3I0KA

Crystal structure of gtb c80s/c196s/c209s + udp + h antigen
Total Genus 90
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
90
sequence length
282
structure length
267
Chain Sequence
YPQPKVLTPSRKDVLVVTPWLAPIVWEGTFNIDILNEQFRLQNTTIGLTVFAIKKYVAFLKLFLETAEKHFMVGHRVHYYVFTDQPAAVPRVTLGTGRQLSVLEVSMRRMEMISDFSERRFLSEVDYLVSVDVDMEFRDHVGVEILTPLFGTLHPSFYGSSREAFTYERRPQSQAYIPKDEGDFYYMGAFFGGSVQEVQRLTRACHQAMMVDQANGIEAVWHDESHLNKYLLRHKPTKVLSPEYLWDQQLLGWPAVLRKLRFTAVPR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords ABO glycosyltransferase
publication title Cysteine-to-serine mutants dramatically reorder the active site of human ABO(H) blood group B glycosyltransferase without affecting activity: structural insights into cooperative substrate binding
pubmed doi rcsb
source organism Homo sapiens
total genus 90
structure length 267
sequence length 282
ec nomenclature ec 2.4.1.37: Fucosylgalactoside 3-alpha-galactosyltransferase.
pdb deposition date 2009-06-25
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.550.10 Alpha Beta Alpha-Beta Complex Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A 3i0kA00
4FRLA 2AGDA 1NWGB 1WT1A 2FYDB 1ZHJA 4HO4A 5FTSA 3PKQA 3PNNA 1ZDGA 1LZIA 3BCVA 1JVGA 2ICXA 2ZU9A 4HOCA 3SX3A 1S4NA 4LW6A 2Y4MA 2W0WA 3USRA 3SX7A 5C4CA 4FRHA 1V84A 1ZCYA 1FO8A 3SXEA 4FCEA 4EE4A 5I1FA 1HM0A 3Q7UA 4B2XA 5FTVA 1YP4A 1ZDFA 2RJ4A 3Q80A 4YS8A 3QVBA 2XWLA 1YROB 2AE7A 2V0HA 3HL3A 3SXAA 2X65A 3JTJA 4AYLA 3BRKX 5C4EA 3V90A 2AH9A 3V0OA 3JUJA 1ON6A 1R80A 4HO9A 5FYEA 3CKQA 5IDTA 1H7LA 1Z90A 3CKVA 1G95A 5IFYA 4D11A 1ON8A 4B2WA 1EZIA 3I0IX 2VS4A 4KXOA 4EEOA 3OH4A 1FGXA 1ZI4A 2E3DA 4KNRA 2GGQA 2AECA 3R2WA 5EJZA 1JV3A 2FY7A 1HM9A 3RMVA 5C1LA 4FROA 1IIMA 3I0CA 5C47A 1H5TB 1ZI3A 1R81A 2YQCA 3OKRA 4HO2A 2FYBA 3U2TA 2O1FA 1ZJ3A 5J49A 1XHBA 1JYLA 3I0FA 4HCQA 1MP4A 4HO8A 1WSZA 1PZTA 4P00A 1ZJOA 4G87A 3U2XA 1OMXA 1ZCVA 2RJ7A 3TZTA 5C36A 2YC3A 4CJ8A 4CJCA 3RMWA 2YQSA 4IRPA 2WVMA 4Y7FA 3E25A 3JUKA 3USQA 4IRQA 2RJ0A 2FFUA 3SX8A 2QKXA 4R7PA 2UX8A 1H5RA 3U2VA 1S4OA 1GQCA 1MC3A 3V0MA 2XWMA 5BXCA 1HV9A 3D8VA 2PA4A 4FRPA 3T7MA 1ZIZA 1OQMB 1H5SA 3O3PA 1GQ9A 1VZTA 3POLA 2A8WA 1FWYA 3FOQA 3I0KA 4Y64A 1NF5B 1WT0A 3T7NA 1VM8A 4XWIA 1GA8A 2AM5A 2RJ9A 4FCUA 2AM3A 2BO4A 5AJNA 1GX4A 3NGWA 4L41C 1INJA 2V0IA 2E8BA 5CQPA 3IOIA 5CMJA 1LZ0A 4D48A 3KIAA 3F1YA 4CVHA 3I0DA 4LW3A 3I0JA 4Y6NA 3DK5A 3OC9A 1MP3A 1ZI1A 4ECMA 2W0VA 3TQDA 5CMIA 4FRBA 1ZJ2A 3I0GA 4JD0A 1H7QA 4FRDA 1FO9A 4BMAA 1WT2A 4EE5A 4J18A 4Y63A 4KC1A 2OI7A 4ASYA 4G3QA 2BO6A 2YQJA 1GX0A 4DE7A 1FOAA 2XMHA 3V0LA 3ZLKA 2JCOA 1LL2A 1ZJPA 1O0RA 3ZGGA 2X60A 1VGZA 4B4BA 4NALA 1K4VA 2RIXA 1QGQA 2XMEA 4E1KA 5C8RA 1NKHB 1G1LA 3I0HA 1OMZA 2X5ZA 2RJ6A 2I5KA 3ZF8A 1O23B 3CU0A 2WEEA 3K8EA 3U0XA 1W55A 1LL0A 4KPZA 1H3MA 1ZCTA 1HJLA 4AYJA 1VGTA 2OEFA 2VFZA 4NANA 4AAWA 3V8ZA 2D7RA 5C4BA 3DJ4A 1W57A 2CU2A 2VXMA 4G3SA 3D5NA 5FUHA 2Y4LA 2QH5A 3R3IA 1H4EA 3OH0A 1G2VA 2JCJA 1EYRA 4NAKA 3OGZA 5C48A 1FZWA 1ZJ1A 5L6SA 4M2BA 1IINA 2YESA 1G97A 5HS2A 3SXBA 3F1CA 3U2UA 1JYKA 2Y7AA 4MYBA 3OH2A 3OH3A 4ASJA 5C1HA 3OAMA 1WVCA 4FRQA 5C4FA 5C3DA 2VXLA 2Y4KA 5C3BA 4HO3A 4EEGA 1ZJ0A 1VH3A 2O1GA 1VICA 5CMGX 3I0LA 4C2SA 1H7TA 5IDSA 2JCKA 2ICYA 2OI6A 4Y62A 4EVWA 4KNXA 4NAIA 1NHEB 4B4MA 4KQLA 3V0NA 1NMMB 4Y7GA 1H7GA 1H4CA 5CQMX 3Q4SA 3DUVA 1YP3A 1H5TA 2VSIA 4D11C 1H7HA 1FR9A 2ZU8A 4KC2A 1O7QA 4D0ZA 4EE3A 4HG6A 2AM4A 2PX7A 4K6RA 3CKOA 2PGVA 4Y7TA 3SXGA 1FGGA 1FXOA 1QG8A 4M28A 2VS3A 4GBPA 3E26A 2PGYA 1G93A 3SXDA 4P02A 4DECA 3V8YA 1HM8A 2YCMA 1VGWA 2RIYA 2WVKA 2RJ1A 1QWJA 3U0YA 4MNDA 2D7IA 2P6WA 4Y9XA 2YC5A 3V91A 3CKNA 1VPAA 5DDVA 1TVYA 1I52A 4B42A 2APCA 5CQOA 1R7XA 1G9RA 3K8DA 5CQLX 1R7UA 1GWVA 4KPXA 2P73A 2VD4A 4UEGA 1FRWA 1VH1A 2V0JA 1SS9A 1LZ7A 4FREA 3T7OA 3N9WA 2Y6PA 4HO6A 1QGSA 1TZFA 5JQQA 2OEGA 5CQNX 1G8OA 1JVDA 2FYCB 2O1HA 5AJPA 4AC3A 2RJ8A 3PKPA 3SX5A 1FR8A 1WT3A 3CGXA 1R7VA 1R7TA 5EJ1A 4Y7UA 1TW1A 1S4PA 5C49A 4EEMA 4D0TA 3ST8A 3SPTA 1H5SC 3ZGFA 2AESA 1LL3A 1ZCUA 4DDZA 4M4KA 5FV9A 2BO8A 1NQIB 1FG5N 5C1GA 2VSHA 4FRAA 4G3PA 4FQWA 2QGIA 2WVLA 5AJOA 2XWNA 2RITA 1H7EA 2RIZA 3RSBA 1V83A 3EE5A 2Z86A 2MZBA 2V0KA 3V0QA 1TW5A 1R7YA 3ZLLA 4HO0A 2NXVA 4B4GA 5L6VA 1XZ6A 1YP2A 2VS5A 4KRVA 3U2WA 1W77A 2ZU7A 1LZJA 1H5RB 5C4DA 2OI5A 1H5SB 2RJ5A 4B3UA 1V82A 4Y6UA 4HO5A 2WGZA 4M2AA 1G23A 2GGOA 5FU8A 1H4DA 1VZXA 5DDTA 4B5BA 1VGUA 3D98A 4ZDQA 4ARWA 3OH1A 1HJJA 1MP5A 3I0EA 2FFVA 5CMFX 1R82A 1G0RA 1VZUA 2I7BA 2Z87A 4KT7A 5C38A 2BO7A 2V0LA 4KC4A 5EIYA 1LVWA 1JV1A 2WAWA 2JCLA 2Y4JA 3FWWA 4EEAA 2D0JA 1H7FA 1E5KA 2A8UA 5C3AA 3CKJA 1FXJA 4Y7VA 1INIA 4CJBA 5CMHA 1KWSA 1ZI5A 3V0PA 3GUEA 2P72A 3IOHA 3SXCA 2I5EA 2WE9A 5FU0A 3IOJA 2DPWA 2YQHA 1O7OA 1PZYB 3LW6A 2FYAA 4FRMA 2Q4JA 1G3LA 1GWWA 4BQHA 1H5SD 2X5SA 4JISA
chains in the Genus database with same CATH superfamily
4FRLA 2AGDA 1NWGB 1WT1A 2FYDB 1ZHJA 4HO4A 5FTSA 3PKQA 3PNNA 1ZDGA 1LZIA 3BCVA 1JVGA 2ICXA 2ZU9A 4HOCA 3SX3A 1S4NA 4LW6A 2Y4MA 2W0WA 3USRA 3SX7A 5C4CA 4FRHA 1V84A 1ZCYA 1FO8A 3SXEA 4FCEA 4EE4A 5I1FA 1HM0A 3Q7UA 4B2XA 5FTVA 1YP4A 1ZDFA 2RJ4A 3Q80A 4YS8A 3QVBA 2XWLA 1YROB 2AE7A 2V0HA 3HL3A 3SXAA 2X65A 3JTJA 4O6NA 4AYLA 3BRKX 5C4EA 3V90A 2AH9A 3V0OA 4FIXA 2J0BA 3JUJA 1ON6A 1R80A 4HO9A 5FYEA 3CKQA 5IDTA 1H7LA 1Z90A 3CKVA 1G95A 5IFYA 4D11A 1ON8A 4B2WA 5D92A 1EZIA 3I0IX 2VS4A 4KXOA 4EEOA 3OH4A 1FGXA 1ZI4A 2E3DA 4KNRA 2GGQA 2AECA 3R2WA 5EJZA 1JV3A 2FY7A 1HM9A 3RMVA 5C1LA 4FROA 1IIMA 3I0CA 5C47A 1H5TB 1ZI3A 1R81A 2YQCA 3OKRA 4HO2A 2FYBA 3U2TA 2O1FA 5D91A 1ZJ3A 5J49A 1XHBA 1JYLA 3I0FA 4HCQA 1MP4A 4HO8A 1WSZA 1PZTA 4P00A 1ZJOA 4G87A 3U2XA 1OMXA 1ZCVA 2RJ7A 3TZTA 5C36A 2YC3A 4CJ8A 4CJCA 3RMWA 2YQSA 4IRPA 2WVMA 4Y7FA 3E25A 3JUKA 3USQA 4IRQA 2RJ0A 2FFUA 3SX8A 2QKXA 4R7PA 2UX8A 1H5RA 3U2VA 1S4OA 1GQCA 1MC3A 3V0MA 2XWMA 5BXCA 1HV9A 3D8VA 2PA4A 4FRPA 3T7MA 1ZIZA 1OQMB 1H5SA 3O3PA 1GQ9A 1VZTA 3POLA 2A8WA 1FWYA 3FOQA 3I0KA 4Y64A 1NF5B 1WT0A 3T7NA 1VM8A 4XWIA 1GA8A 2AM5A 2RJ9A 4FCUA 2AM3A 2BO4A 5AJNA 1GX4A 3NGWA 4L41C 1INJA 2V0IA 2E8BA 5CQPA 3IOIA 5CMJA 1LZ0A 4D48A 3KIAA 3F1YA 4CVHA 3I0DA 4LW3A 3I0JA 4Y6NA 3DK5A 3OC9A 1MP3A 1ZI1A 4ECMA 2W0VA 3TQDA 5CMIA 4FRBA 1ZJ2A 3I0GA 4JD0A 1H7QA 4FRDA 1FO9A 4BMAA 1WT2A 4EE5A 4J18A 4Y63A 4KC1A 2OI7A 4ASYA 4G3QA 2BO6A 2YQJA 1GX0A 4DE7A 1FOAA 2XMHA 3V0LA 3ZLKA 2JCOA 1LL2A 1ZJPA 1O0RA 3ZGGA 2X60A 1VGZA 4B4BA 4NALA 1K4VA 2RIXA 1QGQA 2XMEA 4E1KA 5C8RA 1NKHB 1G1LA 3I0HA 1OMZA 2X5ZA 2RJ6A 2I5KA 3ZF8A 1O23B 2J0AA 3CU0A 2WEEA 3K8EA 3U0XA 1W55A 1LL0A 4KPZA 1H3MA 1ZCTA 1HJLA 4AYJA 1VGTA 2OEFA 2VFZA 4NANA 4AAWA 3V8ZA 2D7RA 5C4BA 3DJ4A 1W57A 2CU2A 2VXMA 4G3SA 3D5NA 5FUHA 2Y4LA 2QH5A 3R3IA 1H4EA 3OH0A 1G2VA 2JCJA 1EYRA 4NAKA 3OGZA 2C0NA 5C48A 1FZWA 1ZJ1A 5L6SA 4M2BA 1IINA 2YESA 1G97A 5HS2A 3SXBA 3F1CA 3U2UA 1JYKA 2Y7AA 4MYBA 3OH2A 3OH3A 4ASJA 5C1HA 3OAMA 1WVCA 4FRQA 5C4FA 5C3DA 2VXLA 2Y4KA 5C3BA 4HO3A 4EEGA 1ZJ0A 1VH3A 2O1GA 1VICA 5CMGX 3I0LA 4C2SA 1H7TA 5IDSA 2JCKA 2ICYA 2OI6A 4Y62A 4EVWA 4KNXA 4NAIA 1NHEB 4O6MA 4KQLA 4B4MA 3V0NA 1NMMB 4Y7GA 1H7GA 1H4CA 5CQMX 3Q4SA 3DUVA 1YP3A 1H5TA 2VSIA 4D11C 1H7HA 1FR9A 2ZU8A 4KC2A 1O7QA 4MIXA 4D0ZA 4EE3A 4HG6A 2AM4A 2PX7A 4K6RA 3CKOA 2PGVA 4Y7TA 3SXGA 1FGGA 1FXOA 1QG8A 4M28A 2VS3A 4GBPA 3E26A 2PGYA 1G93A 3SXDA 4P02A 4DECA 3V8YA 1HM8A 2YCMA 1VGWA 2RIYA 2WVKA 2RJ1A 1QWJA 3U0YA 4MNDA 2D7IA 2P6WA 4Y9XA 2YC5A 3V91A 3CKNA 1VPAA 5DDVA 1TVYA 1I52A 4B42A 2APCA 5CQOA 1R7XA 1G9RA 3K8DA 5CQLX 1R7UA 1GWVA 4Q7CA 4KPXA 2P73A 2VD4A 4UEGA 1FRWA 1VH1A 2V0JA 1SS9A 1LZ7A 4FREA 3T7OA 3N9WA 2Y6PA 4HO6A 1QGSA 1TZFA 5JQQA 2OEGA 5CQNX 1G8OA 1JVDA 2FYCB 2O1HA 5AJPA 4AC3A 2RJ8A 3PKPA 3SX5A 1FR8A 1WT3A 3CGXA 1R7VA 1R7TA 5EJ1A 4Y7UA 1TW1A 1S4PA 5C49A 4EEMA 4D0TA 3ST8A 3SPTA 1H5SC 3ZGFA 2AESA 1LL3A 1ZCUA 4DDZA 4M4KA 5FV9A 2BO8A 1NQIB 1FG5N 5C1GA 2VSHA 4FRAA 4G3PA 4FQWA 2QGIA 2WVLA 5AJOA 2XWNA 2RITA 1H7EA 2RIZA 3RSBA 1V83A 3EE5A 2Z86A 2MZBA 2V0KA 3V0QA 1TW5A 1R7YA 3ZLLA 4HO0A 2NXVA 4B4GA 5L6VA 1XZ6A 1YP2A 2VS5A 4KRVA 3U2WA 1W77A 2ZU7A 1LZJA 1H5RB 5C4DA 2OI5A 1H5SB 2RJ5A 4B3UA 1V82A 4Y6UA 4HO5A 2WGZA 4M2AA 1G23A 2GGOA 5FU8A 1H4DA 1VZXA 5DDTA 4B5BA 1VGUA 3D98A 4ZDQA 4FIYA 4ARWA 3OH1A 1HJJA 1MP5A 3I0EA 2FFVA 5CMFX 1R82A 1G0RA 1VZUA 2I7BA 2Z87A 4KT7A 5C38A 2BO7A 2V0LA 4KC4A 5EIYA 1LVWA 1JV1A 2WAWA 2JCLA 2Y4JA 3FWWA 4EEAA 2D0JA 1H7FA 1E5KA 2A8UA 5C3AA 3CKJA 1FXJA 4Y7VA 1INIA 4CJBA 5CMHA 1KWSA 1ZI5A 3V0PA 3GUEA 2P72A 3IOHA 3SXCA 2I5EA 2WE9A 5FU0A 3IOJA 2DPWA 2YQHA 1O7OA 1PZYB 3LW6A 2FYAA 4FRMA 2Q4JA 1G3LA 1GWWA 4BQHA 2VK9A 1H5SD 2X5SA 4JISA
chains in the Genus database with same CATH topology
4FRLA 2AGDA 1NWGB 1WT1A 2FYDB 1ZHJA 4HO4A 5FTSA 3PKQA 3PNNA 1ZDGA 1LZIA 3BCVA 1JVGA 2ICXA 2ZU9A 4HOCA 3SX3A 1S4NA 4LW6A 2Y4MA 2W0WA 3USRA 3SX7A 5C4CA 4FRHA 1V84A 1ZCYA 1FO8A 3SXEA 4FCEA 4EE4A 5I1FA 1HM0A 3Q7UA 4B2XA 5FTVA 1YP4A 1ZDFA 2RJ4A 3Q80A 4YS8A 3QVBA 2XWLA 1YROB 2AE7A 2V0HA 3HL3A 3SXAA 2X65A 3JTJA 4O6NA 4AYLA 3BRKX 5C4EA 3V90A 2AH9A 3V0OA 4FIXA 2J0BA 3JUJA 1ON6A 1R80A 4HO9A 5FYEA 3CKQA 5IDTA 1H7LA 1Z90A 3CKVA 1G95A 5IFYA 4D11A 1ON8A 4B2WA 5D92A 1EZIA 3I0IX 2VS4A 4KXOA 4EEOA 3OH4A 1FGXA 1ZI4A 2E3DA 4KNRA 2GGQA 2AECA 3R2WA 5EJZA 1JV3A 2FY7A 1HM9A 3RMVA 5C1LA 4FROA 1IIMA 3I0CA 5C47A 1H5TB 1ZI3A 1R81A 2YQCA 3OKRA 4HO2A 2FYBA 3U2TA 2O1FA 5D91A 1ZJ3A 5J49A 1XHBA 1JYLA 3I0FA 4HCQA 1MP4A 4HO8A 1WSZA 1PZTA 4P00A 1ZJOA 4G87A 3U2XA 1OMXA 1ZCVA 2RJ7A 3TZTA 5C36A 2YC3A 4CJ8A 4CJCA 3RMWA 2YQSA 4IRPA 2WVMA 4Y7FA 3E25A 3JUKA 3USQA 4IRQA 2RJ0A 2FFUA 3SX8A 2QKXA 4R7PA 2UX8A 1H5RA 3U2VA 1S4OA 1GQCA 1MC3A 3V0MA 2XWMA 5BXCA 1HV9A 3D8VA 2PA4A 4FRPA 3T7MA 1ZIZA 1OQMB 1H5SA 3O3PA 1GQ9A 1VZTA 3POLA 2A8WA 1FWYA 3FOQA 3I0KA 4Y64A 1NF5B 1WT0A 3T7NA 1VM8A 4XWIA 1GA8A 2AM5A 2RJ9A 4FCUA 2AM3A 2BO4A 5AJNA 1GX4A 3NGWA 4L41C 1INJA 2V0IA 2E8BA 5CQPA 3IOIA 5CMJA 1LZ0A 4D48A 3KIAA 3F1YA 4CVHA 3I0DA 4LW3A 3I0JA 4Y6NA 3DK5A 3OC9A 1MP3A 1ZI1A 4ECMA 2W0VA 3TQDA 5CMIA 4FRBA 1ZJ2A 3I0GA 4JD0A 1H7QA 4FRDA 1FO9A 4BMAA 1WT2A 4EE5A 4J18A 4Y63A 4KC1A 2OI7A 4ASYA 4G3QA 2BO6A 2YQJA 1GX0A 4DE7A 1FOAA 2XMHA 3V0LA 3ZLKA 2JCOA 1LL2A 1ZJPA 1O0RA 3ZGGA 2X60A 1VGZA 4B4BA 4NALA 1K4VA 2RIXA 1QGQA 2XMEA 4E1KA 5C8RA 1NKHB 1G1LA 3I0HA 1OMZA 2X5ZA 2RJ6A 2I5KA 3ZF8A 1O23B 2J0AA 3CU0A 2WEEA 3K8EA 3U0XA 1W55A 1LL0A 4KPZA 1H3MA 1ZCTA 1HJLA 4AYJA 1VGTA 2OEFA 2VFZA 4NANA 4AAWA 3V8ZA 2D7RA 5C4BA 3DJ4A 1W57A 2CU2A 2VXMA 4G3SA 3D5NA 5FUHA 2Y4LA 2QH5A 3R3IA 1H4EA 3OH0A 1G2VA 2JCJA 1EYRA 4NAKA 3OGZA 2C0NA 5C48A 1FZWA 1ZJ1A 5L6SA 4M2BA 1IINA 2YESA 1G97A 5HS2A 3SXBA 3F1CA 3U2UA 1JYKA 2Y7AA 4MYBA 3OH2A 3OH3A 4ASJA 5C1HA 3OAMA 1WVCA 4FRQA 5C4FA 5C3DA 2VXLA 2Y4KA 5C3BA 4HO3A 4EEGA 1ZJ0A 1VH3A 2O1GA 1VICA 5CMGX 3I0LA 4C2SA 1H7TA 5IDSA 2JCKA 2ICYA 2OI6A 4Y62A 4EVWA 4KNXA 4NAIA 1NHEB 4O6MA 4KQLA 4B4MA 3V0NA 1NMMB 4Y7GA 1H7GA 1H4CA 5CQMX 3Q4SA 3DUVA 1YP3A 1H5TA 2VSIA 4D11C 1H7HA 1FR9A 2ZU8A 4KC2A 1O7QA 4MIXA 4D0ZA 4EE3A 4HG6A 2AM4A 2PX7A 4K6RA 3CKOA 2PGVA 4Y7TA 3SXGA 1FGGA 1FXOA 1QG8A 4M28A 2VS3A 4GBPA 3E26A 2PGYA 1G93A 3SXDA 4P02A 4DECA 3V8YA 1HM8A 2YCMA 1VGWA 2RIYA 2WVKA 2RJ1A 1QWJA 3U0YA 4MNDA 2D7IA 2P6WA 4Y9XA 2YC5A 3V91A 3CKNA 1VPAA 5DDVA 1TVYA 1I52A 4B42A 2APCA 5CQOA 1R7XA 1G9RA 3K8DA 5CQLX 1R7UA 1GWVA 4Q7CA 4KPXA 2P73A 2VD4A 4UEGA 1FRWA 1VH1A 2V0JA 1SS9A 1LZ7A 4FREA 3T7OA 3N9WA 2Y6PA 4HO6A 1QGSA 1TZFA 5JQQA 2OEGA 5CQNX 1G8OA 1JVDA 2FYCB 2O1HA 5AJPA 4AC3A 2RJ8A 3PKPA 3SX5A 1FR8A 1WT3A 3CGXA 1R7VA 1R7TA 5EJ1A 4Y7UA 1TW1A 1S4PA 5C49A 4EEMA 4D0TA 3ST8A 3SPTA 1H5SC 3ZGFA 2AESA 1LL3A 1ZCUA 4DDZA 4M4KA 5FV9A 2BO8A 1NQIB 1FG5N 5C1GA 2VSHA 4FRAA 4G3PA 4FQWA 2QGIA 2WVLA 5AJOA 2XWNA 2RITA 1H7EA 2RIZA 3RSBA 1V83A 3EE5A 2Z86A 2MZBA 2V0KA 3V0QA 1TW5A 1R7YA 3ZLLA 4HO0A 2NXVA 4B4GA 5L6VA 1XZ6A 1YP2A 2VS5A 4KRVA 3U2WA 1W77A 2ZU7A 1LZJA 1H5RB 5C4DA 2OI5A 1H5SB 2RJ5A 4B3UA 1V82A 4Y6UA 4HO5A 2WGZA 4M2AA 1G23A 2GGOA 5FU8A 1H4DA 1VZXA 5DDTA 4B5BA 1VGUA 3D98A 4ZDQA 4FIYA 4ARWA 3OH1A 1HJJA 1MP5A 3I0EA 2FFVA 5CMFX 1R82A 1G0RA 1VZUA 2I7BA 2Z87A 4KT7A 5C38A 2BO7A 2V0LA 4KC4A 5EIYA 1LVWA 1JV1A 2WAWA 2JCLA 2Y4JA 3FWWA 4EEAA 2D0JA 1H7FA 1E5KA 2A8UA 5C3AA 3CKJA 1FXJA 4Y7VA 1INIA 4CJBA 5CMHA 1KWSA 1ZI5A 3V0PA 3GUEA 2P72A 3IOHA 3SXCA 2I5EA 2WE9A 5FU0A 3IOJA 2DPWA 2YQHA 1O7OA 1PZYB 3LW6A 2FYAA 4FRMA 2Q4JA 1G3LA 1GWWA 4BQHA 2VK9A 1H5SD 2X5SA 4JISA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4FRL A;  2AGD A;  1NWG B;  1WT1 A;  2FYD B;  1ZHJ A;  4HO4 A;  5FTS A;  3PKQ A;  3PNN A;  1ZDG A;  1LZI A;  3BCV A;  1JVG A;  2ICX A;  2ZU9 A;  4HOC A;  3SX3 A;  1S4N A;  4LW6 A;  2Y4M A;  2W0W A;  3USR A;  3SX7 A;  5C4C A;  4FRH A;  1V84 A;  1ZCY A;  1FO8 A;  3SXE A;  4FCE A;  4EE4 A;  5I1F A;  1HM0 A;  3Q7U A;  4B2X A;  5FTV A;  1YP4 A;  1ZDF A;  2RJ4 A;  3Q80 A;  4YS8 A;  3QVB A;  2XWL A;  1YRO B;  2AE7 A;  2V0H A;  3HL3 A;  3SXA A;  2X65 A;  3JTJ A;  4AYL A;  3BRK X;  5C4E A;  3V90 A;  2AH9 A;  3V0O A;  3JUJ A;  1ON6 A;  1R80 A;  4HO9 A;  5FYE A;  3CKQ A;  5IDT A;  1H7L A;  1Z90 A;  3CKV A;  1G95 A;  5IFY A;  4D11 A;  1ON8 A;  4B2W A;  1EZI A;  3I0I X;  2VS4 A;  4KXO A;  4EEO A;  3OH4 A;  1FGX A;  1ZI4 A;  2E3D A;  4KNR A;  2GGQ A;  2AEC A;  3R2W A;  5EJZ A;  1JV3 A;  2FY7 A;  1HM9 A;  3RMV A;  5C1L A;  4FRO A;  1IIM A;  3I0C A;  5C47 A;  1H5T B;  1ZI3 A;  1R81 A;  2YQC A;  3OKR A;  4HO2 A;  2FYB A;  3U2T A;  2O1F A;  1ZJ3 A;  5J49 A;  1XHB A;  1JYL A;  3I0F A;  4HCQ A;  1MP4 A;  4HO8 A;  1WSZ A;  1PZT A;  4P00 A;  1ZJO A;  4G87 A;  3U2X A;  1OMX A;  1ZCV A;  2RJ7 A;  3TZT A;  5C36 A;  2YC3 A;  4CJ8 A;  4CJC A;  3RMW A;  2YQS A;  4IRP A;  2WVM A;  4Y7F A;  3E25 A;  3JUK A;  3USQ A;  4IRQ A;  2RJ0 A;  2FFU A;  3SX8 A;  2QKX A;  4R7P A;  2UX8 A;  1H5R A;  3U2V A;  1S4O A;  1GQC A;  1MC3 A;  3V0M A;  2XWM A;  5BXC A;  1HV9 A;  3D8V A;  2PA4 A;  4FRP A;  3T7M A;  1ZIZ A;  1OQM B;  1H5S A;  3O3P A;  1GQ9 A;  1VZT A;  3POL A;  2A8W A;  1FWY A;  3FOQ A;  3I0K A;  4Y64 A;  1NF5 B;  1WT0 A;  3T7N A;  1VM8 A;  4XWI A;  1GA8 A;  2AM5 A;  2RJ9 A;  4FCU A;  2AM3 A;  2BO4 A;  5AJN A;  1GX4 A;  3NGW A;  4L41 C;  1INJ A;  2V0I A;  2E8B A;  5CQP A;  3IOI A;  5CMJ A;  1LZ0 A;  4D48 A;  3KIA A;  3F1Y A;  4CVH A;  3I0D A;  4LW3 A;  3I0J A;  4Y6N A;  3DK5 A;  3OC9 A;  1MP3 A;  1ZI1 A;  4ECM A;  2W0V A;  3TQD A;  5CMI A;  4FRB A;  1ZJ2 A;  3I0G A;  4JD0 A;  1H7Q A;  4FRD A;  1FO9 A;  4BMA A;  1WT2 A;  4EE5 A;  4J18 A;  4Y63 A;  4KC1 A;  2OI7 A;  4ASY A;  4G3Q A;  2BO6 A;  2YQJ A;  1GX0 A;  4DE7 A;  1FOA A;  2XMH A;  3V0L A;  3ZLK A;  2JCO A;  1LL2 A;  1ZJP A;  1O0R A;  3ZGG A;  2X60 A;  1VGZ A;  4B4B A;  4NAL A;  1K4V A;  2RIX A;  1QGQ A;  2XME A;  4E1K A;  5C8R A;  1NKH B;  1G1L A;  3I0H A;  1OMZ A;  2X5Z A;  2RJ6 A;  2I5K A;  3ZF8 A;  1O23 B;  3CU0 A;  2WEE A;  3K8E A;  3U0X A;  1W55 A;  1LL0 A;  4KPZ A;  1H3M A;  1ZCT A;  1HJL A;  4AYJ A;  1VGT A;  2OEF A;  2VFZ A;  4NAN A;  4AAW A;  3V8Z A;  2D7R A;  5C4B A;  3DJ4 A;  1W57 A;  2CU2 A;  2VXM A;  4G3S A;  3D5N A;  5FUH A;  2Y4L A;  2QH5 A;  3R3I A;  1H4E A;  3OH0 A;  1G2V A;  2JCJ A;  1EYR A;  4NAK A;  3OGZ A;  5C48 A;  1FZW A;  1ZJ1 A;  5L6S A;  4M2B A;  1IIN A;  2YES A;  1G97 A;  5HS2 A;  3SXB A;  3F1C A;  3U2U A;  1JYK A;  2Y7A A;  4MYB A;  3OH2 A;  3OH3 A;  4ASJ A;  5C1H A;  3OAM A;  1WVC A;  4FRQ A;  5C4F A;  5C3D A;  2VXL A;  2Y4K A;  5C3B A;  4HO3 A;  4EEG A;  1ZJ0 A;  1VH3 A;  2O1G A;  1VIC A;  5CMG X;  3I0L A;  4C2S A;  1H7T A;  5IDS A;  2JCK A;  2ICY A;  2OI6 A;  4Y62 A;  4EVW A;  4KNX A;  4NAI A;  1NHE B;  4B4M A;  4KQL A;  3V0N A;  1NMM B;  4Y7G A;  1H7G A;  1H4C A;  5CQM X;  3Q4S A;  3DUV A;  1YP3 A;  1H5T A;  2VSI A;  4D11 C;  1H7H A;  1FR9 A;  2ZU8 A;  4KC2 A;  1O7Q A;  4D0Z A;  4EE3 A;  4HG6 A;  2AM4 A;  2PX7 A;  4K6R A;  3CKO A;  2PGV A;  4Y7T A;  3SXG A;  1FGG A;  1FXO A;  1QG8 A;  4M28 A;  2VS3 A;  4GBP A;  3E26 A;  2PGY A;  1G93 A;  3SXD A;  4P02 A;  4DEC A;  3V8Y A;  1HM8 A;  2YCM A;  1VGW A;  2RIY A;  2WVK A;  2RJ1 A;  1QWJ A;  3U0Y A;  4MND A;  2D7I A;  2P6W A;  4Y9X A;  2YC5 A;  3V91 A;  3CKN A;  1VPA A;  5DDV A;  1TVY A;  1I52 A;  4B42 A;  2APC A;  5CQO A;  1R7X A;  1G9R A;  3K8D A;  5CQL X;  1R7U A;  1GWV A;  4KPX A;  2P73 A;  2VD4 A;  4UEG A;  1FRW A;  1VH1 A;  2V0J A;  1SS9 A;  1LZ7 A;  4FRE A;  3T7O A;  3N9W A;  2Y6P A;  4HO6 A;  1QGS A;  1TZF A;  5JQQ A;  2OEG A;  5CQN X;  1G8O A;  1JVD A;  2FYC B;  2O1H A;  5AJP A;  4AC3 A;  2RJ8 A;  3PKP A;  3SX5 A;  1FR8 A;  1WT3 A;  3CGX A;  1R7V A;  1R7T A;  5EJ1 A;  4Y7U A;  1TW1 A;  1S4P A;  5C49 A;  4EEM A;  4D0T A;  3ST8 A;  3SPT A;  1H5S C;  3ZGF A;  2AES A;  1LL3 A;  1ZCU A;  4DDZ A;  4M4K A;  5FV9 A;  2BO8 A;  1NQI B;  1FG5 N;  5C1G A;  2VSH A;  4FRA A;  4G3P A;  4FQW A;  2QGI A;  2WVL A;  5AJO A;  2XWN A;  2RIT A;  1H7E A;  2RIZ A;  3RSB A;  1V83 A;  3EE5 A;  2Z86 A;  2MZB A;  2V0K A;  3V0Q A;  1TW5 A;  1R7Y A;  3ZLL A;  4HO0 A;  2NXV A;  4B4G A;  5L6V A;  1XZ6 A;  1YP2 A;  2VS5 A;  4KRV A;  3U2W A;  1W77 A;  2ZU7 A;  1LZJ A;  1H5R B;  5C4D A;  2OI5 A;  1H5S B;  2RJ5 A;  4B3U A;  1V82 A;  4Y6U A;  4HO5 A;  2WGZ A;  4M2A A;  1G23 A;  2GGO A;  5FU8 A;  1H4D A;  1VZX A;  5DDT A;  4B5B A;  1VGU A;  3D98 A;  4ZDQ A;  4ARW A;  3OH1 A;  1HJJ A;  1MP5 A;  3I0E A;  2FFV A;  5CMF X;  1R82 A;  1G0R A;  1VZU A;  2I7B A;  2Z87 A;  4KT7 A;  5C38 A;  2BO7 A;  2V0L A;  4KC4 A;  5EIY A;  1LVW A;  1JV1 A;  2WAW A;  2JCL A;  2Y4J A;  3FWW A;  4EEA A;  2D0J A;  1H7F A;  1E5K A;  2A8U A;  5C3A A;  3CKJ A;  1FXJ A;  4Y7V A;  1INI A;  4CJB A;  5CMH A;  1KWS A;  1ZI5 A;  3V0P A;  3GUE A;  2P72 A;  3IOH A;  3SXC A;  2I5E A;  2WE9 A;  5FU0 A;  3IOJ A;  2DPW A;  2YQH A;  1O7O A;  1PZY B;  3LW6 A;  2FYA A;  4FRM A;  2Q4J A;  1G3L A;  1GWW A;  4BQH A;  1H5S D;  2X5S A;  4JIS A; 
#chains in the Genus database with same CATH topology
 4FRL A;  2AGD A;  1NWG B;  1WT1 A;  2FYD B;  1ZHJ A;  4HO4 A;  5FTS A;  3PKQ A;  3PNN A;  1ZDG A;  1LZI A;  3BCV A;  1JVG A;  2ICX A;  2ZU9 A;  4HOC A;  3SX3 A;  1S4N A;  4LW6 A;  2Y4M A;  2W0W A;  3USR A;  3SX7 A;  5C4C A;  4FRH A;  1V84 A;  1ZCY A;  1FO8 A;  3SXE A;  4FCE A;  4EE4 A;  5I1F A;  1HM0 A;  3Q7U A;  4B2X A;  5FTV A;  1YP4 A;  1ZDF A;  2RJ4 A;  3Q80 A;  4YS8 A;  3QVB A;  2XWL A;  1YRO B;  2AE7 A;  2V0H A;  3HL3 A;  3SXA A;  2X65 A;  3JTJ A;  4O6N A;  4AYL A;  3BRK X;  5C4E A;  3V90 A;  2AH9 A;  3V0O A;  4FIX A;  2J0B A;  3JUJ A;  1ON6 A;  1R80 A;  4HO9 A;  5FYE A;  3CKQ A;  5IDT A;  1H7L A;  1Z90 A;  3CKV A;  1G95 A;  5IFY A;  4D11 A;  1ON8 A;  4B2W A;  5D92 A;  1EZI A;  3I0I X;  2VS4 A;  4KXO A;  4EEO A;  3OH4 A;  1FGX A;  1ZI4 A;  2E3D A;  4KNR A;  2GGQ A;  2AEC A;  3R2W A;  5EJZ A;  1JV3 A;  2FY7 A;  1HM9 A;  3RMV A;  5C1L A;  4FRO A;  1IIM A;  3I0C A;  5C47 A;  1H5T B;  1ZI3 A;  1R81 A;  2YQC A;  3OKR A;  4HO2 A;  2FYB A;  3U2T A;  2O1F A;  5D91 A;  1ZJ3 A;  5J49 A;  1XHB A;  1JYL A;  3I0F A;  4HCQ A;  1MP4 A;  4HO8 A;  1WSZ A;  1PZT A;  4P00 A;  1ZJO A;  4G87 A;  3U2X A;  1OMX A;  1ZCV A;  2RJ7 A;  3TZT A;  5C36 A;  2YC3 A;  4CJ8 A;  4CJC A;  3RMW A;  2YQS A;  4IRP A;  2WVM A;  4Y7F A;  3E25 A;  3JUK A;  3USQ A;  4IRQ A;  2RJ0 A;  2FFU A;  3SX8 A;  2QKX A;  4R7P A;  2UX8 A;  1H5R A;  3U2V A;  1S4O A;  1GQC A;  1MC3 A;  3V0M A;  2XWM A;  5BXC A;  1HV9 A;  3D8V A;  2PA4 A;  4FRP A;  3T7M A;  1ZIZ A;  1OQM B;  1H5S A;  3O3P A;  1GQ9 A;  1VZT A;  3POL A;  2A8W A;  1FWY A;  3FOQ A;  3I0K A;  4Y64 A;  1NF5 B;  1WT0 A;  3T7N A;  1VM8 A;  4XWI A;  1GA8 A;  2AM5 A;  2RJ9 A;  4FCU A;  2AM3 A;  2BO4 A;  5AJN A;  1GX4 A;  3NGW A;  4L41 C;  1INJ A;  2V0I A;  2E8B A;  5CQP A;  3IOI A;  5CMJ A;  1LZ0 A;  4D48 A;  3KIA A;  3F1Y A;  4CVH A;  3I0D A;  4LW3 A;  3I0J A;  4Y6N A;  3DK5 A;  3OC9 A;  1MP3 A;  1ZI1 A;  4ECM A;  2W0V A;  3TQD A;  5CMI A;  4FRB A;  1ZJ2 A;  3I0G A;  4JD0 A;  1H7Q A;  4FRD A;  1FO9 A;  4BMA A;  1WT2 A;  4EE5 A;  4J18 A;  4Y63 A;  4KC1 A;  2OI7 A;  4ASY A;  4G3Q A;  2BO6 A;  2YQJ A;  1GX0 A;  4DE7 A;  1FOA A;  2XMH A;  3V0L A;  3ZLK A;  2JCO A;  1LL2 A;  1ZJP A;  1O0R A;  3ZGG A;  2X60 A;  1VGZ A;  4B4B A;  4NAL A;  1K4V A;  2RIX A;  1QGQ A;  2XME A;  4E1K A;  5C8R A;  1NKH B;  1G1L A;  3I0H A;  1OMZ A;  2X5Z A;  2RJ6 A;  2I5K A;  3ZF8 A;  1O23 B;  2J0A A;  3CU0 A;  2WEE A;  3K8E A;  3U0X A;  1W55 A;  1LL0 A;  4KPZ A;  1H3M A;  1ZCT A;  1HJL A;  4AYJ A;  1VGT A;  2OEF A;  2VFZ A;  4NAN A;  4AAW A;  3V8Z A;  2D7R A;  5C4B A;  3DJ4 A;  1W57 A;  2CU2 A;  2VXM A;  4G3S A;  3D5N A;  5FUH A;  2Y4L A;  2QH5 A;  3R3I A;  1H4E A;  3OH0 A;  1G2V A;  2JCJ A;  1EYR A;  4NAK A;  3OGZ A;  2C0N A;  5C48 A;  1FZW A;  1ZJ1 A;  5L6S A;  4M2B A;  1IIN A;  2YES A;  1G97 A;  5HS2 A;  3SXB A;  3F1C A;  3U2U A;  1JYK A;  2Y7A A;  4MYB A;  3OH2 A;  3OH3 A;  4ASJ A;  5C1H A;  3OAM A;  1WVC A;  4FRQ A;  5C4F A;  5C3D A;  2VXL A;  2Y4K A;  5C3B A;  4HO3 A;  4EEG A;  1ZJ0 A;  1VH3 A;  2O1G A;  1VIC A;  5CMG X;  3I0L A;  4C2S A;  1H7T A;  5IDS A;  2JCK A;  2ICY A;  2OI6 A;  4Y62 A;  4EVW A;  4KNX A;  4NAI A;  1NHE B;  4O6M A;  4KQL A;  4B4M A;  3V0N A;  1NMM B;  4Y7G A;  1H7G A;  1H4C A;  5CQM X;  3Q4S A;  3DUV A;  1YP3 A;  1H5T A;  2VSI A;  4D11 C;  1H7H A;  1FR9 A;  2ZU8 A;  4KC2 A;  1O7Q A;  4MIX A;  4D0Z A;  4EE3 A;  4HG6 A;  2AM4 A;  2PX7 A;  4K6R A;  3CKO A;  2PGV A;  4Y7T A;  3SXG A;  1FGG A;  1FXO A;  1QG8 A;  4M28 A;  2VS3 A;  4GBP A;  3E26 A;  2PGY A;  1G93 A;  3SXD A;  4P02 A;  4DEC A;  3V8Y A;  1HM8 A;  2YCM A;  1VGW A;  2RIY A;  2WVK A;  2RJ1 A;  1QWJ A;  3U0Y A;  4MND A;  2D7I A;  2P6W A;  4Y9X A;  2YC5 A;  3V91 A;  3CKN A;  1VPA A;  5DDV A;  1TVY A;  1I52 A;  4B42 A;  2APC A;  5CQO A;  1R7X A;  1G9R A;  3K8D A;  5CQL X;  1R7U A;  1GWV A;  4Q7C A;  4KPX A;  2P73 A;  2VD4 A;  4UEG A;  1FRW A;  1VH1 A;  2V0J A;  1SS9 A;  1LZ7 A;  4FRE A;  3T7O A;  3N9W A;  2Y6P A;  4HO6 A;  1QGS A;  1TZF A;  5JQQ A;  2OEG A;  5CQN X;  1G8O A;  1JVD A;  2FYC B;  2O1H A;  5AJP A;  4AC3 A;  2RJ8 A;  3PKP A;  3SX5 A;  1FR8 A;  1WT3 A;  3CGX A;  1R7V A;  1R7T A;  5EJ1 A;  4Y7U A;  1TW1 A;  1S4P A;  5C49 A;  4EEM A;  4D0T A;  3ST8 A;  3SPT A;  1H5S C;  3ZGF A;  2AES A;  1LL3 A;  1ZCU A;  4DDZ A;  4M4K A;  5FV9 A;  2BO8 A;  1NQI B;  1FG5 N;  5C1G A;  2VSH A;  4FRA A;  4G3P A;  4FQW A;  2QGI A;  2WVL A;  5AJO A;  2XWN A;  2RIT A;  1H7E A;  2RIZ A;  3RSB A;  1V83 A;  3EE5 A;  2Z86 A;  2MZB A;  2V0K A;  3V0Q A;  1TW5 A;  1R7Y A;  3ZLL A;  4HO0 A;  2NXV A;  4B4G A;  5L6V A;  1XZ6 A;  1YP2 A;  2VS5 A;  4KRV A;  3U2W A;  1W77 A;  2ZU7 A;  1LZJ A;  1H5R B;  5C4D A;  2OI5 A;  1H5S B;  2RJ5 A;  4B3U A;  1V82 A;  4Y6U A;  4HO5 A;  2WGZ A;  4M2A A;  1G23 A;  2GGO A;  5FU8 A;  1H4D A;  1VZX A;  5DDT A;  4B5B A;  1VGU A;  3D98 A;  4ZDQ A;  4FIY A;  4ARW A;  3OH1 A;  1HJJ A;  1MP5 A;  3I0E A;  2FFV A;  5CMF X;  1R82 A;  1G0R A;  1VZU A;  2I7B A;  2Z87 A;  4KT7 A;  5C38 A;  2BO7 A;  2V0L A;  4KC4 A;  5EIY A;  1LVW A;  1JV1 A;  2WAW A;  2JCL A;  2Y4J A;  3FWW A;  4EEA A;  2D0J A;  1H7F A;  1E5K A;  2A8U A;  5C3A A;  3CKJ A;  1FXJ A;  4Y7V A;  1INI A;  4CJB A;  5CMH A;  1KWS A;  1ZI5 A;  3V0P A;  3GUE A;  2P72 A;  3IOH A;  3SXC A;  2I5E A;  2WE9 A;  5FU0 A;  3IOJ A;  2DPW A;  2YQH A;  1O7O A;  1PZY B;  3LW6 A;  2FYA A;  4FRM A;  2Q4J A;  1G3L A;  1GWW A;  4BQH A;  2VK9 A;  1H5S D;  2X5S A;  4JIS A; 
#chains in the Genus database with same CATH homology
 4FRL A;  2AGD A;  1NWG B;  1WT1 A;  2FYD B;  1ZHJ A;  4HO4 A;  5FTS A;  3PKQ A;  3PNN A;  1ZDG A;  1LZI A;  3BCV A;  1JVG A;  2ICX A;  2ZU9 A;  4HOC A;  3SX3 A;  1S4N A;  4LW6 A;  2Y4M A;  2W0W A;  3USR A;  3SX7 A;  5C4C A;  4FRH A;  1V84 A;  1ZCY A;  1FO8 A;  3SXE A;  4FCE A;  4EE4 A;  5I1F A;  1HM0 A;  3Q7U A;  4B2X A;  5FTV A;  1YP4 A;  1ZDF A;  2RJ4 A;  3Q80 A;  4YS8 A;  3QVB A;  2XWL A;  1YRO B;  2AE7 A;  2V0H A;  3HL3 A;  3SXA A;  2X65 A;  3JTJ A;  4O6N A;  4AYL A;  3BRK X;  5C4E A;  3V90 A;  2AH9 A;  3V0O A;  4FIX A;  2J0B A;  3JUJ A;  1ON6 A;  1R80 A;  4HO9 A;  5FYE A;  3CKQ A;  5IDT A;  1H7L A;  1Z90 A;  3CKV A;  1G95 A;  5IFY A;  4D11 A;  1ON8 A;  4B2W A;  5D92 A;  1EZI A;  3I0I X;  2VS4 A;  4KXO A;  4EEO A;  3OH4 A;  1FGX A;  1ZI4 A;  2E3D A;  4KNR A;  2GGQ A;  2AEC A;  3R2W A;  5EJZ A;  1JV3 A;  2FY7 A;  1HM9 A;  3RMV A;  5C1L A;  4FRO A;  1IIM A;  3I0C A;  5C47 A;  1H5T B;  1ZI3 A;  1R81 A;  2YQC A;  3OKR A;  4HO2 A;  2FYB A;  3U2T A;  2O1F A;  5D91 A;  1ZJ3 A;  5J49 A;  1XHB A;  1JYL A;  3I0F A;  4HCQ A;  1MP4 A;  4HO8 A;  1WSZ A;  1PZT A;  4P00 A;  1ZJO A;  4G87 A;  3U2X A;  1OMX A;  1ZCV A;  2RJ7 A;  3TZT A;  5C36 A;  2YC3 A;  4CJ8 A;  4CJC A;  3RMW A;  2YQS A;  4IRP A;  2WVM A;  4Y7F A;  3E25 A;  3JUK A;  3USQ A;  4IRQ A;  2RJ0 A;  2FFU A;  3SX8 A;  2QKX A;  4R7P A;  2UX8 A;  1H5R A;  3U2V A;  1S4O A;  1GQC A;  1MC3 A;  3V0M A;  2XWM A;  5BXC A;  1HV9 A;  3D8V A;  2PA4 A;  4FRP A;  3T7M A;  1ZIZ A;  1OQM B;  1H5S A;  3O3P A;  1GQ9 A;  1VZT A;  3POL A;  2A8W A;  1FWY A;  3FOQ A;  3I0K A;  4Y64 A;  1NF5 B;  1WT0 A;  3T7N A;  1VM8 A;  4XWI A;  1GA8 A;  2AM5 A;  2RJ9 A;  4FCU A;  2AM3 A;  2BO4 A;  5AJN A;  1GX4 A;  3NGW A;  4L41 C;  1INJ A;  2V0I A;  2E8B A;  5CQP A;  3IOI A;  5CMJ A;  1LZ0 A;  4D48 A;  3KIA A;  3F1Y A;  4CVH A;  3I0D A;  4LW3 A;  3I0J A;  4Y6N A;  3DK5 A;  3OC9 A;  1MP3 A;  1ZI1 A;  4ECM A;  2W0V A;  3TQD A;  5CMI A;  4FRB A;  1ZJ2 A;  3I0G A;  4JD0 A;  1H7Q A;  4FRD A;  1FO9 A;  4BMA A;  1WT2 A;  4EE5 A;  4J18 A;  4Y63 A;  4KC1 A;  2OI7 A;  4ASY A;  4G3Q A;  2BO6 A;  2YQJ A;  1GX0 A;  4DE7 A;  1FOA A;  2XMH A;  3V0L A;  3ZLK A;  2JCO A;  1LL2 A;  1ZJP A;  1O0R A;  3ZGG A;  2X60 A;  1VGZ A;  4B4B A;  4NAL A;  1K4V A;  2RIX A;  1QGQ A;  2XME A;  4E1K A;  5C8R A;  1NKH B;  1G1L A;  3I0H A;  1OMZ A;  2X5Z A;  2RJ6 A;  2I5K A;  3ZF8 A;  1O23 B;  2J0A A;  3CU0 A;  2WEE A;  3K8E A;  3U0X A;  1W55 A;  1LL0 A;  4KPZ A;  1H3M A;  1ZCT A;  1HJL A;  4AYJ A;  1VGT A;  2OEF A;  2VFZ A;  4NAN A;  4AAW A;  3V8Z A;  2D7R A;  5C4B A;  3DJ4 A;  1W57 A;  2CU2 A;  2VXM A;  4G3S A;  3D5N A;  5FUH A;  2Y4L A;  2QH5 A;  3R3I A;  1H4E A;  3OH0 A;  1G2V A;  2JCJ A;  1EYR A;  4NAK A;  3OGZ A;  2C0N A;  5C48 A;  1FZW A;  1ZJ1 A;  5L6S A;  4M2B A;  1IIN A;  2YES A;  1G97 A;  5HS2 A;  3SXB A;  3F1C A;  3U2U A;  1JYK A;  2Y7A A;  4MYB A;  3OH2 A;  3OH3 A;  4ASJ A;  5C1H A;  3OAM A;  1WVC A;  4FRQ A;  5C4F A;  5C3D A;  2VXL A;  2Y4K A;  5C3B A;  4HO3 A;  4EEG A;  1ZJ0 A;  1VH3 A;  2O1G A;  1VIC A;  5CMG X;  3I0L A;  4C2S A;  1H7T A;  5IDS A;  2JCK A;  2ICY A;  2OI6 A;  4Y62 A;  4EVW A;  4KNX A;  4NAI A;  1NHE B;  4O6M A;  4KQL A;  4B4M A;  3V0N A;  1NMM B;  4Y7G A;  1H7G A;  1H4C A;  5CQM X;  3Q4S A;  3DUV A;  1YP3 A;  1H5T A;  2VSI A;  4D11 C;  1H7H A;  1FR9 A;  2ZU8 A;  4KC2 A;  1O7Q A;  4MIX A;  4D0Z A;  4EE3 A;  4HG6 A;  2AM4 A;  2PX7 A;  4K6R A;  3CKO A;  2PGV A;  4Y7T A;  3SXG A;  1FGG A;  1FXO A;  1QG8 A;  4M28 A;  2VS3 A;  4GBP A;  3E26 A;  2PGY A;  1G93 A;  3SXD A;  4P02 A;  4DEC A;  3V8Y A;  1HM8 A;  2YCM A;  1VGW A;  2RIY A;  2WVK A;  2RJ1 A;  1QWJ A;  3U0Y A;  4MND A;  2D7I A;  2P6W A;  4Y9X A;  2YC5 A;  3V91 A;  3CKN A;  1VPA A;  5DDV A;  1TVY A;  1I52 A;  4B42 A;  2APC A;  5CQO A;  1R7X A;  1G9R A;  3K8D A;  5CQL X;  1R7U A;  1GWV A;  4Q7C A;  4KPX A;  2P73 A;  2VD4 A;  4UEG A;  1FRW A;  1VH1 A;  2V0J A;  1SS9 A;  1LZ7 A;  4FRE A;  3T7O A;  3N9W A;  2Y6P A;  4HO6 A;  1QGS A;  1TZF A;  5JQQ A;  2OEG A;  5CQN X;  1G8O A;  1JVD A;  2FYC B;  2O1H A;  5AJP A;  4AC3 A;  2RJ8 A;  3PKP A;  3SX5 A;  1FR8 A;  1WT3 A;  3CGX A;  1R7V A;  1R7T A;  5EJ1 A;  4Y7U A;  1TW1 A;  1S4P A;  5C49 A;  4EEM A;  4D0T A;  3ST8 A;  3SPT A;  1H5S C;  3ZGF A;  2AES A;  1LL3 A;  1ZCU A;  4DDZ A;  4M4K A;  5FV9 A;  2BO8 A;  1NQI B;  1FG5 N;  5C1G A;  2VSH A;  4FRA A;  4G3P A;  4FQW A;  2QGI A;  2WVL A;  5AJO A;  2XWN A;  2RIT A;  1H7E A;  2RIZ A;  3RSB A;  1V83 A;  3EE5 A;  2Z86 A;  2MZB A;  2V0K A;  3V0Q A;  1TW5 A;  1R7Y A;  3ZLL A;  4HO0 A;  2NXV A;  4B4G A;  5L6V A;  1XZ6 A;  1YP2 A;  2VS5 A;  4KRV A;  3U2W A;  1W77 A;  2ZU7 A;  1LZJ A;  1H5R B;  5C4D A;  2OI5 A;  1H5S B;  2RJ5 A;  4B3U A;  1V82 A;  4Y6U A;  4HO5 A;  2WGZ A;  4M2A A;  1G23 A;  2GGO A;  5FU8 A;  1H4D A;  1VZX A;  5DDT A;  4B5B A;  1VGU A;  3D98 A;  4ZDQ A;  4FIY A;  4ARW A;  3OH1 A;  1HJJ A;  1MP5 A;  3I0E A;  2FFV A;  5CMF X;  1R82 A;  1G0R A;  1VZU A;  2I7B A;  2Z87 A;  4KT7 A;  5C38 A;  2BO7 A;  2V0L A;  4KC4 A;  5EIY A;  1LVW A;  1JV1 A;  2WAW A;  2JCL A;  2Y4J A;  3FWW A;  4EEA A;  2D0J A;  1H7F A;  1E5K A;  2A8U A;  5C3A A;  3CKJ A;  1FXJ A;  4Y7V A;  1INI A;  4CJB A;  5CMH A;  1KWS A;  1ZI5 A;  3V0P A;  3GUE A;  2P72 A;  3IOH A;  3SXC A;  2I5E A;  2WE9 A;  5FU0 A;  3IOJ A;  2DPW A;  2YQH A;  1O7O A;  1PZY B;  3LW6 A;  2FYA A;  4FRM A;  2Q4J A;  1G3L A;  1GWW A;  4BQH A;  2VK9 A;  1H5S D;  2X5S A;  4JIS A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...