1H5SC

Thymidylyltransferase complexed with tmp
Total Genus 95
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
95
sequence length
290
structure length
290
Chain Sequence
KMRKGIILAGGSGTRLYPVTMAVSKQLLPIYDKPMIYYPLSTLMLAGIRDILIISTPQDTPRFQQLLGDGSQWGLNLQYKVQPSPDGLAQAFIIGEEFIGGDDCALVLGDNIFYGHDLPKLMEAAVNKESGATVFAYHVNDPERYGVVEFDKNGTAISLEEKPLEPKSNYAVTGLYFYDNDVVQMAKNLKPSARGELEITDINRIYLEQGRLSVAMMGRGYAWLDTGTHQSLIEASNFIATIEERQGLKVSCPEEIAFRKGFIDVEQVRKLAVPLIKNNYGQYLYKMTKD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Glucose-1-phosphate thymidylyltransferase 1
publication title Kinetic and crystallographic analyses support a sequential-ordered bi bi catalytic mechanism for Escherichia coli glucose-1-phosphate thymidylyltransferase.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Transferase
total genus 95
structure length 290
sequence length 290
ec nomenclature ec 2.7.7.24: Glucose-1-phosphate thymidylyltransferase.
pdb deposition date 2001-05-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00483 NTP_transferase Nucleotidyl transferase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.550.10 Alpha Beta Alpha-Beta Complex Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A 1h5sC00
4XWIA 1ZI5A 1ZJPA 1W77A 2JCJA 3OH2A 2FFUA 4M4KA 3R3IA 1G8OA 2GGQA 5AJNA 3T7MA 3SPTA 3V0NA 2VSIA 4HO4A 3FWWA 4FCUA 3JUJA 4KPZA 1H3MA 2YC3A 1ON8A 4P02A 2V0KA 4HO0A 1I52A 2Y6PA 2Z86A 4FRQA 1YP2A 2A8UA 3EE5A 3PKPA 5CMFX 1VGZA 2XWNA 1H5RB 3OGZA 2YQCA 2JCKA 1GX4A 4ASYA 2Y4LA 3OKRA 3I0HA 4Y63A 1TVYA 3U2UA 2XWLA 1GQ9A 2BO7A 4EVWA 2P72A 4HO9A 3USRA 2RJ5A 2VS5A 3KIAA 5C4EA 1TZFA 1OQMB 5C49A 1O7OA 2BO4A 1H7LA 1W57A 4UEGA 1HM8A 5L6VA 2GGOA 3DK5A 1WT1A 4L41C 1G0RA 1K4VA 4CJCA 1HV9A 4Y7TA 5CQMX 4NALA 2JCOA 1ZJ0A 2FYAA 1TW5A 2ICYA 3PNNA 4D11C 1GA8A 1ZJ1A 4C2SA 1H5RA 2VS4A 1H7HA 2Q4JA 1MP5A 1G3LA 4G87A 3HL3A 2Y4MA 2FYBA 1XHBA 3SXGA 3V8ZA 1OMZA 4DE7A 5C48A 2PX7A 2ICXA 3DUVA 1LL2A 4NANA 3SX8A 3D98A 4D0ZA 1OMXA 4EEGA 3CKOA 2DPWA 2RIZA 1G2VA 5CQLX 3FOQA 2AM4A 4EEMA 5C38A 1EYRA 2APCA 2WAWA 2FFVA 3D8VA 3CKVA 2VSHA 4Y6UA 1FXOA 3CKNA 4DECA 5C4FA 1G97A 1FO8A 1ZI1A 3IOJA 3BCVA 1HJLA 4NAIA 3I0FA 3OAMA 5CMGX 1H7QA 1NQIB 1S4NA 1ZIZA 4KQLA 1R80A 4Y7FA 2MZBA 4FRLA 5IDTA 2FY7A 1G23A 4Y9XA 4IRQA 3TZTA 2AECA 4R7PA 1GWWA 3ZLKA 3V0LA 4FROA 4P00A 4G3SA 5FTVA 2D7RA 1ZCVA 3K8DA 2W0VA 1MC3A 4AYLA 1IIMA 4KNRA 2BO6A 3SXBA 3CKJA 2D0JA 4KC2A 2YCMA 4Y64A 5C36A 2O1FA 1VICA 3GUEA 1KWSA 3DJ4A 3R2WA 1XZ6A 1TW1A 3PKQA 4B2XA 2NXVA 1ZCYA 1LZ7A 3SX7A 4B5BA 1R81A 4KRVA 4FRBA 1IINA 1W55A 1H5SD 2VS3A 3I0KA 4KC1A 4Y7GA 1ZHJA 2XMHA 4HOCA 3F1YA 5EIYA 1H7FA 3I0DA 4LW6A 1ZI4A 1FXJA 3ZGGA 5C4DA 3SXAA 2I5KA 2RJ0A 2FYDB 1H5SC 1NF5B 4HCQA 2WVKA 2OI7A 1GQCA 2RJ1A 5C8RA 1WT0A 3OH1A 1HM0A 2YQHA 3OH3A 1S4PA 4Y7UA 1WSZA 4Y6NA 5DDTA 1H7TA 1V84A 4Y62A 3OH4A 2YESA 3SXEA 4Y7VA 1EZIA 3K8EA 1ON6A 2ZU9A 1FG5N 2O1GA 1JYLA 3OH0A 4IRPA 1FZWA 3IOIA 2OI6A 4EE5A 5CMIA 5C3AA 2XWMA 1GX0A 3V8YA 2OI5A 2V0IA 3JTJA 1PZYB 3IOHA 1R7TA 3ZGFA 5IFYA 4LW3A 3I0EA 5JQQA 1HM9A 3TQDA 1R7XA 1H5SB 3I0IX 2Z87A 3V0OA 3F1CA 4EE4A 4YS8A 1H4DA 3U2TA 1FGGA 3CU0A 1VH3A 1S4OA 1LZ0A 4FCEA 1JVDA 4HO3A 5CQPA 5C3BA 1JV3A 5FYEA 1FR9A 3U0XA 2YQJA 1FR8A 4AAWA 4GBPA 1V82A 1G93A 3SXCA 1YROB 1H7EA 5C1HA 2FYCB 4B4MA 3V0QA 2I5EA 1HJJA 3U0YA 4J18A 2AESA 4FRHA 4HO8A 2A8WA 4B3UA 4G3QA 4FRDA 1ZCTA 2X5SA 3D5NA 4B2WA 2X65A 5C47A 2VFZA 3Q7UA 1LZIA 2I7BA 4MNDA 4ARWA 3LW6A 4HO5A 1Z90A 1QWJA 2P73A 3V90A 3V91A 3POLA 1NHEB 3JUKA 3ST8A 1R7YA 2ZU8A 2AM5A 4FQWA 1GWVA 1ZDFA 2VD4A 3SXDA 3V0MA 1FGXA 4JISA 4D11A 1INJA 2CU2A 1E5KA 1H4CA 1H5TB 4D0TA 1ZJ3A 3OC9A 4M2BA 2RJ4A 4JD0A 5L6SA 2WEEA 1ZCUA 1MP4A 3Q4SA 2WGZA 4EEAA 3RMVA 4AYJA 3I0LA 1NWGB 2JCLA 4BQHA 2P6WA 2W0WA 1YP4A 3Q80A 2PGVA 1VZUA 3V0PA 5CMJA 4BMAA 1VGUA 1O7QA 2AH9A 2RJ9A 2RITA 4HO2A 3E25A 2V0HA 2O1HA 2ZU7A 2RJ6A 1INIA 2PGYA 3E26A 3O3PA 5AJOA 1FOAA 3CGXA 1H7GA 1H5TA 1NKHB 5HS2A 4AC3A 2Y4KA 1JV1A 4NAKA 4M2AA 3T7NA 5FV9A 1WVCA 2AM3A 2AGDA 4KT7A 2RJ8A 2RIYA 1LZJA 4D48A 2V0JA 5C3DA 5C4CA 1VZTA 2VXLA 1O0RA 3NGWA 1ZI3A 5FUHA 1WT2A 5IDSA 4FRMA 3QVBA 1LL0A 4DDZA 5EJZA 5DDVA 1ZJOA 2V0LA 5FTSA 1VH1A 2AE7A 5CQNX 1G9RA 1G95A 5C4BA 2PA4A 4KXOA 4CJBA 5EJ1A 2OEFA 4B42A 3U2VA 1VGWA 4B4GA 3RSBA 2XMEA 3I0CA 4M28A 1FO9A 1SS9A 3T7OA 3I0GA 1QG8A 4K6RA 1JYKA 3RMWA 5I1FA 2BO8A 2Y4JA 2WE9A 5J49A 4ZDQA 1YP3A 1NMMB 4B4BA 4CJ8A 3USQA 2E8BA 4ASJA 2YC5A 1LL3A 4FRPA 1QGQA 1LVWA 5CMHA 2WVMA 3CKQA 2QGIA 4CVHA 3U2WA 2OEGA 1VM8A 2X60A 3SX3A 1R82A 3U2XA 4KPXA 1FWYA 1VGTA 2RJ7A 1H5SA 2Y7AA 5FU0A 5BXCA 1FRWA 4ECMA 1H4EA 2WVLA 4HG6A 5CQOA 1PZTA 2D7IA 4EE3A 4FRAA 2QKXA 3SX5A 1WT3A 3ZLLA 4EEOA 1R7UA 1QGSA 1O23B 1VZXA 3I0JA 2UX8A 1V83A 5FU8A 4G3PA 1JVGA 2X5ZA 2QH5A 4MYBA 5C1GA 2VXMA 2YQSA 3ZF8A 1G1LA 1MP3A 3N9WA 4KC4A 4FREA 4E1KA 2RIXA 4HO6A 1ZDGA 1VPAA 1R7VA 5AJPA 1ZJ2A 5C1LA 2E3DA 3BRKX 4KNXA
chains in the Genus database with same CATH superfamily
4XWIA 1ZI5A 1ZJPA 1W77A 2JCJA 3OH2A 2FFUA 4M4KA 3R3IA 1G8OA 2GGQA 5AJNA 3T7MA 3SPTA 3V0NA 2VSIA 4HO4A 3FWWA 4FCUA 3JUJA 4KPZA 1H3MA 2YC3A 4O6NA 1ON8A 4P02A 2V0KA 4HO0A 1I52A 2Y6PA 2Z86A 4FRQA 1YP2A 2A8UA 3EE5A 3PKPA 5CMFX 1VGZA 2XWNA 1H5RB 3OGZA 2YQCA 2JCKA 1GX4A 4ASYA 2Y4LA 3OKRA 3I0HA 4Y63A 1TVYA 3U2UA 2XWLA 1GQ9A 2BO7A 4EVWA 2P72A 4HO9A 3USRA 2RJ5A 2VS5A 3KIAA 5C4EA 1TZFA 1OQMB 5C49A 1O7OA 2BO4A 1H7LA 1W57A 4UEGA 1HM8A 5L6VA 2GGOA 3DK5A 1WT1A 4L41C 1G0RA 1K4VA 4CJCA 1HV9A 4Y7TA 5CQMX 4NALA 2JCOA 1ZJ0A 2FYAA 1TW5A 2ICYA 3PNNA 4D11C 1GA8A 1ZJ1A 4C2SA 1H5RA 2J0BA 2VS4A 1H7HA 2Q4JA 1MP5A 1G3LA 4G87A 3HL3A 2Y4MA 2FYBA 1XHBA 3SXGA 3V8ZA 1OMZA 4DE7A 5C48A 2PX7A 2ICXA 3DUVA 1LL2A 4NANA 3SX8A 3D98A 4D0ZA 1OMXA 4EEGA 3CKOA 2DPWA 2RIZA 1G2VA 5CQLX 3FOQA 2AM4A 4EEMA 5C38A 1EYRA 2APCA 2WAWA 2FFVA 3D8VA 3CKVA 2VSHA 4Y6UA 1FXOA 3CKNA 4DECA 2VK9A 5C4FA 4FIYA 1G97A 1FO8A 1ZI1A 3IOJA 3BCVA 1HJLA 4NAIA 3I0FA 3OAMA 5CMGX 1H7QA 4MIXA 1NQIB 1S4NA 1ZIZA 4KQLA 1R80A 4Y7FA 2MZBA 4FRLA 5IDTA 2FY7A 1G23A 4Y9XA 4IRQA 3TZTA 2AECA 4R7PA 1GWWA 3ZLKA 3V0LA 4FROA 4P00A 4G3SA 5FTVA 2D7RA 1ZCVA 3K8DA 2W0VA 1MC3A 4AYLA 1IIMA 4KNRA 2BO6A 3SXBA 3CKJA 2D0JA 4KC2A 2YCMA 4Y64A 5C36A 2O1FA 1VICA 3GUEA 1KWSA 3DJ4A 3R2WA 1XZ6A 1TW1A 3PKQA 4B2XA 2NXVA 1ZCYA 1LZ7A 3SX7A 4B5BA 1R81A 5D91A 4KRVA 4FRBA 1IINA 1W55A 1H5SD 2VS3A 3I0KA 4KC1A 2J0AA 4Y7GA 1ZHJA 2XMHA 4HOCA 3F1YA 5EIYA 1H7FA 3I0DA 4LW6A 1ZI4A 1FXJA 3ZGGA 5C4DA 3SXAA 2I5KA 2RJ0A 2FYDB 1H5SC 1NF5B 4O6MA 4HCQA 2WVKA 2OI7A 1GQCA 2RJ1A 5C8RA 1WT0A 3OH1A 1HM0A 2YQHA 3OH3A 1S4PA 4Y7UA 4Q7CA 1WSZA 4Y6NA 5DDTA 1H7TA 1V84A 4Y62A 3OH4A 2YESA 3SXEA 4Y7VA 1EZIA 3K8EA 1ON6A 2ZU9A 1FG5N 2O1GA 1JYLA 3OH0A 4IRPA 1FZWA 3IOIA 2OI6A 4EE5A 5CMIA 5C3AA 2XWMA 1GX0A 3V8YA 2OI5A 2V0IA 3JTJA 1PZYB 3IOHA 1R7TA 3ZGFA 5IFYA 4LW3A 3I0EA 5JQQA 1HM9A 3TQDA 1R7XA 1H5SB 3I0IX 2Z87A 3V0OA 3F1CA 4EE4A 4YS8A 1H4DA 3U2TA 1FGGA 3CU0A 1VH3A 1S4OA 1LZ0A 4FCEA 1JVDA 4HO3A 5CQPA 5C3BA 1JV3A 5FYEA 1FR9A 3U0XA 2YQJA 1FR8A 4AAWA 4GBPA 1V82A 1G93A 3SXCA 1YROB 1H7EA 5C1HA 2FYCB 4B4MA 3V0QA 2I5EA 1HJJA 3U0YA 4J18A 2AESA 4FRHA 4HO8A 2A8WA 4B3UA 4G3QA 5D92A 4FRDA 1ZCTA 2X5SA 3D5NA 4B2WA 2X65A 5C47A 2VFZA 3Q7UA 1LZIA 2I7BA 4MNDA 4ARWA 3LW6A 4HO5A 1Z90A 1QWJA 2P73A 3V90A 3V91A 3POLA 1NHEB 3JUKA 3ST8A 1R7YA 2ZU8A 2AM5A 4FQWA 1GWVA 1ZDFA 2VD4A 3SXDA 3V0MA 1FGXA 4JISA 4D11A 1INJA 2CU2A 1E5KA 1H4CA 1H5TB 4D0TA 1ZJ3A 3OC9A 4M2BA 2RJ4A 4JD0A 5L6SA 2WEEA 1ZCUA 1MP4A 3Q4SA 2WGZA 4EEAA 3RMVA 4AYJA 3I0LA 1NWGB 2JCLA 4BQHA 2P6WA 2W0WA 2C0NA 1YP4A 4FIXA 3Q80A 2PGVA 1VZUA 3V0PA 5CMJA 4BMAA 1VGUA 1O7QA 2AH9A 2RJ9A 2RITA 4HO2A 3E25A 2V0HA 2O1HA 2ZU7A 2RJ6A 1INIA 2PGYA 3E26A 3O3PA 5AJOA 1FOAA 3CGXA 1H7GA 1H5TA 1NKHB 5HS2A 4AC3A 2Y4KA 1JV1A 4NAKA 4M2AA 3T7NA 5FV9A 1WVCA 2AM3A 2AGDA 4KT7A 2RJ8A 2RIYA 1LZJA 4D48A 2V0JA 5C3DA 5C4CA 1VZTA 2VXLA 1O0RA 3NGWA 1ZI3A 5FUHA 1WT2A 5IDSA 4FRMA 3QVBA 1LL0A 4DDZA 5EJZA 5DDVA 1ZJOA 2V0LA 5FTSA 1VH1A 2AE7A 5CQNX 1G9RA 1G95A 5C4BA 2PA4A 4KXOA 4CJBA 5EJ1A 2OEFA 4B42A 3U2VA 1VGWA 4B4GA 3RSBA 2XMEA 3I0CA 4M28A 1FO9A 1SS9A 3T7OA 3I0GA 1QG8A 4K6RA 1JYKA 3RMWA 5I1FA 2BO8A 2Y4JA 2WE9A 5J49A 4ZDQA 1YP3A 1NMMB 4B4BA 4CJ8A 3USQA 2E8BA 4ASJA 2YC5A 1LL3A 4FRPA 1QGQA 1LVWA 5CMHA 2WVMA 3CKQA 2QGIA 4CVHA 3U2WA 2OEGA 1VM8A 2X60A 3SX3A 1R82A 3U2XA 4KPXA 1FWYA 1VGTA 2RJ7A 1H5SA 2Y7AA 5FU0A 5BXCA 1FRWA 4ECMA 1H4EA 2WVLA 4HG6A 5CQOA 1PZTA 2D7IA 4EE3A 4FRAA 2QKXA 3SX5A 1WT3A 3ZLLA 4EEOA 1R7UA 1QGSA 1O23B 1VZXA 3I0JA 2UX8A 1V83A 5FU8A 4G3PA 1JVGA 2X5ZA 2QH5A 4MYBA 5C1GA 2VXMA 2YQSA 3ZF8A 1G1LA 1MP3A 3N9WA 4KC4A 4FREA 4E1KA 2RIXA 4HO6A 1ZDGA 1VPAA 1R7VA 5AJPA 1ZJ2A 5C1LA 2E3DA 3BRKX 4KNXA
chains in the Genus database with same CATH topology
4XWIA 1ZI5A 1ZJPA 1W77A 2JCJA 3OH2A 2FFUA 4M4KA 3R3IA 1G8OA 2GGQA 5AJNA 3T7MA 3SPTA 3V0NA 2VSIA 4HO4A 3FWWA 4FCUA 3JUJA 4KPZA 1H3MA 2YC3A 4O6NA 1ON8A 4P02A 2V0KA 4HO0A 1I52A 2Y6PA 2Z86A 4FRQA 1YP2A 2A8UA 3EE5A 3PKPA 5CMFX 1VGZA 2XWNA 1H5RB 3OGZA 2YQCA 2JCKA 1GX4A 4ASYA 2Y4LA 3OKRA 3I0HA 4Y63A 1TVYA 3U2UA 2XWLA 1GQ9A 2BO7A 4EVWA 2P72A 4HO9A 3USRA 2RJ5A 2VS5A 3KIAA 5C4EA 1TZFA 1OQMB 5C49A 1O7OA 2BO4A 1H7LA 1W57A 4UEGA 1HM8A 5L6VA 2GGOA 3DK5A 1WT1A 4L41C 1G0RA 1K4VA 4CJCA 1HV9A 4Y7TA 5CQMX 4NALA 2JCOA 1ZJ0A 2FYAA 1TW5A 2ICYA 3PNNA 4D11C 1GA8A 1ZJ1A 4C2SA 1H5RA 2J0BA 2VS4A 1H7HA 2Q4JA 1MP5A 1G3LA 4G87A 3HL3A 2Y4MA 2FYBA 1XHBA 3SXGA 3V8ZA 1OMZA 4DE7A 5C48A 2PX7A 2ICXA 3DUVA 1LL2A 4NANA 3SX8A 3D98A 4D0ZA 1OMXA 4EEGA 3CKOA 2DPWA 2RIZA 1G2VA 5CQLX 3FOQA 2AM4A 4EEMA 5C38A 1EYRA 2APCA 2WAWA 2FFVA 3D8VA 3CKVA 2VSHA 4Y6UA 1FXOA 3CKNA 4DECA 2VK9A 5C4FA 4FIYA 1G97A 1FO8A 1ZI1A 3IOJA 3BCVA 1HJLA 4NAIA 3I0FA 3OAMA 5CMGX 1H7QA 4MIXA 1NQIB 1S4NA 1ZIZA 4KQLA 1R80A 4Y7FA 2MZBA 4FRLA 5IDTA 2FY7A 1G23A 4Y9XA 4IRQA 3TZTA 2AECA 4R7PA 1GWWA 3ZLKA 3V0LA 4FROA 4P00A 4G3SA 5FTVA 2D7RA 1ZCVA 3K8DA 2W0VA 1MC3A 4AYLA 1IIMA 4KNRA 2BO6A 3SXBA 3CKJA 2D0JA 4KC2A 2YCMA 4Y64A 5C36A 2O1FA 1VICA 3GUEA 1KWSA 3DJ4A 3R2WA 1XZ6A 1TW1A 3PKQA 4B2XA 2NXVA 1ZCYA 1LZ7A 3SX7A 4B5BA 1R81A 5D91A 4KRVA 4FRBA 1IINA 1W55A 1H5SD 2VS3A 3I0KA 4KC1A 2J0AA 4Y7GA 1ZHJA 2XMHA 4HOCA 3F1YA 5EIYA 1H7FA 3I0DA 4LW6A 1ZI4A 1FXJA 3ZGGA 5C4DA 3SXAA 2I5KA 2RJ0A 2FYDB 1H5SC 1NF5B 4O6MA 4HCQA 2WVKA 2OI7A 1GQCA 2RJ1A 5C8RA 1WT0A 3OH1A 1HM0A 2YQHA 3OH3A 1S4PA 4Y7UA 4Q7CA 1WSZA 4Y6NA 5DDTA 1H7TA 1V84A 4Y62A 3OH4A 2YESA 3SXEA 4Y7VA 1EZIA 3K8EA 1ON6A 2ZU9A 1FG5N 2O1GA 1JYLA 3OH0A 4IRPA 1FZWA 3IOIA 2OI6A 4EE5A 5CMIA 5C3AA 2XWMA 1GX0A 3V8YA 2OI5A 2V0IA 3JTJA 1PZYB 3IOHA 1R7TA 3ZGFA 5IFYA 4LW3A 3I0EA 5JQQA 1HM9A 3TQDA 1R7XA 1H5SB 3I0IX 2Z87A 3V0OA 3F1CA 4EE4A 4YS8A 1H4DA 3U2TA 1FGGA 3CU0A 1VH3A 1S4OA 1LZ0A 4FCEA 1JVDA 4HO3A 5CQPA 5C3BA 1JV3A 5FYEA 1FR9A 3U0XA 2YQJA 1FR8A 4AAWA 4GBPA 1V82A 1G93A 3SXCA 1YROB 1H7EA 5C1HA 2FYCB 4B4MA 3V0QA 2I5EA 1HJJA 3U0YA 4J18A 2AESA 4FRHA 4HO8A 2A8WA 4B3UA 4G3QA 5D92A 4FRDA 1ZCTA 2X5SA 3D5NA 4B2WA 2X65A 5C47A 2VFZA 3Q7UA 1LZIA 2I7BA 4MNDA 4ARWA 3LW6A 4HO5A 1Z90A 1QWJA 2P73A 3V90A 3V91A 3POLA 1NHEB 3JUKA 3ST8A 1R7YA 2ZU8A 2AM5A 4FQWA 1GWVA 1ZDFA 2VD4A 3SXDA 3V0MA 1FGXA 4JISA 4D11A 1INJA 2CU2A 1E5KA 1H4CA 1H5TB 4D0TA 1ZJ3A 3OC9A 4M2BA 2RJ4A 4JD0A 5L6SA 2WEEA 1ZCUA 1MP4A 3Q4SA 2WGZA 4EEAA 3RMVA 4AYJA 3I0LA 1NWGB 2JCLA 4BQHA 2P6WA 2W0WA 2C0NA 1YP4A 4FIXA 3Q80A 2PGVA 1VZUA 3V0PA 5CMJA 4BMAA 1VGUA 1O7QA 2AH9A 2RJ9A 2RITA 4HO2A 3E25A 2V0HA 2O1HA 2ZU7A 2RJ6A 1INIA 2PGYA 3E26A 3O3PA 5AJOA 1FOAA 3CGXA 1H7GA 1H5TA 1NKHB 5HS2A 4AC3A 2Y4KA 1JV1A 4NAKA 4M2AA 3T7NA 5FV9A 1WVCA 2AM3A 2AGDA 4KT7A 2RJ8A 2RIYA 1LZJA 4D48A 2V0JA 5C3DA 5C4CA 1VZTA 2VXLA 1O0RA 3NGWA 1ZI3A 5FUHA 1WT2A 5IDSA 4FRMA 3QVBA 1LL0A 4DDZA 5EJZA 5DDVA 1ZJOA 2V0LA 5FTSA 1VH1A 2AE7A 5CQNX 1G9RA 1G95A 5C4BA 2PA4A 4KXOA 4CJBA 5EJ1A 2OEFA 4B42A 3U2VA 1VGWA 4B4GA 3RSBA 2XMEA 3I0CA 4M28A 1FO9A 1SS9A 3T7OA 3I0GA 1QG8A 4K6RA 1JYKA 3RMWA 5I1FA 2BO8A 2Y4JA 2WE9A 5J49A 4ZDQA 1YP3A 1NMMB 4B4BA 4CJ8A 3USQA 2E8BA 4ASJA 2YC5A 1LL3A 4FRPA 1QGQA 1LVWA 5CMHA 2WVMA 3CKQA 2QGIA 4CVHA 3U2WA 2OEGA 1VM8A 2X60A 3SX3A 1R82A 3U2XA 4KPXA 1FWYA 1VGTA 2RJ7A 1H5SA 2Y7AA 5FU0A 5BXCA 1FRWA 4ECMA 1H4EA 2WVLA 4HG6A 5CQOA 1PZTA 2D7IA 4EE3A 4FRAA 2QKXA 3SX5A 1WT3A 3ZLLA 4EEOA 1R7UA 1QGSA 1O23B 1VZXA 3I0JA 2UX8A 1V83A 5FU8A 4G3PA 1JVGA 2X5ZA 2QH5A 4MYBA 5C1GA 2VXMA 2YQSA 3ZF8A 1G1LA 1MP3A 3N9WA 4KC4A 4FREA 4E1KA 2RIXA 4HO6A 1ZDGA 1VPAA 1R7VA 5AJPA 1ZJ2A 5C1LA 2E3DA 3BRKX 4KNXA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4XWI A;  1ZI5 A;  1ZJP A;  1W77 A;  2JCJ A;  3OH2 A;  2FFU A;  4M4K A;  3R3I A;  1G8O A;  2GGQ A;  5AJN A;  3T7M A;  3SPT A;  3V0N A;  2VSI A;  4HO4 A;  3FWW A;  4FCU A;  3JUJ A;  4KPZ A;  1H3M A;  2YC3 A;  1ON8 A;  4P02 A;  2V0K A;  4HO0 A;  1I52 A;  2Y6P A;  2Z86 A;  4FRQ A;  1YP2 A;  2A8U A;  3EE5 A;  3PKP A;  5CMF X;  1VGZ A;  2XWN A;  1H5R B;  3OGZ A;  2YQC A;  2JCK A;  1GX4 A;  4ASY A;  2Y4L A;  3OKR A;  3I0H A;  4Y63 A;  1TVY A;  3U2U A;  2XWL A;  1GQ9 A;  2BO7 A;  4EVW A;  2P72 A;  4HO9 A;  3USR A;  2RJ5 A;  2VS5 A;  3KIA A;  5C4E A;  1TZF A;  1OQM B;  5C49 A;  1O7O A;  2BO4 A;  1H7L A;  1W57 A;  4UEG A;  1HM8 A;  5L6V A;  2GGO A;  3DK5 A;  1WT1 A;  4L41 C;  1G0R A;  1K4V A;  4CJC A;  1HV9 A;  4Y7T A;  5CQM X;  4NAL A;  2JCO A;  1ZJ0 A;  2FYA A;  1TW5 A;  2ICY A;  3PNN A;  4D11 C;  1GA8 A;  1ZJ1 A;  4C2S A;  1H5R A;  2VS4 A;  1H7H A;  2Q4J A;  1MP5 A;  1G3L A;  4G87 A;  3HL3 A;  2Y4M A;  2FYB A;  1XHB A;  3SXG A;  3V8Z A;  1OMZ A;  4DE7 A;  5C48 A;  2PX7 A;  2ICX A;  3DUV A;  1LL2 A;  4NAN A;  3SX8 A;  3D98 A;  4D0Z A;  1OMX A;  4EEG A;  3CKO A;  2DPW A;  2RIZ A;  1G2V A;  5CQL X;  3FOQ A;  2AM4 A;  4EEM A;  5C38 A;  1EYR A;  2APC A;  2WAW A;  2FFV A;  3D8V A;  3CKV A;  2VSH A;  4Y6U A;  1FXO A;  3CKN A;  4DEC A;  5C4F A;  1G97 A;  1FO8 A;  1ZI1 A;  3IOJ A;  3BCV A;  1HJL A;  4NAI A;  3I0F A;  3OAM A;  5CMG X;  1H7Q A;  1NQI B;  1S4N A;  1ZIZ A;  4KQL A;  1R80 A;  4Y7F A;  2MZB A;  4FRL A;  5IDT A;  2FY7 A;  1G23 A;  4Y9X A;  4IRQ A;  3TZT A;  2AEC A;  4R7P A;  1GWW A;  3ZLK A;  3V0L A;  4FRO A;  4P00 A;  4G3S A;  5FTV A;  2D7R A;  1ZCV A;  3K8D A;  2W0V A;  1MC3 A;  4AYL A;  1IIM A;  4KNR A;  2BO6 A;  3SXB A;  3CKJ A;  2D0J A;  4KC2 A;  2YCM A;  4Y64 A;  5C36 A;  2O1F A;  1VIC A;  3GUE A;  1KWS A;  3DJ4 A;  3R2W A;  1XZ6 A;  1TW1 A;  3PKQ A;  4B2X A;  2NXV A;  1ZCY A;  1LZ7 A;  3SX7 A;  4B5B A;  1R81 A;  4KRV A;  4FRB A;  1IIN A;  1W55 A;  1H5S D;  2VS3 A;  3I0K A;  4KC1 A;  4Y7G A;  1ZHJ A;  2XMH A;  4HOC A;  3F1Y A;  5EIY A;  1H7F A;  3I0D A;  4LW6 A;  1ZI4 A;  1FXJ A;  3ZGG A;  5C4D A;  3SXA A;  2I5K A;  2RJ0 A;  2FYD B;  1H5S C;  1NF5 B;  4HCQ A;  2WVK A;  2OI7 A;  1GQC A;  2RJ1 A;  5C8R A;  1WT0 A;  3OH1 A;  1HM0 A;  2YQH A;  3OH3 A;  1S4P A;  4Y7U A;  1WSZ A;  4Y6N A;  5DDT A;  1H7T A;  1V84 A;  4Y62 A;  3OH4 A;  2YES A;  3SXE A;  4Y7V A;  1EZI A;  3K8E A;  1ON6 A;  2ZU9 A;  1FG5 N;  2O1G A;  1JYL A;  3OH0 A;  4IRP A;  1FZW A;  3IOI A;  2OI6 A;  4EE5 A;  5CMI A;  5C3A A;  2XWM A;  1GX0 A;  3V8Y A;  2OI5 A;  2V0I A;  3JTJ A;  1PZY B;  3IOH A;  1R7T A;  3ZGF A;  5IFY A;  4LW3 A;  3I0E A;  5JQQ A;  1HM9 A;  3TQD A;  1R7X A;  1H5S B;  3I0I X;  2Z87 A;  3V0O A;  3F1C A;  4EE4 A;  4YS8 A;  1H4D A;  3U2T A;  1FGG A;  3CU0 A;  1VH3 A;  1S4O A;  1LZ0 A;  4FCE A;  1JVD A;  4HO3 A;  5CQP A;  5C3B A;  1JV3 A;  5FYE A;  1FR9 A;  3U0X A;  2YQJ A;  1FR8 A;  4AAW A;  4GBP A;  1V82 A;  1G93 A;  3SXC A;  1YRO B;  1H7E A;  5C1H A;  2FYC B;  4B4M A;  3V0Q A;  2I5E A;  1HJJ A;  3U0Y A;  4J18 A;  2AES A;  4FRH A;  4HO8 A;  2A8W A;  4B3U A;  4G3Q A;  4FRD A;  1ZCT A;  2X5S A;  3D5N A;  4B2W A;  2X65 A;  5C47 A;  2VFZ A;  3Q7U A;  1LZI A;  2I7B A;  4MND A;  4ARW A;  3LW6 A;  4HO5 A;  1Z90 A;  1QWJ A;  2P73 A;  3V90 A;  3V91 A;  3POL A;  1NHE B;  3JUK A;  3ST8 A;  1R7Y A;  2ZU8 A;  2AM5 A;  4FQW A;  1GWV A;  1ZDF A;  2VD4 A;  3SXD A;  3V0M A;  1FGX A;  4JIS A;  4D11 A;  1INJ A;  2CU2 A;  1E5K A;  1H4C A;  1H5T B;  4D0T A;  1ZJ3 A;  3OC9 A;  4M2B A;  2RJ4 A;  4JD0 A;  5L6S A;  2WEE A;  1ZCU A;  1MP4 A;  3Q4S A;  2WGZ A;  4EEA A;  3RMV A;  4AYJ A;  3I0L A;  1NWG B;  2JCL A;  4BQH A;  2P6W A;  2W0W A;  1YP4 A;  3Q80 A;  2PGV A;  1VZU A;  3V0P A;  5CMJ A;  4BMA A;  1VGU A;  1O7Q A;  2AH9 A;  2RJ9 A;  2RIT A;  4HO2 A;  3E25 A;  2V0H A;  2O1H A;  2ZU7 A;  2RJ6 A;  1INI A;  2PGY A;  3E26 A;  3O3P A;  5AJO A;  1FOA A;  3CGX A;  1H7G A;  1H5T A;  1NKH B;  5HS2 A;  4AC3 A;  2Y4K A;  1JV1 A;  4NAK A;  4M2A A;  3T7N A;  5FV9 A;  1WVC A;  2AM3 A;  2AGD A;  4KT7 A;  2RJ8 A;  2RIY A;  1LZJ A;  4D48 A;  2V0J A;  5C3D A;  5C4C A;  1VZT A;  2VXL A;  1O0R A;  3NGW A;  1ZI3 A;  5FUH A;  1WT2 A;  5IDS A;  4FRM A;  3QVB A;  1LL0 A;  4DDZ A;  5EJZ A;  5DDV A;  1ZJO A;  2V0L A;  5FTS A;  1VH1 A;  2AE7 A;  5CQN X;  1G9R A;  1G95 A;  5C4B A;  2PA4 A;  4KXO A;  4CJB A;  5EJ1 A;  2OEF A;  4B42 A;  3U2V A;  1VGW A;  4B4G A;  3RSB A;  2XME A;  3I0C A;  4M28 A;  1FO9 A;  1SS9 A;  3T7O A;  3I0G A;  1QG8 A;  4K6R A;  1JYK A;  3RMW A;  5I1F A;  2BO8 A;  2Y4J A;  2WE9 A;  5J49 A;  4ZDQ A;  1YP3 A;  1NMM B;  4B4B A;  4CJ8 A;  3USQ A;  2E8B A;  4ASJ A;  2YC5 A;  1LL3 A;  4FRP A;  1QGQ A;  1LVW A;  5CMH A;  2WVM A;  3CKQ A;  2QGI A;  4CVH A;  3U2W A;  2OEG A;  1VM8 A;  2X60 A;  3SX3 A;  1R82 A;  3U2X A;  4KPX A;  1FWY A;  1VGT A;  2RJ7 A;  1H5S A;  2Y7A A;  5FU0 A;  5BXC A;  1FRW A;  4ECM A;  1H4E A;  2WVL A;  4HG6 A;  5CQO A;  1PZT A;  2D7I A;  4EE3 A;  4FRA A;  2QKX A;  3SX5 A;  1WT3 A;  3ZLL A;  4EEO A;  1R7U A;  1QGS A;  1O23 B;  1VZX A;  3I0J A;  2UX8 A;  1V83 A;  5FU8 A;  4G3P A;  1JVG A;  2X5Z A;  2QH5 A;  4MYB A;  5C1G A;  2VXM A;  2YQS A;  3ZF8 A;  1G1L A;  1MP3 A;  3N9W A;  4KC4 A;  4FRE A;  4E1K A;  2RIX A;  4HO6 A;  1ZDG A;  1VPA A;  1R7V A;  5AJP A;  1ZJ2 A;  5C1L A;  2E3D A;  3BRK X;  4KNX A; 
#chains in the Genus database with same CATH topology
 4XWI A;  1ZI5 A;  1ZJP A;  1W77 A;  2JCJ A;  3OH2 A;  2FFU A;  4M4K A;  3R3I A;  1G8O A;  2GGQ A;  5AJN A;  3T7M A;  3SPT A;  3V0N A;  2VSI A;  4HO4 A;  3FWW A;  4FCU A;  3JUJ A;  4KPZ A;  1H3M A;  2YC3 A;  4O6N A;  1ON8 A;  4P02 A;  2V0K A;  4HO0 A;  1I52 A;  2Y6P A;  2Z86 A;  4FRQ A;  1YP2 A;  2A8U A;  3EE5 A;  3PKP A;  5CMF X;  1VGZ A;  2XWN A;  1H5R B;  3OGZ A;  2YQC A;  2JCK A;  1GX4 A;  4ASY A;  2Y4L A;  3OKR A;  3I0H A;  4Y63 A;  1TVY A;  3U2U A;  2XWL A;  1GQ9 A;  2BO7 A;  4EVW A;  2P72 A;  4HO9 A;  3USR A;  2RJ5 A;  2VS5 A;  3KIA A;  5C4E A;  1TZF A;  1OQM B;  5C49 A;  1O7O A;  2BO4 A;  1H7L A;  1W57 A;  4UEG A;  1HM8 A;  5L6V A;  2GGO A;  3DK5 A;  1WT1 A;  4L41 C;  1G0R A;  1K4V A;  4CJC A;  1HV9 A;  4Y7T A;  5CQM X;  4NAL A;  2JCO A;  1ZJ0 A;  2FYA A;  1TW5 A;  2ICY A;  3PNN A;  4D11 C;  1GA8 A;  1ZJ1 A;  4C2S A;  1H5R A;  2J0B A;  2VS4 A;  1H7H A;  2Q4J A;  1MP5 A;  1G3L A;  4G87 A;  3HL3 A;  2Y4M A;  2FYB A;  1XHB A;  3SXG A;  3V8Z A;  1OMZ A;  4DE7 A;  5C48 A;  2PX7 A;  2ICX A;  3DUV A;  1LL2 A;  4NAN A;  3SX8 A;  3D98 A;  4D0Z A;  1OMX A;  4EEG A;  3CKO A;  2DPW A;  2RIZ A;  1G2V A;  5CQL X;  3FOQ A;  2AM4 A;  4EEM A;  5C38 A;  1EYR A;  2APC A;  2WAW A;  2FFV A;  3D8V A;  3CKV A;  2VSH A;  4Y6U A;  1FXO A;  3CKN A;  4DEC A;  2VK9 A;  5C4F A;  4FIY A;  1G97 A;  1FO8 A;  1ZI1 A;  3IOJ A;  3BCV A;  1HJL A;  4NAI A;  3I0F A;  3OAM A;  5CMG X;  1H7Q A;  4MIX A;  1NQI B;  1S4N A;  1ZIZ A;  4KQL A;  1R80 A;  4Y7F A;  2MZB A;  4FRL A;  5IDT A;  2FY7 A;  1G23 A;  4Y9X A;  4IRQ A;  3TZT A;  2AEC A;  4R7P A;  1GWW A;  3ZLK A;  3V0L A;  4FRO A;  4P00 A;  4G3S A;  5FTV A;  2D7R A;  1ZCV A;  3K8D A;  2W0V A;  1MC3 A;  4AYL A;  1IIM A;  4KNR A;  2BO6 A;  3SXB A;  3CKJ A;  2D0J A;  4KC2 A;  2YCM A;  4Y64 A;  5C36 A;  2O1F A;  1VIC A;  3GUE A;  1KWS A;  3DJ4 A;  3R2W A;  1XZ6 A;  1TW1 A;  3PKQ A;  4B2X A;  2NXV A;  1ZCY A;  1LZ7 A;  3SX7 A;  4B5B A;  1R81 A;  5D91 A;  4KRV A;  4FRB A;  1IIN A;  1W55 A;  1H5S D;  2VS3 A;  3I0K A;  4KC1 A;  2J0A A;  4Y7G A;  1ZHJ A;  2XMH A;  4HOC A;  3F1Y A;  5EIY A;  1H7F A;  3I0D A;  4LW6 A;  1ZI4 A;  1FXJ A;  3ZGG A;  5C4D A;  3SXA A;  2I5K A;  2RJ0 A;  2FYD B;  1H5S C;  1NF5 B;  4O6M A;  4HCQ A;  2WVK A;  2OI7 A;  1GQC A;  2RJ1 A;  5C8R A;  1WT0 A;  3OH1 A;  1HM0 A;  2YQH A;  3OH3 A;  1S4P A;  4Y7U A;  4Q7C A;  1WSZ A;  4Y6N A;  5DDT A;  1H7T A;  1V84 A;  4Y62 A;  3OH4 A;  2YES A;  3SXE A;  4Y7V A;  1EZI A;  3K8E A;  1ON6 A;  2ZU9 A;  1FG5 N;  2O1G A;  1JYL A;  3OH0 A;  4IRP A;  1FZW A;  3IOI A;  2OI6 A;  4EE5 A;  5CMI A;  5C3A A;  2XWM A;  1GX0 A;  3V8Y A;  2OI5 A;  2V0I A;  3JTJ A;  1PZY B;  3IOH A;  1R7T A;  3ZGF A;  5IFY A;  4LW3 A;  3I0E A;  5JQQ A;  1HM9 A;  3TQD A;  1R7X A;  1H5S B;  3I0I X;  2Z87 A;  3V0O A;  3F1C A;  4EE4 A;  4YS8 A;  1H4D A;  3U2T A;  1FGG A;  3CU0 A;  1VH3 A;  1S4O A;  1LZ0 A;  4FCE A;  1JVD A;  4HO3 A;  5CQP A;  5C3B A;  1JV3 A;  5FYE A;  1FR9 A;  3U0X A;  2YQJ A;  1FR8 A;  4AAW A;  4GBP A;  1V82 A;  1G93 A;  3SXC A;  1YRO B;  1H7E A;  5C1H A;  2FYC B;  4B4M A;  3V0Q A;  2I5E A;  1HJJ A;  3U0Y A;  4J18 A;  2AES A;  4FRH A;  4HO8 A;  2A8W A;  4B3U A;  4G3Q A;  5D92 A;  4FRD A;  1ZCT A;  2X5S A;  3D5N A;  4B2W A;  2X65 A;  5C47 A;  2VFZ A;  3Q7U A;  1LZI A;  2I7B A;  4MND A;  4ARW A;  3LW6 A;  4HO5 A;  1Z90 A;  1QWJ A;  2P73 A;  3V90 A;  3V91 A;  3POL A;  1NHE B;  3JUK A;  3ST8 A;  1R7Y A;  2ZU8 A;  2AM5 A;  4FQW A;  1GWV A;  1ZDF A;  2VD4 A;  3SXD A;  3V0M A;  1FGX A;  4JIS A;  4D11 A;  1INJ A;  2CU2 A;  1E5K A;  1H4C A;  1H5T B;  4D0T A;  1ZJ3 A;  3OC9 A;  4M2B A;  2RJ4 A;  4JD0 A;  5L6S A;  2WEE A;  1ZCU A;  1MP4 A;  3Q4S A;  2WGZ A;  4EEA A;  3RMV A;  4AYJ A;  3I0L A;  1NWG B;  2JCL A;  4BQH A;  2P6W A;  2W0W A;  2C0N A;  1YP4 A;  4FIX A;  3Q80 A;  2PGV A;  1VZU A;  3V0P A;  5CMJ A;  4BMA A;  1VGU A;  1O7Q A;  2AH9 A;  2RJ9 A;  2RIT A;  4HO2 A;  3E25 A;  2V0H A;  2O1H A;  2ZU7 A;  2RJ6 A;  1INI A;  2PGY A;  3E26 A;  3O3P A;  5AJO A;  1FOA A;  3CGX A;  1H7G A;  1H5T A;  1NKH B;  5HS2 A;  4AC3 A;  2Y4K A;  1JV1 A;  4NAK A;  4M2A A;  3T7N A;  5FV9 A;  1WVC A;  2AM3 A;  2AGD A;  4KT7 A;  2RJ8 A;  2RIY A;  1LZJ A;  4D48 A;  2V0J A;  5C3D A;  5C4C A;  1VZT A;  2VXL A;  1O0R A;  3NGW A;  1ZI3 A;  5FUH A;  1WT2 A;  5IDS A;  4FRM A;  3QVB A;  1LL0 A;  4DDZ A;  5EJZ A;  5DDV A;  1ZJO A;  2V0L A;  5FTS A;  1VH1 A;  2AE7 A;  5CQN X;  1G9R A;  1G95 A;  5C4B A;  2PA4 A;  4KXO A;  4CJB A;  5EJ1 A;  2OEF A;  4B42 A;  3U2V A;  1VGW A;  4B4G A;  3RSB A;  2XME A;  3I0C A;  4M28 A;  1FO9 A;  1SS9 A;  3T7O A;  3I0G A;  1QG8 A;  4K6R A;  1JYK A;  3RMW A;  5I1F A;  2BO8 A;  2Y4J A;  2WE9 A;  5J49 A;  4ZDQ A;  1YP3 A;  1NMM B;  4B4B A;  4CJ8 A;  3USQ A;  2E8B A;  4ASJ A;  2YC5 A;  1LL3 A;  4FRP A;  1QGQ A;  1LVW A;  5CMH A;  2WVM A;  3CKQ A;  2QGI A;  4CVH A;  3U2W A;  2OEG A;  1VM8 A;  2X60 A;  3SX3 A;  1R82 A;  3U2X A;  4KPX A;  1FWY A;  1VGT A;  2RJ7 A;  1H5S A;  2Y7A A;  5FU0 A;  5BXC A;  1FRW A;  4ECM A;  1H4E A;  2WVL A;  4HG6 A;  5CQO A;  1PZT A;  2D7I A;  4EE3 A;  4FRA A;  2QKX A;  3SX5 A;  1WT3 A;  3ZLL A;  4EEO A;  1R7U A;  1QGS A;  1O23 B;  1VZX A;  3I0J A;  2UX8 A;  1V83 A;  5FU8 A;  4G3P A;  1JVG A;  2X5Z A;  2QH5 A;  4MYB A;  5C1G A;  2VXM A;  2YQS A;  3ZF8 A;  1G1L A;  1MP3 A;  3N9W A;  4KC4 A;  4FRE A;  4E1K A;  2RIX A;  4HO6 A;  1ZDG A;  1VPA A;  1R7V A;  5AJP A;  1ZJ2 A;  5C1L A;  2E3D A;  3BRK X;  4KNX A; 
#chains in the Genus database with same CATH homology
 4XWI A;  1ZI5 A;  1ZJP A;  1W77 A;  2JCJ A;  3OH2 A;  2FFU A;  4M4K A;  3R3I A;  1G8O A;  2GGQ A;  5AJN A;  3T7M A;  3SPT A;  3V0N A;  2VSI A;  4HO4 A;  3FWW A;  4FCU A;  3JUJ A;  4KPZ A;  1H3M A;  2YC3 A;  4O6N A;  1ON8 A;  4P02 A;  2V0K A;  4HO0 A;  1I52 A;  2Y6P A;  2Z86 A;  4FRQ A;  1YP2 A;  2A8U A;  3EE5 A;  3PKP A;  5CMF X;  1VGZ A;  2XWN A;  1H5R B;  3OGZ A;  2YQC A;  2JCK A;  1GX4 A;  4ASY A;  2Y4L A;  3OKR A;  3I0H A;  4Y63 A;  1TVY A;  3U2U A;  2XWL A;  1GQ9 A;  2BO7 A;  4EVW A;  2P72 A;  4HO9 A;  3USR A;  2RJ5 A;  2VS5 A;  3KIA A;  5C4E A;  1TZF A;  1OQM B;  5C49 A;  1O7O A;  2BO4 A;  1H7L A;  1W57 A;  4UEG A;  1HM8 A;  5L6V A;  2GGO A;  3DK5 A;  1WT1 A;  4L41 C;  1G0R A;  1K4V A;  4CJC A;  1HV9 A;  4Y7T A;  5CQM X;  4NAL A;  2JCO A;  1ZJ0 A;  2FYA A;  1TW5 A;  2ICY A;  3PNN A;  4D11 C;  1GA8 A;  1ZJ1 A;  4C2S A;  1H5R A;  2J0B A;  2VS4 A;  1H7H A;  2Q4J A;  1MP5 A;  1G3L A;  4G87 A;  3HL3 A;  2Y4M A;  2FYB A;  1XHB A;  3SXG A;  3V8Z A;  1OMZ A;  4DE7 A;  5C48 A;  2PX7 A;  2ICX A;  3DUV A;  1LL2 A;  4NAN A;  3SX8 A;  3D98 A;  4D0Z A;  1OMX A;  4EEG A;  3CKO A;  2DPW A;  2RIZ A;  1G2V A;  5CQL X;  3FOQ A;  2AM4 A;  4EEM A;  5C38 A;  1EYR A;  2APC A;  2WAW A;  2FFV A;  3D8V A;  3CKV A;  2VSH A;  4Y6U A;  1FXO A;  3CKN A;  4DEC A;  2VK9 A;  5C4F A;  4FIY A;  1G97 A;  1FO8 A;  1ZI1 A;  3IOJ A;  3BCV A;  1HJL A;  4NAI A;  3I0F A;  3OAM A;  5CMG X;  1H7Q A;  4MIX A;  1NQI B;  1S4N A;  1ZIZ A;  4KQL A;  1R80 A;  4Y7F A;  2MZB A;  4FRL A;  5IDT A;  2FY7 A;  1G23 A;  4Y9X A;  4IRQ A;  3TZT A;  2AEC A;  4R7P A;  1GWW A;  3ZLK A;  3V0L A;  4FRO A;  4P00 A;  4G3S A;  5FTV A;  2D7R A;  1ZCV A;  3K8D A;  2W0V A;  1MC3 A;  4AYL A;  1IIM A;  4KNR A;  2BO6 A;  3SXB A;  3CKJ A;  2D0J A;  4KC2 A;  2YCM A;  4Y64 A;  5C36 A;  2O1F A;  1VIC A;  3GUE A;  1KWS A;  3DJ4 A;  3R2W A;  1XZ6 A;  1TW1 A;  3PKQ A;  4B2X A;  2NXV A;  1ZCY A;  1LZ7 A;  3SX7 A;  4B5B A;  1R81 A;  5D91 A;  4KRV A;  4FRB A;  1IIN A;  1W55 A;  1H5S D;  2VS3 A;  3I0K A;  4KC1 A;  2J0A A;  4Y7G A;  1ZHJ A;  2XMH A;  4HOC A;  3F1Y A;  5EIY A;  1H7F A;  3I0D A;  4LW6 A;  1ZI4 A;  1FXJ A;  3ZGG A;  5C4D A;  3SXA A;  2I5K A;  2RJ0 A;  2FYD B;  1H5S C;  1NF5 B;  4O6M A;  4HCQ A;  2WVK A;  2OI7 A;  1GQC A;  2RJ1 A;  5C8R A;  1WT0 A;  3OH1 A;  1HM0 A;  2YQH A;  3OH3 A;  1S4P A;  4Y7U A;  4Q7C A;  1WSZ A;  4Y6N A;  5DDT A;  1H7T A;  1V84 A;  4Y62 A;  3OH4 A;  2YES A;  3SXE A;  4Y7V A;  1EZI A;  3K8E A;  1ON6 A;  2ZU9 A;  1FG5 N;  2O1G A;  1JYL A;  3OH0 A;  4IRP A;  1FZW A;  3IOI A;  2OI6 A;  4EE5 A;  5CMI A;  5C3A A;  2XWM A;  1GX0 A;  3V8Y A;  2OI5 A;  2V0I A;  3JTJ A;  1PZY B;  3IOH A;  1R7T A;  3ZGF A;  5IFY A;  4LW3 A;  3I0E A;  5JQQ A;  1HM9 A;  3TQD A;  1R7X A;  1H5S B;  3I0I X;  2Z87 A;  3V0O A;  3F1C A;  4EE4 A;  4YS8 A;  1H4D A;  3U2T A;  1FGG A;  3CU0 A;  1VH3 A;  1S4O A;  1LZ0 A;  4FCE A;  1JVD A;  4HO3 A;  5CQP A;  5C3B A;  1JV3 A;  5FYE A;  1FR9 A;  3U0X A;  2YQJ A;  1FR8 A;  4AAW A;  4GBP A;  1V82 A;  1G93 A;  3SXC A;  1YRO B;  1H7E A;  5C1H A;  2FYC B;  4B4M A;  3V0Q A;  2I5E A;  1HJJ A;  3U0Y A;  4J18 A;  2AES A;  4FRH A;  4HO8 A;  2A8W A;  4B3U A;  4G3Q A;  5D92 A;  4FRD A;  1ZCT A;  2X5S A;  3D5N A;  4B2W A;  2X65 A;  5C47 A;  2VFZ A;  3Q7U A;  1LZI A;  2I7B A;  4MND A;  4ARW A;  3LW6 A;  4HO5 A;  1Z90 A;  1QWJ A;  2P73 A;  3V90 A;  3V91 A;  3POL A;  1NHE B;  3JUK A;  3ST8 A;  1R7Y A;  2ZU8 A;  2AM5 A;  4FQW A;  1GWV A;  1ZDF A;  2VD4 A;  3SXD A;  3V0M A;  1FGX A;  4JIS A;  4D11 A;  1INJ A;  2CU2 A;  1E5K A;  1H4C A;  1H5T B;  4D0T A;  1ZJ3 A;  3OC9 A;  4M2B A;  2RJ4 A;  4JD0 A;  5L6S A;  2WEE A;  1ZCU A;  1MP4 A;  3Q4S A;  2WGZ A;  4EEA A;  3RMV A;  4AYJ A;  3I0L A;  1NWG B;  2JCL A;  4BQH A;  2P6W A;  2W0W A;  2C0N A;  1YP4 A;  4FIX A;  3Q80 A;  2PGV A;  1VZU A;  3V0P A;  5CMJ A;  4BMA A;  1VGU A;  1O7Q A;  2AH9 A;  2RJ9 A;  2RIT A;  4HO2 A;  3E25 A;  2V0H A;  2O1H A;  2ZU7 A;  2RJ6 A;  1INI A;  2PGY A;  3E26 A;  3O3P A;  5AJO A;  1FOA A;  3CGX A;  1H7G A;  1H5T A;  1NKH B;  5HS2 A;  4AC3 A;  2Y4K A;  1JV1 A;  4NAK A;  4M2A A;  3T7N A;  5FV9 A;  1WVC A;  2AM3 A;  2AGD A;  4KT7 A;  2RJ8 A;  2RIY A;  1LZJ A;  4D48 A;  2V0J A;  5C3D A;  5C4C A;  1VZT A;  2VXL A;  1O0R A;  3NGW A;  1ZI3 A;  5FUH A;  1WT2 A;  5IDS A;  4FRM A;  3QVB A;  1LL0 A;  4DDZ A;  5EJZ A;  5DDV A;  1ZJO A;  2V0L A;  5FTS A;  1VH1 A;  2AE7 A;  5CQN X;  1G9R A;  1G95 A;  5C4B A;  2PA4 A;  4KXO A;  4CJB A;  5EJ1 A;  2OEF A;  4B42 A;  3U2V A;  1VGW A;  4B4G A;  3RSB A;  2XME A;  3I0C A;  4M28 A;  1FO9 A;  1SS9 A;  3T7O A;  3I0G A;  1QG8 A;  4K6R A;  1JYK A;  3RMW A;  5I1F A;  2BO8 A;  2Y4J A;  2WE9 A;  5J49 A;  4ZDQ A;  1YP3 A;  1NMM B;  4B4B A;  4CJ8 A;  3USQ A;  2E8B A;  4ASJ A;  2YC5 A;  1LL3 A;  4FRP A;  1QGQ A;  1LVW A;  5CMH A;  2WVM A;  3CKQ A;  2QGI A;  4CVH A;  3U2W A;  2OEG A;  1VM8 A;  2X60 A;  3SX3 A;  1R82 A;  3U2X A;  4KPX A;  1FWY A;  1VGT A;  2RJ7 A;  1H5S A;  2Y7A A;  5FU0 A;  5BXC A;  1FRW A;  4ECM A;  1H4E A;  2WVL A;  4HG6 A;  5CQO A;  1PZT A;  2D7I A;  4EE3 A;  4FRA A;  2QKX A;  3SX5 A;  1WT3 A;  3ZLL A;  4EEO A;  1R7U A;  1QGS A;  1O23 B;  1VZX A;  3I0J A;  2UX8 A;  1V83 A;  5FU8 A;  4G3P A;  1JVG A;  2X5Z A;  2QH5 A;  4MYB A;  5C1G A;  2VXM A;  2YQS A;  3ZF8 A;  1G1L A;  1MP3 A;  3N9W A;  4KC4 A;  4FRE A;  4E1K A;  2RIX A;  4HO6 A;  1ZDG A;  1VPA A;  1R7V A;  5AJP A;  1ZJ2 A;  5C1L A;  2E3D A;  3BRK X;  4KNX A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...