4ZDQA

Crystal structure of 2-c-methyl-d-erythritol 4-phosphate cytidylyltransferase (ispd) from burkholderia thailandensis complexed with ctp
Total Genus 70
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
70
sequence length
230
structure length
230
Chain Sequence
TSRLFALIPCAGTGSRSGSALPKQYRTLAGRALLHYTLAAFDACSEFAQTLVVISPDDAHFDARRFAGLRFAVRRCGGASRQASVMNGLIQLAEFGATDADWVLVHDAARPGITPALIRTLIGALKDDPVGGIVALPVADTLKRVPAGGDAIERTESRNGLWQAQTPQMFRIGMLRDAIQRAQLEGRDLTDEASAIEWAGHTPRVVQGSLRNFKVTYPEDFDLAEAILAH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords 2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase
publication title Crystal Structure of 2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase (IspD) from Burkholderia thailandensis complexed with CTP
rcsb
source organism Burkholderia thailandensis
total genus 70
structure length 230
sequence length 230
chains with identical sequence B, C, D
ec nomenclature ec 2.7.7.60: 2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase.
pdb deposition date 2015-04-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01128 IspD 2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.550.10 Alpha Beta Alpha-Beta Complex Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A 4zdqA00
4FRDA 1H7TA 3USRA 2WAWA 3GUEA 1O7QA 4KC2A 1R82A 5JQQA 2FYCB 3N9WA 3CKNA 1VGWA 1JV3A 2AM4A 1FGXA 3D5NA 1H5SA 4B3UA 1NMMB 2Y4LA 2RJ6A 3SPTA 2A8UA 2RIZA 3OH1A 4Y7UA 4Y7FA 2YQHA 4XWIA 1JVGA 2ZU8A 2X65A 1IIMA 3O3PA 3Q80A 1W55A 1GX0A 3OH3A 4E1KA 1YROB 4ECMA 2RJ5A 3I0CA 4JISA 2P73A 3EE5A 1O7OA 2OEFA 2YESA 3IOHA 4KC4A 2O1HA 1ZJ1A 3V8ZA 2NXVA 5C4DA 1JYLA 1FOAA 1G9RA 4EEMA 2JCJA 3I0GA 1NF5B 3T7MA 1ZJ3A 1GQ9A 1H5SC 2X5SA 4ASYA 1XHBA 2ICXA 4FRHA 1FR9A 2JCLA 3V91A 3BRKX 3V8YA 5FU0A 2DPWA 2Y4MA 3DUVA 4AYLA 4IRQA 1G97A 2QH5A 4G87A 4M2AA 2OI7A 2WEEA 5C49A 2VXLA 1H5SB 2GGOA 4KXOA 4L41C 4D48A 4G3PA 5CMIA 4JD0A 2WGZA 2APCA 2I7BA 1H7FA 4KT7A 1VICA 4FRBA 1ZI3A 4Y6NA 3SXCA 1VM8A 2W0WA 1FO9A 1FRWA 2RJ0A 1MP5A 5CMFX 1R81A 1WT0A 4B5BA 2E3DA 4NANA 5C4EA 2RJ7A 4K6RA 5CQNX 3V0QA 1H5SD 5FUHA 4KPXA 2Y6PA 5C48A 5IFYA 3U2XA 5C3BA 1NWGB 4KC1A 1NKHB 2OEGA 4BMAA 1GX4A 3CGXA 4FCUA 5C38A 3I0EA 1EZIA 3OH4A 3CU0A 4ZDQA 3JUJA 4Y7VA 3DJ4A 1ON6A 1G95A 1K4VA 4FRMA 3OGZA 3T7OA 2XWLA 4B4GA 5C8RA 2O1FA 4DE7A 3SXBA 2VXMA 2PGYA 4HO5A 3HL3A 4UEGA 1FGGA 1G2VA 4P02A 1FZWA 1ZIZA 3V0NA 2W0VA 1R7XA 5HS2A 3NGWA 2AM3A 2WVKA 5IDSA 4LW3A 1S4OA 3CKOA 1ZHJA 1ZCUA 4KNXA 5CQOA 4KQLA 1VGTA 2Z87A 3PKQA 5C4FA 5FV9A 3R2WA 3SX8A 5C3DA 1FXOA 1TW5A 1NHEB 2WVLA 2D7IA 4EEAA 2BO4A 2X60A 2BO6A 3D8VA 4M28A 5CMGX 3F1CA 3ZF8A 3SXGA 4D0ZA 4HO6A 4Y64A 1G23A 2VSHA 1LL3A 1YP3A 1YP2A 2FY7A 1OMZA 3E25A 1VH1A 4EE3A 2VS4A 1S4NA 1VZTA 5DDTA 3I0FA 1HV9A 1MP3A 4IRPA 4FCEA 2FYDB 1O0RA 3SXEA 1G8OA 3PNNA 2VS5A 1GWVA 1H3MA 4ARWA 1H5TB 1WT1A 1H7LA 3FWWA 1R80A 4LW6A 1ZI4A 3I0DA 1QGQA 4CJBA 5CQMX 4KRVA 4B2WA 1O23B 4Y9XA 3OKRA 1LZIA 3ZLLA 5FTSA 4NAIA 1VZXA 1S4PA 1ZJPA 2WE9A 1V82A 1VGZA 2AH9A 3I0IX 4FRLA 1GWWA 1H7GA 3JTJA 1OMXA 5C4BA 2BO8A 4HO4A 3ZGGA 4FRPA 4DECA 1G1LA 1G3LA 2RJ9A 2D0JA 1QG8A 2E8BA 1JV1A 3R3IA 1G93A 2X5ZA 1ZDFA 2JCKA 4GBPA 4EE4A 3D98A 2FYAA 5CMJA 4B2XA 3OH2A 5J49A 4B4BA 4CJCA 1LZ7A 5AJOA 5AJPA 3RMWA 1H7EA 2ZU9A 1FXJA 3U2WA 1ZCVA 4FRQA 5C47A 2OI5A 3ZGFA 3POLA 3I0KA 1ON8A 3Q4SA 3U0XA 1QWJA 2V0KA 5C36A 3SX7A 3V0LA 1W77A 1R7VA 4FRAA 2FFUA 3V0MA 2YC3A 4HO2A 1H5TA 4HO8A 3U2VA 1INJA 3U0YA 1H4EA 2RIXA 1ZI5A 1HM9A 1HJJA 1LZJA 5FTVA 5C1GA 2FFVA 3LW6A 2Q4JA 1ZI1A 4M2BA 1VGUA 1NQIB 4BQHA 2XMEA 1R7TA 5EIYA 3F1YA 2ZU7A 2FYBA 1Z90A 4G3SA 5L6SA 1H4DA 4KPZA 5FYEA 2V0LA 3SX3A 2UX8A 5L6VA 1FO8A 1ZJ2A 1OQMB 2RIYA 2V0HA 4Y7TA 3USQA 3U2TA 2QGIA 1TW1A 1FR8A 2JCOA 2GGQA 3BCVA 1H7QA 3QVBA 3V0PA 2A8WA 1PZYB 3DK5A 3TQDA 1JYKA 1FG5N 4ASJA 2QKXA 2V0JA 4AAWA 1LL2A 2O1GA 4P00A 1ZCTA 3I0HA 2AESA 4D0TA 5CQPA 3TZTA 3CKVA 3IOJA 5C1HA 2YQCA 1WSZA 2P72A 1G0RA 2Z86A 2AECA 2PGVA 2Y4KA 2Y4JA 3ZLKA 2RJ8A 4Y6UA 5CMHA 2I5KA 3SXDA 3V0OA 3FOQA 1EYRA 1WT3A 2V0IA 1R7YA 1VZUA 2XMHA 1HM0A 3KIAA 1V83A 1LVWA 4B42A 3CKJA 3OC9A 4D11A 1FWYA 2RITA 1KWSA 3K8EA 1E5KA 1ZJ0A 3Q7UA 1H5RB 5C4CA 3SX5A 2VFZA 4HG6A 2YQSA 4Y63A 4EVWA 2VD4A 5I1FA 4NALA 1TZFA 1YP4A 3PKPA 3T7NA 5EJ1A 5CQLX 1R7UA 4CVHA 5C1LA 1HM8A 1PZTA 2PX7A 4Y62A 3K8DA 1LZ0A 5BXCA 1HJLA 2MZBA 2AE7A 1GA8A 3OH0A 2AM5A 2XWNA 1ZDGA 4YS8A 3V90A 4B4MA 2AGDA 1SS9A 5EJZA 2YC5A 2PA4A 3CKQA 4AC3A 1V84A 3U2UA 1I52A 1W57A 1XZ6A 4DDZA 1QGSA 3RMVA 3ST8A 4C2SA 2D7RA 5IDTA 4D11C 4G3QA 1H4CA 4FROA 2CU2A 4J18A 4FQWA 1GQCA 1WVCA 4EEOA 3SXAA 4M4KA 1VPAA 4EEGA 3JUKA 5C3AA 1IINA 1LL0A 2WVMA 2ICYA 4FREA 4R7PA 2RJ4A 1ZCYA 1WT2A 4EE5A 2BO7A 4MYBA 1H5RA 3OAMA 3E26A 5DDVA 4HO9A 1MC3A 1H7HA 4MNDA 4Y7GA 4HOCA 3IOIA 4HCQA 2OI6A 4HO0A 3I0JA 3RSBA 2VSIA 2RJ1A 5AJNA 4KNRA 2I5EA 5FU8A 1ZJOA 1INIA 3I0LA 2P6WA 4AYJA 1MP4A 2VS3A 1TVYA 1VH3A 2YCMA 4HO3A 2YQJA 4CJ8A 2Y7AA 2XWMA 4NAKA 1JVDA
chains in the Genus database with same CATH superfamily
4FRDA 1H7TA 3USRA 2WAWA 3GUEA 1O7QA 4KC2A 1R82A 5JQQA 2FYCB 3N9WA 3CKNA 1VGWA 1JV3A 2AM4A 1FGXA 3D5NA 1H5SA 4B3UA 1NMMB 2Y4LA 2RJ6A 3SPTA 2A8UA 2RIZA 3OH1A 4Y7UA 4Y7FA 2YQHA 4XWIA 1JVGA 2ZU8A 2X65A 1IIMA 3O3PA 3Q80A 1W55A 1GX0A 3OH3A 4E1KA 1YROB 4ECMA 2RJ5A 3I0CA 4JISA 2P73A 3EE5A 1O7OA 2OEFA 2YESA 3IOHA 4KC4A 2O1HA 1ZJ1A 3V8ZA 2NXVA 5C4DA 1JYLA 1FOAA 1G9RA 4EEMA 2JCJA 3I0GA 1NF5B 3T7MA 1ZJ3A 1GQ9A 1H5SC 2X5SA 4ASYA 1XHBA 2ICXA 4FRHA 1FR9A 2JCLA 3V91A 3BRKX 3V8YA 5FU0A 2DPWA 2Y4MA 3DUVA 4AYLA 4IRQA 1G97A 2QH5A 4G87A 4M2AA 2OI7A 2WEEA 5C49A 2VXLA 1H5SB 2GGOA 4KXOA 4L41C 4D48A 4G3PA 5CMIA 4JD0A 2WGZA 2APCA 2I7BA 4FIXA 1H7FA 4KT7A 1VICA 4FRBA 1ZI3A 4Y6NA 3SXCA 1VM8A 2W0WA 1FO9A 1FRWA 2RJ0A 1MP5A 5CMFX 1R81A 1WT0A 4B5BA 2E3DA 4NANA 5C4EA 2RJ7A 4K6RA 5CQNX 3V0QA 1H5SD 5FUHA 4KPXA 2Y6PA 5C48A 5IFYA 3U2XA 5C3BA 1NWGB 4KC1A 1NKHB 2OEGA 4BMAA 1GX4A 3CGXA 4FCUA 5C38A 3I0EA 1EZIA 3OH4A 3CU0A 4ZDQA 3JUJA 4Y7VA 3DJ4A 1ON6A 1G95A 1K4VA 4FRMA 3OGZA 3T7OA 2XWLA 4B4GA 5C8RA 2O1FA 4DE7A 3SXBA 2VXMA 2PGYA 4HO5A 3HL3A 4UEGA 1FGGA 1G2VA 4O6NA 4P02A 1FZWA 1ZIZA 3V0NA 2W0VA 1R7XA 5HS2A 3NGWA 2AM3A 2WVKA 5IDSA 4LW3A 1S4OA 3CKOA 1ZHJA 1ZCUA 4KNXA 5CQOA 4KQLA 1VGTA 2Z87A 3PKQA 5C4FA 5FV9A 3R2WA 3SX8A 5C3DA 1FXOA 1TW5A 1NHEB 2WVLA 2D7IA 4EEAA 2BO4A 2X60A 2BO6A 3D8VA 4M28A 5CMGX 3F1CA 3ZF8A 3SXGA 4D0ZA 4HO6A 4Y64A 1G23A 2VSHA 1LL3A 1YP3A 1YP2A 2FY7A 1OMZA 3E25A 1VH1A 4EE3A 2VS4A 1S4NA 1VZTA 5DDTA 3I0FA 1HV9A 1MP3A 4IRPA 4FCEA 2FYDB 1O0RA 3SXEA 1G8OA 3PNNA 2VS5A 1GWVA 1H3MA 4ARWA 1H5TB 1WT1A 1H7LA 3FWWA 1R80A 4LW6A 1ZI4A 3I0DA 1QGQA 4CJBA 5CQMX 4KRVA 4B2WA 1O23B 4Y9XA 3OKRA 1LZIA 3ZLLA 5FTSA 4NAIA 1VZXA 1S4PA 1ZJPA 2WE9A 1V82A 1VGZA 2AH9A 3I0IX 4FRLA 1GWWA 1H7GA 3JTJA 1OMXA 5C4BA 2BO8A 4HO4A 3ZGGA 2VK9A 4FRPA 4DECA 1G1LA 1G3LA 2RJ9A 2D0JA 1QG8A 2E8BA 1JV1A 3R3IA 1G93A 2X5ZA 1ZDFA 4FIYA 2JCKA 4GBPA 4EE4A 3D98A 2FYAA 5CMJA 4B2XA 3OH2A 5J49A 4B4BA 4CJCA 1LZ7A 5AJOA 5AJPA 3RMWA 2J0BA 1H7EA 2ZU9A 1FXJA 3U2WA 1ZCVA 4FRQA 5C47A 2OI5A 3ZGFA 3POLA 3I0KA 1ON8A 3Q4SA 3U0XA 1QWJA 2V0KA 5C36A 3SX7A 3V0LA 1W77A 1R7VA 4FRAA 2FFUA 5D92A 3V0MA 2YC3A 4HO2A 1H5TA 4HO8A 3U2VA 1INJA 3U0YA 1H4EA 5D91A 2RIXA 1ZI5A 1HM9A 1HJJA 1LZJA 5FTVA 5C1GA 2FFVA 3LW6A 2Q4JA 1ZI1A 4M2BA 1VGUA 1NQIB 4BQHA 2XMEA 1R7TA 5EIYA 3F1YA 2ZU7A 2FYBA 1Z90A 4G3SA 5L6SA 1H4DA 4KPZA 5FYEA 2V0LA 3SX3A 2UX8A 5L6VA 1FO8A 1ZJ2A 1OQMB 2RIYA 2V0HA 4Y7TA 3USQA 3U2TA 2QGIA 1TW1A 1FR8A 2JCOA 2GGQA 3BCVA 1H7QA 3QVBA 3V0PA 2A8WA 1PZYB 3DK5A 3TQDA 1JYKA 2J0AA 1FG5N 4ASJA 2QKXA 2V0JA 4AAWA 1LL2A 2O1GA 4P00A 1ZCTA 3I0HA 2AESA 4D0TA 4Q7CA 5CQPA 3TZTA 3CKVA 3IOJA 5C1HA 2YQCA 1WSZA 2P72A 1G0RA 2Z86A 2AECA 2PGVA 2Y4KA 2Y4JA 3ZLKA 2RJ8A 4Y6UA 5CMHA 2I5KA 3SXDA 3V0OA 3FOQA 1EYRA 1WT3A 2V0IA 1R7YA 1VZUA 2XMHA 1HM0A 3KIAA 1V83A 1LVWA 2C0NA 4B42A 3CKJA 3OC9A 4D11A 1FWYA 2RITA 1KWSA 4MIXA 3K8EA 1E5KA 1ZJ0A 3Q7UA 1H5RB 5C4CA 3SX5A 2VFZA 4HG6A 2YQSA 4Y63A 4EVWA 2VD4A 5I1FA 4NALA 1TZFA 1YP4A 3PKPA 3T7NA 5EJ1A 5CQLX 1R7UA 4CVHA 5C1LA 1HM8A 1PZTA 2PX7A 4Y62A 3K8DA 1LZ0A 5BXCA 1HJLA 2MZBA 2AE7A 1GA8A 3OH0A 2AM5A 2XWNA 1ZDGA 4YS8A 3V90A 4B4MA 2AGDA 1SS9A 5EJZA 2YC5A 2PA4A 3CKQA 4AC3A 1V84A 3U2UA 1I52A 1W57A 1XZ6A 4DDZA 1QGSA 3RMVA 3ST8A 4C2SA 2D7RA 5IDTA 4D11C 4G3QA 1H4CA 4FROA 2CU2A 4J18A 4FQWA 1GQCA 1WVCA 4EEOA 3SXAA 4M4KA 1VPAA 4EEGA 3JUKA 5C3AA 1IINA 1LL0A 2WVMA 2ICYA 4FREA 4R7PA 2RJ4A 4O6MA 1ZCYA 1WT2A 4EE5A 2BO7A 4MYBA 1H5RA 3OAMA 3E26A 5DDVA 4HO9A 1MC3A 1H7HA 4MNDA 4Y7GA 4HOCA 3IOIA 4HCQA 2OI6A 4HO0A 3I0JA 3RSBA 2VSIA 2RJ1A 5AJNA 4KNRA 2I5EA 5FU8A 1ZJOA 1INIA 3I0LA 2P6WA 4AYJA 1MP4A 2VS3A 1TVYA 1VH3A 2YCMA 4HO3A 2YQJA 4CJ8A 2Y7AA 2XWMA 4NAKA 1JVDA
chains in the Genus database with same CATH topology
4FRDA 1H7TA 3USRA 2WAWA 3GUEA 1O7QA 4KC2A 1R82A 5JQQA 2FYCB 3N9WA 3CKNA 1VGWA 1JV3A 2AM4A 1FGXA 3D5NA 1H5SA 4B3UA 1NMMB 2Y4LA 2RJ6A 3SPTA 2A8UA 2RIZA 3OH1A 4Y7UA 4Y7FA 2YQHA 4XWIA 1JVGA 2ZU8A 2X65A 1IIMA 3O3PA 3Q80A 1W55A 1GX0A 3OH3A 4E1KA 1YROB 4ECMA 2RJ5A 3I0CA 4JISA 2P73A 3EE5A 1O7OA 2OEFA 2YESA 3IOHA 4KC4A 2O1HA 1ZJ1A 3V8ZA 2NXVA 5C4DA 1JYLA 1FOAA 1G9RA 4EEMA 2JCJA 3I0GA 1NF5B 3T7MA 1ZJ3A 1GQ9A 1H5SC 2X5SA 4ASYA 1XHBA 2ICXA 4FRHA 1FR9A 2JCLA 3V91A 3BRKX 3V8YA 5FU0A 2DPWA 2Y4MA 3DUVA 4AYLA 4IRQA 1G97A 2QH5A 4G87A 4M2AA 2OI7A 2WEEA 5C49A 2VXLA 1H5SB 2GGOA 4KXOA 4L41C 4D48A 4G3PA 5CMIA 4JD0A 2WGZA 2APCA 2I7BA 4FIXA 1H7FA 4KT7A 1VICA 4FRBA 1ZI3A 4Y6NA 3SXCA 1VM8A 2W0WA 1FO9A 1FRWA 2RJ0A 1MP5A 5CMFX 1R81A 1WT0A 4B5BA 2E3DA 4NANA 5C4EA 2RJ7A 4K6RA 5CQNX 3V0QA 1H5SD 5FUHA 4KPXA 2Y6PA 5C48A 5IFYA 3U2XA 5C3BA 1NWGB 4KC1A 1NKHB 2OEGA 4BMAA 1GX4A 3CGXA 4FCUA 5C38A 3I0EA 1EZIA 3OH4A 3CU0A 4ZDQA 3JUJA 4Y7VA 3DJ4A 1ON6A 1G95A 1K4VA 4FRMA 3OGZA 3T7OA 2XWLA 4B4GA 5C8RA 2O1FA 4DE7A 3SXBA 2VXMA 2PGYA 4HO5A 3HL3A 4UEGA 1FGGA 1G2VA 4O6NA 4P02A 1FZWA 1ZIZA 3V0NA 2W0VA 1R7XA 5HS2A 3NGWA 2AM3A 2WVKA 5IDSA 4LW3A 1S4OA 3CKOA 1ZHJA 1ZCUA 4KNXA 5CQOA 4KQLA 1VGTA 2Z87A 3PKQA 5C4FA 5FV9A 3R2WA 3SX8A 5C3DA 1FXOA 1TW5A 1NHEB 2WVLA 2D7IA 4EEAA 2BO4A 2X60A 2BO6A 3D8VA 4M28A 5CMGX 3F1CA 3ZF8A 3SXGA 4D0ZA 4HO6A 4Y64A 1G23A 2VSHA 1LL3A 1YP3A 1YP2A 2FY7A 1OMZA 3E25A 1VH1A 4EE3A 2VS4A 1S4NA 1VZTA 5DDTA 3I0FA 1HV9A 1MP3A 4IRPA 4FCEA 2FYDB 1O0RA 3SXEA 1G8OA 3PNNA 2VS5A 1GWVA 1H3MA 4ARWA 1H5TB 1WT1A 1H7LA 3FWWA 1R80A 4LW6A 1ZI4A 3I0DA 1QGQA 4CJBA 5CQMX 4KRVA 4B2WA 1O23B 4Y9XA 3OKRA 1LZIA 3ZLLA 5FTSA 4NAIA 1VZXA 1S4PA 1ZJPA 2WE9A 1V82A 1VGZA 2AH9A 3I0IX 4FRLA 1GWWA 1H7GA 3JTJA 1OMXA 5C4BA 2BO8A 4HO4A 3ZGGA 2VK9A 4FRPA 4DECA 1G1LA 1G3LA 2RJ9A 2D0JA 1QG8A 2E8BA 1JV1A 3R3IA 1G93A 2X5ZA 1ZDFA 4FIYA 2JCKA 4GBPA 4EE4A 3D98A 2FYAA 5CMJA 4B2XA 3OH2A 5J49A 4B4BA 4CJCA 1LZ7A 5AJOA 5AJPA 3RMWA 2J0BA 1H7EA 2ZU9A 1FXJA 3U2WA 1ZCVA 4FRQA 5C47A 2OI5A 3ZGFA 3POLA 3I0KA 1ON8A 3Q4SA 3U0XA 1QWJA 2V0KA 5C36A 3SX7A 3V0LA 1W77A 1R7VA 4FRAA 2FFUA 5D92A 3V0MA 2YC3A 4HO2A 1H5TA 4HO8A 3U2VA 1INJA 3U0YA 1H4EA 5D91A 2RIXA 1ZI5A 1HM9A 1HJJA 1LZJA 5FTVA 5C1GA 2FFVA 3LW6A 2Q4JA 1ZI1A 4M2BA 1VGUA 1NQIB 4BQHA 2XMEA 1R7TA 5EIYA 3F1YA 2ZU7A 2FYBA 1Z90A 4G3SA 5L6SA 1H4DA 4KPZA 5FYEA 2V0LA 3SX3A 2UX8A 5L6VA 1FO8A 1ZJ2A 1OQMB 2RIYA 2V0HA 4Y7TA 3USQA 3U2TA 2QGIA 1TW1A 1FR8A 2JCOA 2GGQA 3BCVA 1H7QA 3QVBA 3V0PA 2A8WA 1PZYB 3DK5A 3TQDA 1JYKA 2J0AA 1FG5N 4ASJA 2QKXA 2V0JA 4AAWA 1LL2A 2O1GA 4P00A 1ZCTA 3I0HA 2AESA 4D0TA 4Q7CA 5CQPA 3TZTA 3CKVA 3IOJA 5C1HA 2YQCA 1WSZA 2P72A 1G0RA 2Z86A 2AECA 2PGVA 2Y4KA 2Y4JA 3ZLKA 2RJ8A 4Y6UA 5CMHA 2I5KA 3SXDA 3V0OA 3FOQA 1EYRA 1WT3A 2V0IA 1R7YA 1VZUA 2XMHA 1HM0A 3KIAA 1V83A 1LVWA 2C0NA 4B42A 3CKJA 3OC9A 4D11A 1FWYA 2RITA 1KWSA 4MIXA 3K8EA 1E5KA 1ZJ0A 3Q7UA 1H5RB 5C4CA 3SX5A 2VFZA 4HG6A 2YQSA 4Y63A 4EVWA 2VD4A 5I1FA 4NALA 1TZFA 1YP4A 3PKPA 3T7NA 5EJ1A 5CQLX 1R7UA 4CVHA 5C1LA 1HM8A 1PZTA 2PX7A 4Y62A 3K8DA 1LZ0A 5BXCA 1HJLA 2MZBA 2AE7A 1GA8A 3OH0A 2AM5A 2XWNA 1ZDGA 4YS8A 3V90A 4B4MA 2AGDA 1SS9A 5EJZA 2YC5A 2PA4A 3CKQA 4AC3A 1V84A 3U2UA 1I52A 1W57A 1XZ6A 4DDZA 1QGSA 3RMVA 3ST8A 4C2SA 2D7RA 5IDTA 4D11C 4G3QA 1H4CA 4FROA 2CU2A 4J18A 4FQWA 1GQCA 1WVCA 4EEOA 3SXAA 4M4KA 1VPAA 4EEGA 3JUKA 5C3AA 1IINA 1LL0A 2WVMA 2ICYA 4FREA 4R7PA 2RJ4A 4O6MA 1ZCYA 1WT2A 4EE5A 2BO7A 4MYBA 1H5RA 3OAMA 3E26A 5DDVA 4HO9A 1MC3A 1H7HA 4MNDA 4Y7GA 4HOCA 3IOIA 4HCQA 2OI6A 4HO0A 3I0JA 3RSBA 2VSIA 2RJ1A 5AJNA 4KNRA 2I5EA 5FU8A 1ZJOA 1INIA 3I0LA 2P6WA 4AYJA 1MP4A 2VS3A 1TVYA 1VH3A 2YCMA 4HO3A 2YQJA 4CJ8A 2Y7AA 2XWMA 4NAKA 1JVDA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4FRD A;  1H7T A;  3USR A;  2WAW A;  3GUE A;  1O7Q A;  4KC2 A;  1R82 A;  5JQQ A;  2FYC B;  3N9W A;  3CKN A;  1VGW A;  1JV3 A;  2AM4 A;  1FGX A;  3D5N A;  1H5S A;  4B3U A;  1NMM B;  2Y4L A;  2RJ6 A;  3SPT A;  2A8U A;  2RIZ A;  3OH1 A;  4Y7U A;  4Y7F A;  2YQH A;  4XWI A;  1JVG A;  2ZU8 A;  2X65 A;  1IIM A;  3O3P A;  3Q80 A;  1W55 A;  1GX0 A;  3OH3 A;  4E1K A;  1YRO B;  4ECM A;  2RJ5 A;  3I0C A;  4JIS A;  2P73 A;  3EE5 A;  1O7O A;  2OEF A;  2YES A;  3IOH A;  4KC4 A;  2O1H A;  1ZJ1 A;  3V8Z A;  2NXV A;  5C4D A;  1JYL A;  1FOA A;  1G9R A;  4EEM A;  2JCJ A;  3I0G A;  1NF5 B;  3T7M A;  1ZJ3 A;  1GQ9 A;  1H5S C;  2X5S A;  4ASY A;  1XHB A;  2ICX A;  4FRH A;  1FR9 A;  2JCL A;  3V91 A;  3BRK X;  3V8Y A;  5FU0 A;  2DPW A;  2Y4M A;  3DUV A;  4AYL A;  4IRQ A;  1G97 A;  2QH5 A;  4G87 A;  4M2A A;  2OI7 A;  2WEE A;  5C49 A;  2VXL A;  1H5S B;  2GGO A;  4KXO A;  4L41 C;  4D48 A;  4G3P A;  5CMI A;  4JD0 A;  2WGZ A;  2APC A;  2I7B A;  1H7F A;  4KT7 A;  1VIC A;  4FRB A;  1ZI3 A;  4Y6N A;  3SXC A;  1VM8 A;  2W0W A;  1FO9 A;  1FRW A;  2RJ0 A;  1MP5 A;  5CMF X;  1R81 A;  1WT0 A;  4B5B A;  2E3D A;  4NAN A;  5C4E A;  2RJ7 A;  4K6R A;  5CQN X;  3V0Q A;  1H5S D;  5FUH A;  4KPX A;  2Y6P A;  5C48 A;  5IFY A;  3U2X A;  5C3B A;  1NWG B;  4KC1 A;  1NKH B;  2OEG A;  4BMA A;  1GX4 A;  3CGX A;  4FCU A;  5C38 A;  3I0E A;  1EZI A;  3OH4 A;  3CU0 A;  4ZDQ A;  3JUJ A;  4Y7V A;  3DJ4 A;  1ON6 A;  1G95 A;  1K4V A;  4FRM A;  3OGZ A;  3T7O A;  2XWL A;  4B4G A;  5C8R A;  2O1F A;  4DE7 A;  3SXB A;  2VXM A;  2PGY A;  4HO5 A;  3HL3 A;  4UEG A;  1FGG A;  1G2V A;  4P02 A;  1FZW A;  1ZIZ A;  3V0N A;  2W0V A;  1R7X A;  5HS2 A;  3NGW A;  2AM3 A;  2WVK A;  5IDS A;  4LW3 A;  1S4O A;  3CKO A;  1ZHJ A;  1ZCU A;  4KNX A;  5CQO A;  4KQL A;  1VGT A;  2Z87 A;  3PKQ A;  5C4F A;  5FV9 A;  3R2W A;  3SX8 A;  5C3D A;  1FXO A;  1TW5 A;  1NHE B;  2WVL A;  2D7I A;  4EEA A;  2BO4 A;  2X60 A;  2BO6 A;  3D8V A;  4M28 A;  5CMG X;  3F1C A;  3ZF8 A;  3SXG A;  4D0Z A;  4HO6 A;  4Y64 A;  1G23 A;  2VSH A;  1LL3 A;  1YP3 A;  1YP2 A;  2FY7 A;  1OMZ A;  3E25 A;  1VH1 A;  4EE3 A;  2VS4 A;  1S4N A;  1VZT A;  5DDT A;  3I0F A;  1HV9 A;  1MP3 A;  4IRP A;  4FCE A;  2FYD B;  1O0R A;  3SXE A;  1G8O A;  3PNN A;  2VS5 A;  1GWV A;  1H3M A;  4ARW A;  1H5T B;  1WT1 A;  1H7L A;  3FWW A;  1R80 A;  4LW6 A;  1ZI4 A;  3I0D A;  1QGQ A;  4CJB A;  5CQM X;  4KRV A;  4B2W A;  1O23 B;  4Y9X A;  3OKR A;  1LZI A;  3ZLL A;  5FTS A;  4NAI A;  1VZX A;  1S4P A;  1ZJP A;  2WE9 A;  1V82 A;  1VGZ A;  2AH9 A;  3I0I X;  4FRL A;  1GWW A;  1H7G A;  3JTJ A;  1OMX A;  5C4B A;  2BO8 A;  4HO4 A;  3ZGG A;  4FRP A;  4DEC A;  1G1L A;  1G3L A;  2RJ9 A;  2D0J A;  1QG8 A;  2E8B A;  1JV1 A;  3R3I A;  1G93 A;  2X5Z A;  1ZDF A;  2JCK A;  4GBP A;  4EE4 A;  3D98 A;  2FYA A;  5CMJ A;  4B2X A;  3OH2 A;  5J49 A;  4B4B A;  4CJC A;  1LZ7 A;  5AJO A;  5AJP A;  3RMW A;  1H7E A;  2ZU9 A;  1FXJ A;  3U2W A;  1ZCV A;  4FRQ A;  5C47 A;  2OI5 A;  3ZGF A;  3POL A;  3I0K A;  1ON8 A;  3Q4S A;  3U0X A;  1QWJ A;  2V0K A;  5C36 A;  3SX7 A;  3V0L A;  1W77 A;  1R7V A;  4FRA A;  2FFU A;  3V0M A;  2YC3 A;  4HO2 A;  1H5T A;  4HO8 A;  3U2V A;  1INJ A;  3U0Y A;  1H4E A;  2RIX A;  1ZI5 A;  1HM9 A;  1HJJ A;  1LZJ A;  5FTV A;  5C1G A;  2FFV A;  3LW6 A;  2Q4J A;  1ZI1 A;  4M2B A;  1VGU A;  1NQI B;  4BQH A;  2XME A;  1R7T A;  5EIY A;  3F1Y A;  2ZU7 A;  2FYB A;  1Z90 A;  4G3S A;  5L6S A;  1H4D A;  4KPZ A;  5FYE A;  2V0L A;  3SX3 A;  2UX8 A;  5L6V A;  1FO8 A;  1ZJ2 A;  1OQM B;  2RIY A;  2V0H A;  4Y7T A;  3USQ A;  3U2T A;  2QGI A;  1TW1 A;  1FR8 A;  2JCO A;  2GGQ A;  3BCV A;  1H7Q A;  3QVB A;  3V0P A;  2A8W A;  1PZY B;  3DK5 A;  3TQD A;  1JYK A;  1FG5 N;  4ASJ A;  2QKX A;  2V0J A;  4AAW A;  1LL2 A;  2O1G A;  4P00 A;  1ZCT A;  3I0H A;  2AES A;  4D0T A;  5CQP A;  3TZT A;  3CKV A;  3IOJ A;  5C1H A;  2YQC A;  1WSZ A;  2P72 A;  1G0R A;  2Z86 A;  2AEC A;  2PGV A;  2Y4K A;  2Y4J A;  3ZLK A;  2RJ8 A;  4Y6U A;  5CMH A;  2I5K A;  3SXD A;  3V0O A;  3FOQ A;  1EYR A;  1WT3 A;  2V0I A;  1R7Y A;  1VZU A;  2XMH A;  1HM0 A;  3KIA A;  1V83 A;  1LVW A;  4B42 A;  3CKJ A;  3OC9 A;  4D11 A;  1FWY A;  2RIT A;  1KWS A;  3K8E A;  1E5K A;  1ZJ0 A;  3Q7U A;  1H5R B;  5C4C A;  3SX5 A;  2VFZ A;  4HG6 A;  2YQS A;  4Y63 A;  4EVW A;  2VD4 A;  5I1F A;  4NAL A;  1TZF A;  1YP4 A;  3PKP A;  3T7N A;  5EJ1 A;  5CQL X;  1R7U A;  4CVH A;  5C1L A;  1HM8 A;  1PZT A;  2PX7 A;  4Y62 A;  3K8D A;  1LZ0 A;  5BXC A;  1HJL A;  2MZB A;  2AE7 A;  1GA8 A;  3OH0 A;  2AM5 A;  2XWN A;  1ZDG A;  4YS8 A;  3V90 A;  4B4M A;  2AGD A;  1SS9 A;  5EJZ A;  2YC5 A;  2PA4 A;  3CKQ A;  4AC3 A;  1V84 A;  3U2U A;  1I52 A;  1W57 A;  1XZ6 A;  4DDZ A;  1QGS A;  3RMV A;  3ST8 A;  4C2S A;  2D7R A;  5IDT A;  4D11 C;  4G3Q A;  1H4C A;  4FRO A;  2CU2 A;  4J18 A;  4FQW A;  1GQC A;  1WVC A;  4EEO A;  3SXA A;  4M4K A;  1VPA A;  4EEG A;  3JUK A;  5C3A A;  1IIN A;  1LL0 A;  2WVM A;  2ICY A;  4FRE A;  4R7P A;  2RJ4 A;  1ZCY A;  1WT2 A;  4EE5 A;  2BO7 A;  4MYB A;  1H5R A;  3OAM A;  3E26 A;  5DDV A;  4HO9 A;  1MC3 A;  1H7H A;  4MND A;  4Y7G A;  4HOC A;  3IOI A;  4HCQ A;  2OI6 A;  4HO0 A;  3I0J A;  3RSB A;  2VSI A;  2RJ1 A;  5AJN A;  4KNR A;  2I5E A;  5FU8 A;  1ZJO A;  1INI A;  3I0L A;  2P6W A;  4AYJ A;  1MP4 A;  2VS3 A;  1TVY A;  1VH3 A;  2YCM A;  4HO3 A;  2YQJ A;  4CJ8 A;  2Y7A A;  2XWM A;  4NAK A;  1JVD A; 
#chains in the Genus database with same CATH topology
 4FRD A;  1H7T A;  3USR A;  2WAW A;  3GUE A;  1O7Q A;  4KC2 A;  1R82 A;  5JQQ A;  2FYC B;  3N9W A;  3CKN A;  1VGW A;  1JV3 A;  2AM4 A;  1FGX A;  3D5N A;  1H5S A;  4B3U A;  1NMM B;  2Y4L A;  2RJ6 A;  3SPT A;  2A8U A;  2RIZ A;  3OH1 A;  4Y7U A;  4Y7F A;  2YQH A;  4XWI A;  1JVG A;  2ZU8 A;  2X65 A;  1IIM A;  3O3P A;  3Q80 A;  1W55 A;  1GX0 A;  3OH3 A;  4E1K A;  1YRO B;  4ECM A;  2RJ5 A;  3I0C A;  4JIS A;  2P73 A;  3EE5 A;  1O7O A;  2OEF A;  2YES A;  3IOH A;  4KC4 A;  2O1H A;  1ZJ1 A;  3V8Z A;  2NXV A;  5C4D A;  1JYL A;  1FOA A;  1G9R A;  4EEM A;  2JCJ A;  3I0G A;  1NF5 B;  3T7M A;  1ZJ3 A;  1GQ9 A;  1H5S C;  2X5S A;  4ASY A;  1XHB A;  2ICX A;  4FRH A;  1FR9 A;  2JCL A;  3V91 A;  3BRK X;  3V8Y A;  5FU0 A;  2DPW A;  2Y4M A;  3DUV A;  4AYL A;  4IRQ A;  1G97 A;  2QH5 A;  4G87 A;  4M2A A;  2OI7 A;  2WEE A;  5C49 A;  2VXL A;  1H5S B;  2GGO A;  4KXO A;  4L41 C;  4D48 A;  4G3P A;  5CMI A;  4JD0 A;  2WGZ A;  2APC A;  2I7B A;  4FIX A;  1H7F A;  4KT7 A;  1VIC A;  4FRB A;  1ZI3 A;  4Y6N A;  3SXC A;  1VM8 A;  2W0W A;  1FO9 A;  1FRW A;  2RJ0 A;  1MP5 A;  5CMF X;  1R81 A;  1WT0 A;  4B5B A;  2E3D A;  4NAN A;  5C4E A;  2RJ7 A;  4K6R A;  5CQN X;  3V0Q A;  1H5S D;  5FUH A;  4KPX A;  2Y6P A;  5C48 A;  5IFY A;  3U2X A;  5C3B A;  1NWG B;  4KC1 A;  1NKH B;  2OEG A;  4BMA A;  1GX4 A;  3CGX A;  4FCU A;  5C38 A;  3I0E A;  1EZI A;  3OH4 A;  3CU0 A;  4ZDQ A;  3JUJ A;  4Y7V A;  3DJ4 A;  1ON6 A;  1G95 A;  1K4V A;  4FRM A;  3OGZ A;  3T7O A;  2XWL A;  4B4G A;  5C8R A;  2O1F A;  4DE7 A;  3SXB A;  2VXM A;  2PGY A;  4HO5 A;  3HL3 A;  4UEG A;  1FGG A;  1G2V A;  4O6N A;  4P02 A;  1FZW A;  1ZIZ A;  3V0N A;  2W0V A;  1R7X A;  5HS2 A;  3NGW A;  2AM3 A;  2WVK A;  5IDS A;  4LW3 A;  1S4O A;  3CKO A;  1ZHJ A;  1ZCU A;  4KNX A;  5CQO A;  4KQL A;  1VGT A;  2Z87 A;  3PKQ A;  5C4F A;  5FV9 A;  3R2W A;  3SX8 A;  5C3D A;  1FXO A;  1TW5 A;  1NHE B;  2WVL A;  2D7I A;  4EEA A;  2BO4 A;  2X60 A;  2BO6 A;  3D8V A;  4M28 A;  5CMG X;  3F1C A;  3ZF8 A;  3SXG A;  4D0Z A;  4HO6 A;  4Y64 A;  1G23 A;  2VSH A;  1LL3 A;  1YP3 A;  1YP2 A;  2FY7 A;  1OMZ A;  3E25 A;  1VH1 A;  4EE3 A;  2VS4 A;  1S4N A;  1VZT A;  5DDT A;  3I0F A;  1HV9 A;  1MP3 A;  4IRP A;  4FCE A;  2FYD B;  1O0R A;  3SXE A;  1G8O A;  3PNN A;  2VS5 A;  1GWV A;  1H3M A;  4ARW A;  1H5T B;  1WT1 A;  1H7L A;  3FWW A;  1R80 A;  4LW6 A;  1ZI4 A;  3I0D A;  1QGQ A;  4CJB A;  5CQM X;  4KRV A;  4B2W A;  1O23 B;  4Y9X A;  3OKR A;  1LZI A;  3ZLL A;  5FTS A;  4NAI A;  1VZX A;  1S4P A;  1ZJP A;  2WE9 A;  1V82 A;  1VGZ A;  2AH9 A;  3I0I X;  4FRL A;  1GWW A;  1H7G A;  3JTJ A;  1OMX A;  5C4B A;  2BO8 A;  4HO4 A;  3ZGG A;  2VK9 A;  4FRP A;  4DEC A;  1G1L A;  1G3L A;  2RJ9 A;  2D0J A;  1QG8 A;  2E8B A;  1JV1 A;  3R3I A;  1G93 A;  2X5Z A;  1ZDF A;  4FIY A;  2JCK A;  4GBP A;  4EE4 A;  3D98 A;  2FYA A;  5CMJ A;  4B2X A;  3OH2 A;  5J49 A;  4B4B A;  4CJC A;  1LZ7 A;  5AJO A;  5AJP A;  3RMW A;  2J0B A;  1H7E A;  2ZU9 A;  1FXJ A;  3U2W A;  1ZCV A;  4FRQ A;  5C47 A;  2OI5 A;  3ZGF A;  3POL A;  3I0K A;  1ON8 A;  3Q4S A;  3U0X A;  1QWJ A;  2V0K A;  5C36 A;  3SX7 A;  3V0L A;  1W77 A;  1R7V A;  4FRA A;  2FFU A;  5D92 A;  3V0M A;  2YC3 A;  4HO2 A;  1H5T A;  4HO8 A;  3U2V A;  1INJ A;  3U0Y A;  1H4E A;  5D91 A;  2RIX A;  1ZI5 A;  1HM9 A;  1HJJ A;  1LZJ A;  5FTV A;  5C1G A;  2FFV A;  3LW6 A;  2Q4J A;  1ZI1 A;  4M2B A;  1VGU A;  1NQI B;  4BQH A;  2XME A;  1R7T A;  5EIY A;  3F1Y A;  2ZU7 A;  2FYB A;  1Z90 A;  4G3S A;  5L6S A;  1H4D A;  4KPZ A;  5FYE A;  2V0L A;  3SX3 A;  2UX8 A;  5L6V A;  1FO8 A;  1ZJ2 A;  1OQM B;  2RIY A;  2V0H A;  4Y7T A;  3USQ A;  3U2T A;  2QGI A;  1TW1 A;  1FR8 A;  2JCO A;  2GGQ A;  3BCV A;  1H7Q A;  3QVB A;  3V0P A;  2A8W A;  1PZY B;  3DK5 A;  3TQD A;  1JYK A;  2J0A A;  1FG5 N;  4ASJ A;  2QKX A;  2V0J A;  4AAW A;  1LL2 A;  2O1G A;  4P00 A;  1ZCT A;  3I0H A;  2AES A;  4D0T A;  4Q7C A;  5CQP A;  3TZT A;  3CKV A;  3IOJ A;  5C1H A;  2YQC A;  1WSZ A;  2P72 A;  1G0R A;  2Z86 A;  2AEC A;  2PGV A;  2Y4K A;  2Y4J A;  3ZLK A;  2RJ8 A;  4Y6U A;  5CMH A;  2I5K A;  3SXD A;  3V0O A;  3FOQ A;  1EYR A;  1WT3 A;  2V0I A;  1R7Y A;  1VZU A;  2XMH A;  1HM0 A;  3KIA A;  1V83 A;  1LVW A;  2C0N A;  4B42 A;  3CKJ A;  3OC9 A;  4D11 A;  1FWY A;  2RIT A;  1KWS A;  4MIX A;  3K8E A;  1E5K A;  1ZJ0 A;  3Q7U A;  1H5R B;  5C4C A;  3SX5 A;  2VFZ A;  4HG6 A;  2YQS A;  4Y63 A;  4EVW A;  2VD4 A;  5I1F A;  4NAL A;  1TZF A;  1YP4 A;  3PKP A;  3T7N A;  5EJ1 A;  5CQL X;  1R7U A;  4CVH A;  5C1L A;  1HM8 A;  1PZT A;  2PX7 A;  4Y62 A;  3K8D A;  1LZ0 A;  5BXC A;  1HJL A;  2MZB A;  2AE7 A;  1GA8 A;  3OH0 A;  2AM5 A;  2XWN A;  1ZDG A;  4YS8 A;  3V90 A;  4B4M A;  2AGD A;  1SS9 A;  5EJZ A;  2YC5 A;  2PA4 A;  3CKQ A;  4AC3 A;  1V84 A;  3U2U A;  1I52 A;  1W57 A;  1XZ6 A;  4DDZ A;  1QGS A;  3RMV A;  3ST8 A;  4C2S A;  2D7R A;  5IDT A;  4D11 C;  4G3Q A;  1H4C A;  4FRO A;  2CU2 A;  4J18 A;  4FQW A;  1GQC A;  1WVC A;  4EEO A;  3SXA A;  4M4K A;  1VPA A;  4EEG A;  3JUK A;  5C3A A;  1IIN A;  1LL0 A;  2WVM A;  2ICY A;  4FRE A;  4R7P A;  2RJ4 A;  4O6M A;  1ZCY A;  1WT2 A;  4EE5 A;  2BO7 A;  4MYB A;  1H5R A;  3OAM A;  3E26 A;  5DDV A;  4HO9 A;  1MC3 A;  1H7H A;  4MND A;  4Y7G A;  4HOC A;  3IOI A;  4HCQ A;  2OI6 A;  4HO0 A;  3I0J A;  3RSB A;  2VSI A;  2RJ1 A;  5AJN A;  4KNR A;  2I5E A;  5FU8 A;  1ZJO A;  1INI A;  3I0L A;  2P6W A;  4AYJ A;  1MP4 A;  2VS3 A;  1TVY A;  1VH3 A;  2YCM A;  4HO3 A;  2YQJ A;  4CJ8 A;  2Y7A A;  2XWM A;  4NAK A;  1JVD A; 
#chains in the Genus database with same CATH homology
 4FRD A;  1H7T A;  3USR A;  2WAW A;  3GUE A;  1O7Q A;  4KC2 A;  1R82 A;  5JQQ A;  2FYC B;  3N9W A;  3CKN A;  1VGW A;  1JV3 A;  2AM4 A;  1FGX A;  3D5N A;  1H5S A;  4B3U A;  1NMM B;  2Y4L A;  2RJ6 A;  3SPT A;  2A8U A;  2RIZ A;  3OH1 A;  4Y7U A;  4Y7F A;  2YQH A;  4XWI A;  1JVG A;  2ZU8 A;  2X65 A;  1IIM A;  3O3P A;  3Q80 A;  1W55 A;  1GX0 A;  3OH3 A;  4E1K A;  1YRO B;  4ECM A;  2RJ5 A;  3I0C A;  4JIS A;  2P73 A;  3EE5 A;  1O7O A;  2OEF A;  2YES A;  3IOH A;  4KC4 A;  2O1H A;  1ZJ1 A;  3V8Z A;  2NXV A;  5C4D A;  1JYL A;  1FOA A;  1G9R A;  4EEM A;  2JCJ A;  3I0G A;  1NF5 B;  3T7M A;  1ZJ3 A;  1GQ9 A;  1H5S C;  2X5S A;  4ASY A;  1XHB A;  2ICX A;  4FRH A;  1FR9 A;  2JCL A;  3V91 A;  3BRK X;  3V8Y A;  5FU0 A;  2DPW A;  2Y4M A;  3DUV A;  4AYL A;  4IRQ A;  1G97 A;  2QH5 A;  4G87 A;  4M2A A;  2OI7 A;  2WEE A;  5C49 A;  2VXL A;  1H5S B;  2GGO A;  4KXO A;  4L41 C;  4D48 A;  4G3P A;  5CMI A;  4JD0 A;  2WGZ A;  2APC A;  2I7B A;  4FIX A;  1H7F A;  4KT7 A;  1VIC A;  4FRB A;  1ZI3 A;  4Y6N A;  3SXC A;  1VM8 A;  2W0W A;  1FO9 A;  1FRW A;  2RJ0 A;  1MP5 A;  5CMF X;  1R81 A;  1WT0 A;  4B5B A;  2E3D A;  4NAN A;  5C4E A;  2RJ7 A;  4K6R A;  5CQN X;  3V0Q A;  1H5S D;  5FUH A;  4KPX A;  2Y6P A;  5C48 A;  5IFY A;  3U2X A;  5C3B A;  1NWG B;  4KC1 A;  1NKH B;  2OEG A;  4BMA A;  1GX4 A;  3CGX A;  4FCU A;  5C38 A;  3I0E A;  1EZI A;  3OH4 A;  3CU0 A;  4ZDQ A;  3JUJ A;  4Y7V A;  3DJ4 A;  1ON6 A;  1G95 A;  1K4V A;  4FRM A;  3OGZ A;  3T7O A;  2XWL A;  4B4G A;  5C8R A;  2O1F A;  4DE7 A;  3SXB A;  2VXM A;  2PGY A;  4HO5 A;  3HL3 A;  4UEG A;  1FGG A;  1G2V A;  4O6N A;  4P02 A;  1FZW A;  1ZIZ A;  3V0N A;  2W0V A;  1R7X A;  5HS2 A;  3NGW A;  2AM3 A;  2WVK A;  5IDS A;  4LW3 A;  1S4O A;  3CKO A;  1ZHJ A;  1ZCU A;  4KNX A;  5CQO A;  4KQL A;  1VGT A;  2Z87 A;  3PKQ A;  5C4F A;  5FV9 A;  3R2W A;  3SX8 A;  5C3D A;  1FXO A;  1TW5 A;  1NHE B;  2WVL A;  2D7I A;  4EEA A;  2BO4 A;  2X60 A;  2BO6 A;  3D8V A;  4M28 A;  5CMG X;  3F1C A;  3ZF8 A;  3SXG A;  4D0Z A;  4HO6 A;  4Y64 A;  1G23 A;  2VSH A;  1LL3 A;  1YP3 A;  1YP2 A;  2FY7 A;  1OMZ A;  3E25 A;  1VH1 A;  4EE3 A;  2VS4 A;  1S4N A;  1VZT A;  5DDT A;  3I0F A;  1HV9 A;  1MP3 A;  4IRP A;  4FCE A;  2FYD B;  1O0R A;  3SXE A;  1G8O A;  3PNN A;  2VS5 A;  1GWV A;  1H3M A;  4ARW A;  1H5T B;  1WT1 A;  1H7L A;  3FWW A;  1R80 A;  4LW6 A;  1ZI4 A;  3I0D A;  1QGQ A;  4CJB A;  5CQM X;  4KRV A;  4B2W A;  1O23 B;  4Y9X A;  3OKR A;  1LZI A;  3ZLL A;  5FTS A;  4NAI A;  1VZX A;  1S4P A;  1ZJP A;  2WE9 A;  1V82 A;  1VGZ A;  2AH9 A;  3I0I X;  4FRL A;  1GWW A;  1H7G A;  3JTJ A;  1OMX A;  5C4B A;  2BO8 A;  4HO4 A;  3ZGG A;  2VK9 A;  4FRP A;  4DEC A;  1G1L A;  1G3L A;  2RJ9 A;  2D0J A;  1QG8 A;  2E8B A;  1JV1 A;  3R3I A;  1G93 A;  2X5Z A;  1ZDF A;  4FIY A;  2JCK A;  4GBP A;  4EE4 A;  3D98 A;  2FYA A;  5CMJ A;  4B2X A;  3OH2 A;  5J49 A;  4B4B A;  4CJC A;  1LZ7 A;  5AJO A;  5AJP A;  3RMW A;  2J0B A;  1H7E A;  2ZU9 A;  1FXJ A;  3U2W A;  1ZCV A;  4FRQ A;  5C47 A;  2OI5 A;  3ZGF A;  3POL A;  3I0K A;  1ON8 A;  3Q4S A;  3U0X A;  1QWJ A;  2V0K A;  5C36 A;  3SX7 A;  3V0L A;  1W77 A;  1R7V A;  4FRA A;  2FFU A;  5D92 A;  3V0M A;  2YC3 A;  4HO2 A;  1H5T A;  4HO8 A;  3U2V A;  1INJ A;  3U0Y A;  1H4E A;  5D91 A;  2RIX A;  1ZI5 A;  1HM9 A;  1HJJ A;  1LZJ A;  5FTV A;  5C1G A;  2FFV A;  3LW6 A;  2Q4J A;  1ZI1 A;  4M2B A;  1VGU A;  1NQI B;  4BQH A;  2XME A;  1R7T A;  5EIY A;  3F1Y A;  2ZU7 A;  2FYB A;  1Z90 A;  4G3S A;  5L6S A;  1H4D A;  4KPZ A;  5FYE A;  2V0L A;  3SX3 A;  2UX8 A;  5L6V A;  1FO8 A;  1ZJ2 A;  1OQM B;  2RIY A;  2V0H A;  4Y7T A;  3USQ A;  3U2T A;  2QGI A;  1TW1 A;  1FR8 A;  2JCO A;  2GGQ A;  3BCV A;  1H7Q A;  3QVB A;  3V0P A;  2A8W A;  1PZY B;  3DK5 A;  3TQD A;  1JYK A;  2J0A A;  1FG5 N;  4ASJ A;  2QKX A;  2V0J A;  4AAW A;  1LL2 A;  2O1G A;  4P00 A;  1ZCT A;  3I0H A;  2AES A;  4D0T A;  4Q7C A;  5CQP A;  3TZT A;  3CKV A;  3IOJ A;  5C1H A;  2YQC A;  1WSZ A;  2P72 A;  1G0R A;  2Z86 A;  2AEC A;  2PGV A;  2Y4K A;  2Y4J A;  3ZLK A;  2RJ8 A;  4Y6U A;  5CMH A;  2I5K A;  3SXD A;  3V0O A;  3FOQ A;  1EYR A;  1WT3 A;  2V0I A;  1R7Y A;  1VZU A;  2XMH A;  1HM0 A;  3KIA A;  1V83 A;  1LVW A;  2C0N A;  4B42 A;  3CKJ A;  3OC9 A;  4D11 A;  1FWY A;  2RIT A;  1KWS A;  4MIX A;  3K8E A;  1E5K A;  1ZJ0 A;  3Q7U A;  1H5R B;  5C4C A;  3SX5 A;  2VFZ A;  4HG6 A;  2YQS A;  4Y63 A;  4EVW A;  2VD4 A;  5I1F A;  4NAL A;  1TZF A;  1YP4 A;  3PKP A;  3T7N A;  5EJ1 A;  5CQL X;  1R7U A;  4CVH A;  5C1L A;  1HM8 A;  1PZT A;  2PX7 A;  4Y62 A;  3K8D A;  1LZ0 A;  5BXC A;  1HJL A;  2MZB A;  2AE7 A;  1GA8 A;  3OH0 A;  2AM5 A;  2XWN A;  1ZDG A;  4YS8 A;  3V90 A;  4B4M A;  2AGD A;  1SS9 A;  5EJZ A;  2YC5 A;  2PA4 A;  3CKQ A;  4AC3 A;  1V84 A;  3U2U A;  1I52 A;  1W57 A;  1XZ6 A;  4DDZ A;  1QGS A;  3RMV A;  3ST8 A;  4C2S A;  2D7R A;  5IDT A;  4D11 C;  4G3Q A;  1H4C A;  4FRO A;  2CU2 A;  4J18 A;  4FQW A;  1GQC A;  1WVC A;  4EEO A;  3SXA A;  4M4K A;  1VPA A;  4EEG A;  3JUK A;  5C3A A;  1IIN A;  1LL0 A;  2WVM A;  2ICY A;  4FRE A;  4R7P A;  2RJ4 A;  4O6M A;  1ZCY A;  1WT2 A;  4EE5 A;  2BO7 A;  4MYB A;  1H5R A;  3OAM A;  3E26 A;  5DDV A;  4HO9 A;  1MC3 A;  1H7H A;  4MND A;  4Y7G A;  4HOC A;  3IOI A;  4HCQ A;  2OI6 A;  4HO0 A;  3I0J A;  3RSB A;  2VSI A;  2RJ1 A;  5AJN A;  4KNR A;  2I5E A;  5FU8 A;  1ZJO A;  1INI A;  3I0L A;  2P6W A;  4AYJ A;  1MP4 A;  2VS3 A;  1TVY A;  1VH3 A;  2YCM A;  4HO3 A;  2YQJ A;  4CJ8 A;  2Y7A A;  2XWM A;  4NAK A;  1JVD A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...