA 2Z86A 3R2WA 4O6NA 2WVLA 3SPTA 1H5SD 2Y6PA 4HO2A 4ECMA 1NF5B 5C47A 1OQMB 3SXEA 3I0GA 4DE7A 2PGVA 3RSBA 4ZDQA 1G23A 2V0IA 2Y4JA 1LVWA 3T7NA 3V0LA 3TZTA 4HO5A 1JV3A 5HS2A 3IOIA 1WT2A 3DK5A 4NALA 2V0HA 1FGXA 1VZUA 1OMZA 2YQJA 5D91A 1K4VA 1I52A 5FU0A 3OC9A 4Y64A 5EIYA 1H4EA 1QGQA 3JUKA 3U0YA 1HJLA 1H7QA 1GX0A 3CKVA 4D0TA 4AYLA 3I0EA 4FRLA 5CQNX 2Y4MA 4M28A 4KT7A 4B2XA 4FRHA 1SS9A 1LL0A 3EE5A 1NMMB 4KPXA 1JVGA 5IFYA 2QKXA 2AESA 1NKHB 4EEAA 3PNNA 3I0HA 4DECA 1V82A 4FREA 1XZ6A 3SXCA 3E26A 1H5TA 1FZWA 4JD0A 4P02A 2BO4A 1R81A 1OMXA 4NAKA 2O1HA 3IOJA 4FRDA 3USQA 4NANA 3NGWA 5C4BA 5FYEA 3OH3A 1ON6A 2W0VA 2QGIA 2YQSA 4Y7TA 4HO0A 3I0DA 2YESA 2JCJA 5CQOA 5C4EA 3CKQA 2VXLA 1TZFA 5L6SA 1HM8A 2XMHA 3I0IX 2WAWA 1W77A 1H7LA 1R7XA 2YQCA 3F1YA 2WGZA 3CKNA 2AM3A 3I0LA 5C1GA 1ZJ2A 4B3UA 3TQDA 2RJ6A 4L41C 1YP3A 4Y6NA 5D92A 1ZI4A 1HJJA 4KQLA 2FYCB 2ICYA 3OGZA 3O3PA 4GBPA 1G0RA 3U2VA 5BXCA 5FU8A 4HCQA 1G3LA 1JYKA 3LW6A 1ZCYA 2DPWA 3V90A 3OH0A 4KC4A 5CMHA 1WSZA 2J0BA 1ZJ0A 3CGXA 4HO4A 4IRQA 2FYDB 2APCA 3CKJA 1HV9A 1PZTA 1XHBA 2I7BA 1W57A 2P73A 2YCMA 5CQMX 5C1HA 3D8VA 4HO9A 4MYBA 2GGQA 3JTJA 3POLA 1TW5A 1R80A 1H7HA 4EEOA 2E8BA 5C4FA 1FR8A 1NWGB 2OI7A 1VZTA 2CU2A 1LZ0A 5DDTA 5CMGX 1G93A 2RJ0A 2ZU8A 5C4CA 5C3DA 4FRAA 2OI5A 4IRPA 2Z87A 1ZI1A 4FCUA 4FROA 1LL3A 2A8WA 1R7TA 1GQCA 3ZF8A 2V0LA 1YP4A 4EE3A 5C8RA 1GX4A 3U0XA 1V84A 3U2WA 5C38A 4KRVA 1MP5A 3OAMA 1ZCVA 1G8OA 1VH3A 2AH9A 3ZGFA 3OH4A 4JISA 1QG8A 1GWVA 4ARWA 3HL3A 5EJ1A 1VGWA 2OI6A 2VS5A 1G2VA 5C36A 4G3SA 2BO6A 1WVCA 2D0JA 2YC3A 3V0NA 1JVDA 4AYJA 1G95A 5AJNA 4AAWA 2O1FA 2E3DA 1S4PA 3V0MA 2PGYA 3IOHA 3RMVA 1H4CA 1H4DA 2D7IA 3SXAA 4B2WA 1VZXA 5CMIA 4DDZA 3U2XA 2QH5A 4UEGA 4K6RA 4R7PA 3ZGGA 1ZDGA 1R82A 2VSIA 1ZI5A 4KNXA 2WEEA 3R3IA 4Y62A 4CJCA 3U2UA 3K8EA 2RJ9A 4CJBA 2J0AA 3BCVA 5CMFX 1GQ9A 1H5SA 2VFZA 4P00A 2RJ8A 5C4DA 1LZ7A 2I5EA 1YROB 3USRA 4EE4A 4M2AA 4EEGA 4D11A 2GGOA 2RJ5A 4MNDA 3T7MA 2PA4A 3CKOA 1R7YA 5IDTA 4KNRA 2C0NA 1TVYA 5AJPA 2VXMA 5C49A 3SXDA 3KIAA 3E25A 4B4MA 3OH2A 4O6MA 3DUVA 1MC3A 2Y4LA 1FR9A 2XWNA 4BQHA 2VS3A 2FFVA 1O7QA 2XWLA 3D98A 1ZCUA 1ZJOA 2WE9A 1FG5N 3K8DA 4ASYA 4LW6A 3T7OA 5CMJA 3V8ZA 4D11C 1LZIA 5FTSA 2XWMA 1QGSA 1ZI3A 1ZIZA 2FFUA 1TW1A 1EYRA 4LW3A 1EZIA 1E5KA 2O1GA 1YP2A 5C3BA 3ZLKA 1VH1A 1ZJ3A 5CQLX 1IIMA 2UX8A 1FGGA 3PKPA 3V91A 5DDVA 4B4BA 3BRKX 2VD4A 2RITA 2BO7A 2Q4JA 1WT1A 4C2SA 4KC2A 4Y9XA 2ICXA 1H7EA 1GWWA 1NHEB 2V0JA 2RIYA 4FIXA 4HG6A 4D0ZA 3I0CA 3SX7A 4ASJA 1JYLA 2MZBA 3SX3A 1FXOA 4Y7UA 2A8UA 5J49A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2X5Z A;  2YC5 A;  3FOQ A;  1O23 B;  1O0R A;  2X65 A;  3V0P A;  1G9R A;  5I1F A;  3V0Q A;  1H5R A;  2VS4 A;  3Q4S A;  1H5T B;  2W0W A;  2FYA A;  4KXO A;  1H7T A;  3QVB A;  5C1L A;  1R7V A;  1KWS A;  1MP4 A;  2I5K A;  4Y63 A;  2RJ1 A;  1FOA A;  4B4G A;  3N9W A;  2D7R A;  1LL2 A;  5CQP A;  1H5S B;  3Q80 A;  5AJO A;  3ZLL A;  1WT3 A;  3D5N A;  1HM0 A;  4KPZ A;  4Y7G A;  4AC3 A;  4EEM A;  5JQQ A;  2FY7 A;  2XME A;  4G3Q A;  2P6W A;  3I0J A;  1NQI B;  4NAI A;  5C3A A;  4B5B A;  2RJ7 A;  4B42 A;  3SX8 A;  5FUH A;  1VGT A;  1VGU A;  1H7F A;  2Y4K A;  4CVH A;  3V8Y A;  3Q7U A;  2VSH A;  2ZU7 A;  2AM4 A;  2FYB A;  1VPA A;  1G1L A;  2RJ4 A;  4FQW A;  4CJ8 A;  2JCL A;  4HO8 A;  5EJZ A;  4FRM A;  1R7U A;  1VGZ A;  1LZJ A;  2RIX A;  2AM5 A;  4FRQ A;  1ZDF A;  3I0F A;  4Y6U A;  1FO8 A;  4M4K A;  2OEF A;  1JV1 A;  1ON8 A;  4XWI A;  2ZU9 A;  4FRB A;  1IIN A;  4M2B A;  4FRP A;  5FV9 A;  3CU0 A;  1V83 A;  1W55 A;  3DJ4 A;  1O7O A;  1H5S C;  4FCE A;  1ZCT A;  1H3M A;  1FWY A;  2JCK A;  2Y7A A;  1S4N A;  3GUE A;  2OEG A;  1FRW A;  1QWJ A;  4HO6 A;  1ZJ1 A;  5C48 A;  1ZHJ A;  2AE7 A;  3ST8 A;  4BMA A;  1G97 A;  3OKR A;  1FXJ A;  2P72 A;  4D48 A;  4EE5 A;  2PX7 A;  3OH1 A;  4G3P A;  4Y7F A;  1Z90 A;  5FTV A;  3SXG A;  3U2T A;  3I0K A;  3V0O A;  4YS8 A;  1VIC A;  3RMW A;  2YQH A;  1H5R B;  4Y7V A;  3SX5 A;  1HM9 A;  4HOC A;  1WT0 A;  1GA8 A;  2RIZ A;  1INI A;  2WVM A;  2X60 A;  2X5S A;  1FO9 A;  2V0K A;  2WVK A;  5L6V A;  3SXB A;  1INJ A;  3F1C A;  2AEC A;  4EVW A;  3FWW A;  4HO3 A;  3JUJ A;  4KC1 A;  1S4O A;  1H7G A;  2AGD A;  1MP3 A;  2JCO A;  1ZJP A;  4G87 A;  4E1K A;  1PZY B;  4J18 A;  5IDS A;  1VM8 A;  2NXV A;  2BO8 A;  3PKQ A;  2Z86 A;  3R2W A;  2WVL A;  3SPT A;  1H5S D;  2Y6P A;  4HO2 A;  4ECM A;  1NF5 B;  5C47 A;  1OQM B;  3SXE A;  3I0G A;  4DE7 A;  2PGV A;  3RSB A;  4ZDQ A;  1G23 A;  2V0I A;  2Y4J A;  1LVW A;  3T7N A;  3V0L A;  3TZT A;  4HO5 A;  1JV3 A;  5HS2 A;  3IOI A;  1WT2 A;  3DK5 A;  4NAL A;  2V0H A;  1FGX A;  1VZU A;  1OMZ A;  2YQJ A;  1K4V A;  1I52 A;  5FU0 A;  3OC9 A;  4Y64 A;  5EIY A;  1H4E A;  1QGQ A;  3JUK A;  3U0Y A;  1HJL A;  1H7Q A;  1GX0 A;  3CKV A;  4D0T A;  4AYL A;  3I0E A;  4FRL A;  5CQN X;  2Y4M A;  4M28 A;  4KT7 A;  4B2X A;  4FRH A;  1SS9 A;  1LL0 A;  3EE5 A;  1NMM B;  4KPX A;  1JVG A;  5IFY A;  2QKX A;  2AES A;  1NKH B;  4EEA A;  3PNN A;  3I0H A;  4DEC A;  1V82 A;  4FRE A;  1XZ6 A;  3SXC A;  3E26 A;  1H5T A;  1FZW A;  4JD0 A;  4P02 A;  2BO4 A;  1R81 A;  1OMX A;  4NAK A;  2O1H A;  3IOJ A;  4FRD A;  3USQ A;  4NAN A;  3NGW A;  5C4B A;  5FYE A;  3OH3 A;  1ON6 A;  2W0V A;  2QGI A;  2YQS A;  4Y7T A;  4HO0 A;  3I0D A;  2YES A;  2JCJ A;  5CQO A;  5C4E A;  3CKQ A;  2VXL A;  1TZF A;  5L6S A;  1HM8 A;  2XMH A;  3I0I X;  2WAW A;  1W77 A;  1H7L A;  1R7X A;  2YQC A;  3F1Y A;  2WGZ A;  3CKN A;  2AM3 A;  3I0L A;  5C1G A;  1ZJ2 A;  4B3U A;  3TQD A;  2RJ6 A;  4L41 C;  1YP3 A;  4Y6N A;  1ZI4 A;  1HJJ A;  4KQL A;  2FYC B;  2ICY A;  3OGZ A;  3O3P A;  4GBP A;  1G0R A;  3U2V A;  5BXC A;  5FU8 A;  4HCQ A;  1G3L A;  1JYK A;  3LW6 A;  1ZCY A;  2DPW A;  3V90 A;  3OH0 A;  4KC4 A;  5CMH A;  1WSZ A;  1ZJ0 A;  3CGX A;  4HO4 A;  4IRQ A;  2FYD B;  2APC A;  3CKJ A;  1HV9 A;  1PZT A;  1XHB A;  2I7B A;  1W57 A;  2P73 A;  2YCM A;  5CQM X;  5C1H A;  3D8V A;  4HO9 A;  4MYB A;  2GGQ A;  3JTJ A;  3POL A;  1TW5 A;  1R80 A;  1H7H A;  4EEO A;  2E8B A;  5C4F A;  1FR8 A;  1NWG B;  2OI7 A;  1VZT A;  2CU2 A;  1LZ0 A;  5DDT A;  5CMG X;  1G93 A;  2RJ0 A;  2ZU8 A;  5C4C A;  5C3D A;  4FRA A;  2OI5 A;  4IRP A;  2Z87 A;  1ZI1 A;  4FCU A;  4FRO A;  1LL3 A;  2A8W A;  1R7T A;  1GQC A;  3ZF8 A;  2V0L A;  1YP4 A;  4EE3 A;  5C8R A;  1GX4 A;  3U0X A;  1V84 A;  3U2W A;  5C38 A;  4KRV A;  1MP5 A;  3OAM A;  1ZCV A;  1G8O A;  1VH3 A;  2AH9 A;  3ZGF A;  3OH4 A;  4JIS A;  1QG8 A;  1GWV A;  4ARW A;  3HL3 A;  5EJ1 A;  1VGW A;  2OI6 A;  2VS5 A;  1G2V A;  5C36 A;  4G3S A;  2BO6 A;  1WVC A;  2D0J A;  2YC3 A;  3V0N A;  1JVD A;  4AYJ A;  1G95 A;  5AJN A;  4AAW A;  2O1F A;  2E3D A;  1S4P A;  3V0M A;  2PGY A;  3IOH A;  3RMV A;  1H4C A;  1H4D A;  2D7I A;  3SXA A;  4B2W A;  1VZX A;  5CMI A;  4DDZ A;  3U2X A;  2QH5 A;  4UEG A;  4K6R A;  4R7P A;  3ZGG A;  1ZDG A;  1R82 A;  2VSI A;  1ZI5 A;  4KNX A;  2WEE A;  3R3I A;  4Y62 A;  4CJC A;  3U2U A;  3K8E A;  2RJ9 A;  4CJB A;  3BCV A;  5CMF X;  1GQ9 A;  1H5S A;  2VFZ A;  4P00 A;  2RJ8 A;  5C4D A;  1LZ7 A;  2I5E A;  1YRO B;  3USR A;  4EE4 A;  4M2A A;  4EEG A;  4D11 A;  2GGO A;  2RJ5 A;  4MND A;  3T7M A;  2PA4 A;  3CKO A;  1R7Y A;  5IDT A;  4KNR A;  1TVY A;  5AJP A;  2VXM A;  5C49 A;  3SXD A;  3KIA A;  3E25 A;  4B4M A;  3OH2 A;  3DUV A;  1MC3 A;  2Y4L A;  1FR9 A;  2XWN A;  4BQH A;  2VS3 A;  2FFV A;  1O7Q A;  2XWL A;  3D98 A;  1ZCU A;  1ZJO A;  2WE9 A;  1FG5 N;  3K8D A;  4ASY A;  4LW6 A;  3T7O A;  5CMJ A;  3V8Z A;  4D11 C;  1LZI A;  5FTS A;  2XWM A;  1QGS A;  1ZI3 A;  1ZIZ A;  2FFU A;  1TW1 A;  1EYR A;  4LW3 A;  1EZI A;  1E5K A;  2O1G A;  1YP2 A;  5C3B A;  3ZLK A;  1VH1 A;  1ZJ3 A;  5CQL X;  1IIM A;  2UX8 A;  1FGG A;  3PKP A;  3V91 A;  5DDV A;  4B4B A;  3BRK X;  2VD4 A;  2RIT A;  2BO7 A;  2Q4J A;  1WT1 A;  4C2S A;  4KC2 A;  4Y9X A;  2ICX A;  1H7E A;  1GWW A;  1NHE B;  2V0J A;  2RIY A;  4HG6 A;  4D0Z A;  3I0C A;  3SX7 A;  4ASJ A;  1JYL A;  2MZB A;  3SX3 A;  1FXO A;  4Y7U A;  2A8U A;  5J49 A; 
#chains in the Genus database with same CATH topology
 2X5Z A;  2YC5 A;  3FOQ A;  4MIX A;  1O23 B;  1O0R A;  2X65 A;  2VK9 A;  3V0P A;  1G9R A;  5I1F A;  3V0Q A;  1H5R A;  2VS4 A;  3Q4S A;  1H5T B;  2W0W A;  2FYA A;  4KXO A;  1H7T A;  3QVB A;  5C1L A;  1R7V A;  1KWS A;  1MP4 A;  2I5K A;  4Y63 A;  2RJ1 A;  1FOA A;  4B4G A;  3N9W A;  2D7R A;  1LL2 A;  5CQP A;  1H5S B;  3Q80 A;  5AJO A;  3ZLL A;  1WT3 A;  3D5N A;  1HM0 A;  4KPZ A;  4Y7G A;  4AC3 A;  4EEM A;  5JQQ A;  2FY7 A;  2XME A;  4G3Q A;  2P6W A;  3I0J A;  1NQI B;  4NAI A;  5C3A A;  4B5B A;  2RJ7 A;  4B42 A;  3SX8 A;  5FUH A;  1VGT A;  1VGU A;  1H7F A;  2Y4K A;  4CVH A;  3V8Y A;  3Q7U A;  2VSH A;  2ZU7 A;  2AM4 A;  2FYB A;  1VPA A;  1G1L A;  2RJ4 A;  4FQW A;  4CJ8 A;  2JCL A;  4HO8 A;  5EJZ A;  4FRM A;  1R7U A;  1VGZ A;  1LZJ A;  2RIX A;  2AM5 A;  4FRQ A;  1ZDF A;  3I0F A;  4Y6U A;  1FO8 A;  4M4K A;  2OEF A;  1JV1 A;  1ON8 A;  4XWI A;  2ZU9 A;  4FRB A;  1IIN A;  4M2B A;  4FRP A;  5FV9 A;  3CU0 A;  1V83 A;  1W55 A;  3DJ4 A;  1O7O A;  1H5S C;  4FCE A;  1ZCT A;  1H3M A;  1FWY A;  2JCK A;  2Y7A A;  1S4N A;  3GUE A;  2OEG A;  1FRW A;  1QWJ A;  4HO6 A;  1ZJ1 A;  5C48 A;  1ZHJ A;  2AE7 A;  3ST8 A;  4BMA A;  1G97 A;  3OKR A;  1FXJ A;  2P72 A;  4D48 A;  4EE5 A;  2PX7 A;  3OH1 A;  4G3P A;  4Y7F A;  1Z90 A;  5FTV A;  3SXG A;  3U2T A;  3I0K A;  3V0O A;  4YS8 A;  1VIC A;  3RMW A;  2YQH A;  1H5R B;  4Y7V A;  3SX5 A;  1HM9 A;  4Q7C A;  4HOC A;  1WT0 A;  1GA8 A;  2RIZ A;  1INI A;  2WVM A;  2X60 A;  2X5S A;  4FIY A;  1FO9 A;  2V0K A;  2WVK A;  5L6V A;  3SXB A;  1INJ A;  3F1C A;  2AEC A;  4EVW A;  3FWW A;  4HO3 A;  3JUJ A;  4KC1 A;  1S4O A;  1H7G A;  2AGD A;  1MP3 A;  2JCO A;  1ZJP A;  4G87 A;  4E1K A;  1PZY B;  4J18 A;  5IDS A;  1VM8 A;  2NXV A;  2BO8 A;  3PKQ A;  2Z86 A;  3R2W A;  4O6N A;  2WVL A;  3SPT A;  1H5S D;  2Y6P A;  4HO2 A;  4ECM A;  1NF5 B;  5C47 A;  1OQM B;  3SXE A;  3I0G A;  4DE7 A;  2PGV A;  3RSB A;  4ZDQ A;  1G23 A;  2V0I A;  2Y4J A;  1LVW A;  3T7N A;  3V0L A;  3TZT A;  4HO5 A;  1JV3 A;  5HS2 A;  3IOI A;  1WT2 A;  3DK5 A;  4NAL A;  2V0H A;  1FGX A;  1VZU A;  1OMZ A;  2YQJ A;  5D91 A;  1K4V A;  1I52 A;  5FU0 A;  3OC9 A;  4Y64 A;  5EIY A;  1H4E A;  1QGQ A;  3JUK A;  3U0Y A;  1HJL A;  1H7Q A;  1GX0 A;  3CKV A;  4D0T A;  4AYL A;  3I0E A;  4FRL A;  5CQN X;  2Y4M A;  4M28 A;  4KT7 A;  4B2X A;  4FRH A;  1SS9 A;  1LL0 A;  3EE5 A;  1NMM B;  4KPX A;  1JVG A;  5IFY A;  2QKX A;  2AES A;  1NKH B;  4EEA A;  3PNN A;  3I0H A;  4DEC A;  1V82 A;  4FRE A;  1XZ6 A;  3SXC A;  3E26 A;  1H5T A;  1FZW A;  4JD0 A;  4P02 A;  2BO4 A;  1R81 A;  1OMX A;  4NAK A;  2O1H A;  3IOJ A;  4FRD A;  3USQ A;  4NAN A;  3NGW A;  5C4B A;  5FYE A;  3OH3 A;  1ON6 A;  2W0V A;  2QGI A;  2YQS A;  4Y7T A;  4HO0 A;  3I0D A;  2YES A;  2JCJ A;  5CQO A;  5C4E A;  3CKQ A;  2VXL A;  1TZF A;  5L6S A;  1HM8 A;  2XMH A;  3I0I X;  2WAW A;  1W77 A;  1H7L A;  1R7X A;  2YQC A;  3F1Y A;  2WGZ A;  3CKN A;  2AM3 A;  3I0L A;  5C1G A;  1ZJ2 A;  4B3U A;  3TQD A;  2RJ6 A;  4L41 C;  1YP3 A;  4Y6N A;  5D92 A;  1ZI4 A;  1HJJ A;  4KQL A;  2FYC B;  2ICY A;  3OGZ A;  3O3P A;  4GBP A;  1G0R A;  3U2V A;  5BXC A;  5FU8 A;  4HCQ A;  1G3L A;  1JYK A;  3LW6 A;  1ZCY A;  2DPW A;  3V90 A;  3OH0 A;  4KC4 A;  5CMH A;  1WSZ A;  2J0B A;  1ZJ0 A;  3CGX A;  4HO4 A;  4IRQ A;  2FYD B;  2APC A;  3CKJ A;  1HV9 A;  1PZT A;  1XHB A;  2I7B A;  1W57 A;  2P73 A;  2YCM A;  5CQM X;  5C1H A;  3D8V A;  4HO9 A;  4MYB A;  2GGQ A;  3JTJ A;  3POL A;  1TW5 A;  1R80 A;  1H7H A;  4EEO A;  2E8B A;  5C4F A;  1FR8 A;  1NWG B;  2OI7 A;  1VZT A;  2CU2 A;  1LZ0 A;  5DDT A;  5CMG X;  1G93 A;  2RJ0 A;  2ZU8 A;  5C4C A;  5C3D A;  4FRA A;  2OI5 A;  4IRP A;  2Z87 A;  1ZI1 A;  4FCU A;  4FRO A;  1LL3 A;  2A8W A;  1R7T A;  1GQC A;  3ZF8 A;  2V0L A;  1YP4 A;  4EE3 A;  5C8R A;  1GX4 A;  3U0X A;  1V84 A;  3U2W A;  5C38 A;  4KRV A;  1MP5 A;  3OAM A;  1ZCV A;  1G8O A;  1VH3 A;  2AH9 A;  3ZGF A;  3OH4 A;  4JIS A;  1QG8 A;  1GWV A;  4ARW A;  3HL3 A;  5EJ1 A;  1VGW A;  2OI6 A;  2VS5 A;  1G2V A;  5C36 A;  4G3S A;  2BO6 A;  1WVC A;  2D0J A;  2YC3 A;  3V0N A;  1JVD A;  4AYJ A;  1G95 A;  5AJN A;  4AAW A;  2O1F A;  2E3D A;  1S4P A;  3V0M A;  2PGY A;  3IOH A;  3RMV A;  1H4C A;  1H4D A;  2D7I A;  3SXA A;  4B2W A;  1VZX A;  5CMI A;  4DDZ A;  3U2X A;  2QH5 A;  4UEG A;  4K6R A;  4R7P A;  3ZGG A;  1ZDG A;  1R82 A;  2VSI A;  1ZI5 A;  4KNX A;  2WEE A;  3R3I A;  4Y62 A;  4CJC A;  3U2U A;  3K8E A;  2RJ9 A;  4CJB A;  2J0A A;  3BCV A;  5CMF X;  1GQ9 A;  1H5S A;  2VFZ A;  4P00 A;  2RJ8 A;  5C4D A;  1LZ7 A;  2I5E A;  1YRO B;  3USR A;  4EE4 A;  4M2A A;  4EEG A;  4D11 A;  2GGO A;  2RJ5 A;  4MND A;  3T7M A;  2PA4 A;  3CKO A;  1R7Y A;  5IDT A;  4KNR A;  2C0N A;  1TVY A;  5AJP A;  2VXM A;  5C49 A;  3SXD A;  3KIA A;  3E25 A;  4B4M A;  3OH2 A;  4O6M A;  3DUV A;  1MC3 A;  2Y4L A;  1FR9 A;  2XWN A;  4BQH A;  2VS3 A;  2FFV A;  1O7Q A;  2XWL A;  3D98 A;  1ZCU A;  1ZJO A;  2WE9 A;  1FG5 N;  3K8D A;  4ASY A;  4LW6 A;  3T7O A;  5CMJ A;  3V8Z A;  4D11 C;  1LZI A;  5FTS A;  2XWM A;  1QGS A;  1ZI3 A;  1ZIZ A;  2FFU A;  1TW1 A;  1EYR A;  4LW3 A;  1EZI A;  1E5K A;  2O1G A;  1YP2 A;  5C3B A;  3ZLK A;  1VH1 A;  1ZJ3 A;  5CQL X;  1IIM A;  2UX8 A;  1FGG A;  3PKP A;  3V91 A;  5DDV A;  4B4B A;  3BRK X;  2VD4 A;  2RIT A;  2BO7 A;  2Q4J A;  1WT1 A;  4C2S A;  4KC2 A;  4Y9X A;  2ICX A;  1H7E A;  1GWW A;  1NHE B;  2V0J A;  2RIY A;  4FIX A;  4HG6 A;  4D0Z A;  3I0C A;  3SX7 A;  4ASJ A;  1JYL A;  2MZB A;  3SX3 A;  1FXO A;  4Y7U A;  2A8U A;  5J49 A; 
#chains in the Genus database with same CATH homology
 2X5Z A;  2YC5 A;  3FOQ A;  4MIX A;  1O23 B;  1O0R A;  2X65 A;  2VK9 A;  3V0P A;  1G9R A;  5I1F A;  3V0Q A;  1H5R A;  2VS4 A;  3Q4S A;  1H5T B;  2W0W A;  2FYA A;  4KXO A;  1H7T A;  3QVB A;  5C1L A;  1R7V A;  1KWS A;  1MP4 A;  2I5K A;  4Y63 A;  2RJ1 A;  1FOA A;  4B4G A;  3N9W A;  2D7R A;  1LL2 A;  5CQP A;  1H5S B;  3Q80 A;  5AJO A;  3ZLL A;  1WT3 A;  3D5N A;  1HM0 A;  4KPZ A;  4Y7G A;  4AC3 A;  4EEM A;  5JQQ A;  2FY7 A;  2XME A;  4G3Q A;  2P6W A;  3I0J A;  1NQI B;  4NAI A;  5C3A A;  4B5B A;  2RJ7 A;  4B42 A;  3SX8 A;  5FUH A;  1VGT A;  1VGU A;  1H7F A;  2Y4K A;  4CVH A;  3V8Y A;  3Q7U A;  2VSH A;  2ZU7 A;  2AM4 A;  2FYB A;  1VPA A;  1G1L A;  2RJ4 A;  4FQW A;  4CJ8 A;  2JCL A;  4HO8 A;  5EJZ A;  4FRM A;  1R7U A;  1VGZ A;  1LZJ A;  2RIX A;  2AM5 A;  4FRQ A;  1ZDF A;  3I0F A;  4Y6U A;  1FO8 A;  4M4K A;  2OEF A;  1JV1 A;  1ON8 A;  4XWI A;  2ZU9 A;  4FRB A;  1IIN A;  4M2B A;  4FRP A;  5FV9 A;  3CU0 A;  1V83 A;  1W55 A;  3DJ4 A;  1O7O A;  1H5S C;  4FCE A;  1ZCT A;  1H3M A;  1FWY A;  2JCK A;  2Y7A A;  1S4N A;  3GUE A;  2OEG A;  1FRW A;  1QWJ A;  4HO6 A;  1ZJ1 A;  5C48 A;  1ZHJ A;  2AE7 A;  3ST8 A;  4BMA A;  1G97 A;  3OKR A;  1FXJ A;  2P72 A;  4D48 A;  4EE5 A;  2PX7 A;  3OH1 A;  4G3P A;  4Y7F A;  1Z90 A;  5FTV A;  3SXG A;  3U2T A;  3I0K A;  3V0O A;  4YS8 A;  1VIC A;  3RMW A;  2YQH A;  1H5R B;  4Y7V A;  3SX5 A;  1HM9 A;  4Q7C A;  4HOC A;  1WT0 A;  1GA8 A;  2RIZ A;  1INI A;  2WVM A;  2X60 A;  2X5S A;  4FIY A;  1FO9 A;  2V0K A;  2WVK A;  5L6V A;  3SXB A;  1INJ A;  3F1C A;  2AEC A;  4EVW A;  3FWW A;  4HO3 A;  3JUJ A;  4KC1 A;  1S4O A;  1H7G A;  2AGD A;  1MP3 A;  2JCO A;  1ZJP A;  4G87 A;  4E1K A;  1PZY B;  4J18 A;  5IDS A;  1VM8 A;  2NXV A;  2BO8 A;  3PKQ A;  2Z86 A;  3R2W A;  4O6N A;  2WVL A;  3SPT A;  1H5S D;  2Y6P A;  4HO2 A;  4ECM A;  1NF5 B;  5C47 A;  1OQM B;  3SXE A;  3I0G A;  4DE7 A;  2PGV A;  3RSB A;  4ZDQ A;  1G23 A;  2V0I A;  2Y4J A;  1LVW A;  3T7N A;  3V0L A;  3TZT A;  4HO5 A;  1JV3 A;  5HS2 A;  3IOI A;  1WT2 A;  3DK5 A;  4NAL A;  2V0H A;  1FGX A;  1VZU A;  1OMZ A;  2YQJ A;  5D91 A;  1K4V A;  1I52 A;  5FU0 A;  3OC9 A;  4Y64 A;  5EIY A;  1H4E A;  1QGQ A;  3JUK A;  3U0Y A;  1HJL A;  1H7Q A;  1GX0 A;  3CKV A;  4D0T A;  4AYL A;  3I0E A;  4FRL A;  5CQN X;  2Y4M A;  4M28 A;  4KT7 A;  4B2X A;  4FRH A;  1SS9 A;  1LL0 A;  3EE5 A;  1NMM B;  4KPX A;  1JVG A;  5IFY A;  2QKX A;  2AES A;  1NKH B;  4EEA A;  3PNN A;  3I0H A;  4DEC A;  1V82 A;  4FRE A;  1XZ6 A;  3SXC A;  3E26 A;  1H5T A;  1FZW A;  4JD0 A;  4P02 A;  2BO4 A;  1R81 A;  1OMX A;  4NAK A;  2O1H A;  3IOJ A;  4FRD A;  3USQ A;  4NAN A;  3NGW A;  5C4B A;  5FYE A;  3OH3 A;  1ON6 A;  2W0V A;  2QGI A;  2YQS A;  4Y7T A;  4HO0 A;  3I0D A;  2YES A;  2JCJ A;  5CQO A;  5C4E A;  3CKQ A;  2VXL A;  1TZF A;  5L6S A;  1HM8 A;  2XMH A;  3I0I X;  2WAW A;  1W77 A;  1H7L A;  1R7X A;  2YQC A;  3F1Y A;  2WGZ A;  3CKN A;  2AM3 A;  3I0L A;  5C1G A;  1ZJ2 A;  4B3U A;  3TQD A;  2RJ6 A;  4L41 C;  1YP3 A;  4Y6N A;  5D92 A;  1ZI4 A;  1HJJ A;  4KQL A;  2FYC B;  2ICY A;  3OGZ A;  3O3P A;  4GBP A;  1G0R A;  3U2V A;  5BXC A;  5FU8 A;  4HCQ A;  1G3L A;  1JYK A;  3LW6 A;  1ZCY A;  2DPW A;  3V90 A;  3OH0 A;  4KC4 A;  5CMH A;  1WSZ A;  2J0B A;  1ZJ0 A;  3CGX A;  4HO4 A;  4IRQ A;  2FYD B;  2APC A;  3CKJ A;  1HV9 A;  1PZT A;  1XHB A;  2I7B A;  1W57 A;  2P73 A;  2YCM A;  5CQM X;  5C1H A;  3D8V A;  4HO9 A;  4MYB A;  2GGQ A;  3JTJ A;  3POL A;  1TW5 A;  1R80 A;  1H7H A;  4EEO A;  2E8B A;  5C4F A;  1FR8 A;  1NWG B;  2OI7 A;  1VZT A;  2CU2 A;  1LZ0 A;  5DDT A;  5CMG X;  1G93 A;  2RJ0 A;  2ZU8 A;  5C4C A;  5C3D A;  4FRA A;  2OI5 A;  4IRP A;  2Z87 A;  1ZI1 A;  4FCU A;  4FRO A;  1LL3 A;  2A8W A;  1R7T A;  1GQC A;  3ZF8 A;  2V0L A;  1YP4 A;  4EE3 A;  5C8R A;  1GX4 A;  3U0X A;  1V84 A;  3U2W A;  5C38 A;  4KRV A;  1MP5 A;  3OAM A;  1ZCV A;  1G8O A;  1VH3 A;  2AH9 A;  3ZGF A;  3OH4 A;  4JIS A;  1QG8 A;  1GWV A;  4ARW A;  3HL3 A;  5EJ1 A;  1VGW A;  2OI6 A;  2VS5 A;  1G2V A;  5C36 A;  4G3S A;  2BO6 A;  1WVC A;  2D0J A;  2YC3 A;  3V0N A;  1JVD A;  4AYJ A;  1G95 A;  5AJN A;  4AAW A;  2O1F A;  2E3D A;  1S4P A;  3V0M A;  2PGY A;  3IOH A;  3RMV A;  1H4C A;  1H4D A;  2D7I A;  3SXA A;  4B2W A;  1VZX A;  5CMI A;  4DDZ A;  3U2X A;  2QH5 A;  4UEG A;  4K6R A;  4R7P A;  3ZGG A;  1ZDG A;  1R82 A;  2VSI A;  1ZI5 A;  4KNX A;  2WEE A;  3R3I A;  4Y62 A;  4CJC A;  3U2U A;  3K8E A;  2RJ9 A;  4CJB A;  2J0A A;  3BCV A;  5CMF X;  1GQ9 A;  1H5S A;  2VFZ A;  4P00 A;  2RJ8 A;  5C4D A;  1LZ7 A;  2I5E A;  1YRO B;  3USR A;  4EE4 A;  4M2A A;  4EEG A;  4D11 A;  2GGO A;  2RJ5 A;  4MND A;  3T7M A;  2PA4 A;  3CKO A;  1R7Y A;  5IDT A;  4KNR A;  2C0N A;  1TVY A;  5AJP A;  2VXM A;  5C49 A;  3SXD A;  3KIA A;  3E25 A;  4B4M A;  3OH2 A;  4O6M A;  3DUV A;  1MC3 A;  2Y4L A;  1FR9 A;  2XWN A;  4BQH A;  2VS3 A;  2FFV A;  1O7Q A;  2XWL A;  3D98 A;  1ZCU A;  1ZJO A;  2WE9 A;  1FG5 N;  3K8D A;  4ASY A;  4LW6 A;  3T7O A;  5CMJ A;  3V8Z A;  4D11 C;  1LZI A;  5FTS A;  2XWM A;  1QGS A;  1ZI3 A;  1ZIZ A;  2FFU A;  1TW1 A;  1EYR A;  4LW3 A;  1EZI A;  1E5K A;  2O1G A;  1YP2 A;  5C3B A;  3ZLK A;  1VH1 A;  1ZJ3 A;  5CQL X;  1IIM A;  2UX8 A;  1FGG A;  3PKP A;  3V91 A;  5DDV A;  4B4B A;  3BRK X;  2VD4 A;  2RIT A;  2BO7 A;  2Q4J A;  1WT1 A;  4C2S A;  4KC2 A;  4Y9X A;  2ICX A;  1H7E A;  1GWW A;  1NHE B;  2V0J A;  2RIY A;  4FIX A;  4HG6 A;  4D0Z A;  3I0C A;  3SX7 A;  4ASJ A;  1JYL A;  2MZB A;  3SX3 A;  1FXO A;  4Y7U A;  2A8U A;  5J49 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...