1OMZA

Crystal structure of mouse alpha-1,4-n-acetylhexosaminyltransferase (extl2) in complex with udpgalnac
Total Genus 86
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
86
sequence length
265
structure length
253
Chain Sequence
ALDSFTLIMQTYNRTDLLLRLLNHYQAVPSLHKVIVVWNNVGEKGPEELWNSLGPHPIPVIFKPQTANKMRNRLQVFPEVETNAVLMVDDDTLISAQDLVFAFSIWQQFPDQIIGFVPRKHVSTSSGIYSYGGFELQTPGPGNGDQYSMVLIGASFFNSKYLELFQKQPAAVHALIDETQNCDDIAMNFLVTRHTGKPSGIFVKPINMVNLEAEHFLQRSYCINKLVNIYDGMPLKYSNIMISQFGFPYANHK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords Alpha-1,4-N-acetylhexosaminyltransferase EXTL2
publication title Crystal structure of an alpha-1,4-N-acetylhexosaminyltransferase (EXTL2), a member of the exostosin gene family involved in heparan sulfate biosynthesis
pubmed doi rcsb
source organism Mus musculus
total genus 86
structure length 253
sequence length 265
chains with identical sequence B
ec nomenclature ec 2.4.1.223: Glucuronosyl-galactosyl-proteoglycan 4-alpha-N-
pdb deposition date 2003-02-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF09258 Glyco_transf_64 Glycosyl transferase family 64 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.550.10 Alpha Beta Alpha-Beta Complex Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A 1omzA00
4NAIA 1H7GA 1ZJPA 4B2XA 2JCLA 3I0DA 4R7PA 1FOAA 2XWNA 1FO9A 1FGXA 3OH3A 2AE7A 5C4EA 3OKRA 1ZCYA 1JVDA 4NANA 2RIXA 3FOQA 4EE4A 2UX8A 5CQMX 3DK5A 1JV1A 4Y64A 1ZCVA 2YESA 4ZDQA 4D11C 2OI5A 1GQCA 1V83A 1W55A 3EE5A 4HO0A 3CKVA 4C2SA 2PA4A 5CQOA 4E1KA 2XMHA 4MYBA 4Y7UA 4YS8A 2I5KA 3PNNA 1S4PA 4CVHA 1O7OA 4FCUA 3V8YA 2GGOA 4P00A 3U2XA 1WT0A 3V0OA 2YC3A 1H4CA 2PGYA 2VXMA 4FRLA 3RMWA 2AM5A 1H5SC 2I5EA 2X5SA 2RJ7A 5FU0A 4EE3A 1INIA 1ZI3A 4EEMA 4KNRA 5EIYA 1O0RA 1FGGA 1S4NA 2V0LA 3U2WA 4DE7A 2WGZA 1G1LA 2P6WA 2VS4A 1G3LA 2PGVA 1I52A 2Y7AA 1QGQA 4FRDA 1YP2A 4B5BA 1HV9A 5CMHA 3OH0A 4EVWA 3I0GA 4L41C 1O23B 5C8RA 3BCVA 2QKXA 1OQMB 4NALA 4DECA 2AH9A 4B2WA 2RITA 2P72A 1VGUA 3TQDA 3RMVA 2VXLA 3ZGGA 2FY7A 1GQ9A 3POLA 2VFZA 2AESA 2BO7A 1G23A 1V82A 1W57A 4HO6A 3ZLLA 3I0JA 2RJ0A 5AJPA 3V0MA 2JCKA 5C3AA 1FR8A 1LL2A 2FYAA 3I0IX 4HO9A 5DDVA 1H4EA 2QGIA 2RJ4A 3OH1A 1VZTA 3I0CA 4AYJA 5C4CA 2W0WA 3D5NA 4HO3A 4IRPA 1G2VA 2YQHA 3SXEA 1FWYA 1ZDFA 3F1YA 4Y62A 3R2WA 4CJ8A 3SXGA 4KXOA 1LZ7A 1TW1A 1VH3A 2Y4MA 1H5RB 1W77A 2WVLA 2V0HA 1GX0A 5C48A 1R80A 1OMXA 1ZJ1A 2XWMA 3U0YA 3T7NA 2FYBA 2E3DA 1H5RA 2OEFA 2WAWA 2BO8A 3NGWA 3Q4SA 3CU0A 3V0NA 3ST8A 2RJ8A 5CQNX 1ZI1A 1EYRA 4Y9XA 1H5SA 1ZI4A 5CQPA 3V8ZA 2QH5A 2OEGA 1ZJ0A 3OH4A 4Y7GA 1G93A 1JYKA 4BMAA 2FFUA 5I1FA 1V84A 4KC4A 3JTJA 1FR9A 4KC1A 1R82A 1PZTA 4MNDA 4FRPA 5C47A 1IINA 5EJZA 4CJCA 2RJ6A 1H7EA 3R3IA 4KNXA 1H7TA 4ECMA 1NMMB 1ZI5A 2A8WA 2AM4A 3V0PA 1MP4A 4HO5A 3SX3A 1O7QA 2AM3A 1NWGB 2X60A 4B42A 3PKPA 1NKHB 4FQWA 4GBPA 2WVKA 1QWJA 5CMIA 4Y7VA 4FRBA 2W0VA 4FCEA 1QGSA 4ASJA 2FYCB 1S4OA 1JYLA 1HJLA 2RIZA 2P73A 3LW6A 1NHEB 2Y4KA 5C36A 2DPWA 3SX5A 4JD0A 1NF5B 1VH1A 3RSBA 4FRAA 3CKOA 3K8EA 5C4FA 4EEAA 3SXDA 1H5TB 3CKQA 4LW3A 3U2UA 3I0FA 1MP3A 4HO4A 1R7YA 1R7TA 2A8UA 2V0JA 1R81A 5FTSA 4B4BA 4AC3A 2ICXA 1GWVA 3OAMA 1E5KA 1H7HA 2D0JA 4KT7A 4D48A 3IOHA 2VS5A 1INJA 3HL3A 5IDSA 1FXOA 1H5TA 1KWSA 4Y63A 1VZUA 1ZIZA 2VS3A 3CKNA 1TZFA 1JV3A 2Y4LA 2E8BA 3BRKX 1HM9A 1LVWA 4KPZA 4M28A 2O1HA 2O1FA 1ON8A 4HG6A 1G8OA 2YC5A 1EZIA 2BO6A 1LL0A 1TW5A 1GX4A 1GA8A 5CMGX 1GWWA 2ZU9A 2BO4A 3KIAA 3Q7UA 5IFYA 4HOCA 1XHBA 2Z86A 1H4DA 3I0KA 5DDTA 1WT2A 2V0KA 5BXCA 3SX7A 4FRQA 1XZ6A 3U2TA 1HM8A 3IOIA 4NAKA 3USQA 4XWIA 1QG8A 4KRVA 3V0LA 3USRA 5C3BA 2AECA 2WEEA 2X65A 4Y7FA 4Y7TA 3SX8A 3I0LA 2FFVA 2JCOA 2APCA 3ZF8A 5FYEA 2MZBA 4M2BA 4ARWA 2O1GA 1WVCA 5CMJA 5L6SA 3GUEA 3CKJA 2V0IA 1VZXA 2FYDB 2OI7A 3F1CA 2I7BA 5CMFX 3DJ4A 3SXAA 3U0XA 4IRQA 3U2VA 4G3SA 3V0QA 2Y4JA 5IDTA 2YCMA 3ZGFA 3JUKA 1VGTA 1NQIB 2D7RA 5C3DA 2WE9A 3PKQA 3I0EA 4JISA 1H7LA 4FREA 4DDZA 3TZTA 2RJ9A 2YQSA 5AJNA 5FU8A 4EEOA 3Q80A 2NXVA 4BQHA 4AYLA 3SXCA 1MC3A 1HM0A 4KPXA 4B3UA 1H5SD 3N9WA 3V91A 5HS2A 3K8DA 1K4VA 1ZCUA 2D7IA 4G3PA 3FWWA 3SPTA 4FRMA 1MP5A 1Z90A 5C1LA 1ZJ2A 4AAWA 1YROB 1ZCTA 2AGDA 1FO8A 3OC9A 4KC2A 3E25A 1OMZA 2X5ZA 1R7XA 4EEGA 5C38A 4HCQA 2XMEA 1WT3A 3E26A 4D0TA 1FRWA 2PX7A 5CQLX 2Y6PA 4HO2A 2GGQA 3SXBA 1ON6A 1JVGA 4FRHA 1VM8A 4J18A 1TVYA 5FV9A 1G95A 3I0HA 3V90A 5C49A 1FG5N 2CU2A 2RJ1A 4D0ZA 3OH2A 3QVBA 1VGWA 3T7MA 5EJ1A 1LZJA 5FTVA 1HJJA 2VD4A 5FUHA 1H7FA 4Y6UA 2RIYA 1LZIA 4FROA 3T7OA 2OI6A 3CGXA 1VGZA 4B4GA 3DUVA 4B4MA 4KQLA 1G9RA 1PZYB 1YP4A 4CJBA 1H7QA 2ICYA 1G0RA 1R7VA 3O3PA 4Y6NA 2ZU7A 1FXJA 4G3QA 1G97A 4LW6A 1LZ0A 4K6RA 2ZU8A 4ASYA 2YQJA 3D8VA 1YP3A 3OGZA 4UEGA 1R7UA 5L6VA 2WVMA 5C4DA 4M2AA 1ZJ3A 5AJOA 3ZLKA 1ZDGA 1WT1A 2Z87A 5C1HA 2RJ5A 1VPAA 2VSHA 4HO8A 3D98A 1FZWA 5C4BA 1LL3A 5J49A 1IIMA 5C1GA 1VICA 5JQQA 4D11A 1WSZA 4G87A 4M4KA 4EE5A 1ZJOA 2VSIA 2Q4JA 2YQCA 3JUJA 2JCJA 3IOJA 4P02A 1H5SB 1H3MA 1SS9A 1ZHJA 2XWLA
chains in the Genus database with same CATH superfamily
4NAIA 1H7GA 1ZJPA 4B2XA 2JCLA 3I0DA 4R7PA 1FOAA 2XWNA 1FO9A 1FGXA 3OH3A 2AE7A 5C4EA 3OKRA 1ZCYA 1JVDA 5D91A 4NANA 2RIXA 3FOQA 4EE4A 2UX8A 5CQMX 3DK5A 1JV1A 4Y64A 1ZCVA 2YESA 4ZDQA 4D11C 2OI5A 1GQCA 1V83A 1W55A 3EE5A 4HO0A 3CKVA 4C2SA 2PA4A 5CQOA 4E1KA 2XMHA 4MYBA 4Y7UA 4YS8A 2I5KA 3PNNA 1S4PA 4CVHA 1O7OA 4FCUA 3V8YA 2GGOA 4P00A 3U2XA 1WT0A 3V0OA 2YC3A 1H4CA 2PGYA 2VXMA 4FRLA 3RMWA 2AM5A 1H5SC 2I5EA 2X5SA 2RJ7A 5FU0A 4EE3A 1INIA 1ZI3A 4EEMA 4KNRA 5EIYA 1O0RA 1FGGA 1S4NA 2V0LA 3U2WA 4DE7A 2WGZA 1G1LA 2P6WA 2VS4A 1G3LA 2PGVA 1I52A 2Y7AA 1QGQA 4FRDA 1YP2A 4B5BA 1HV9A 5CMHA 3OH0A 4EVWA 3I0GA 4L41C 1O23B 5C8RA 3BCVA 2QKXA 1OQMB 4NALA 4DECA 2AH9A 4B2WA 2RITA 2P72A 1VGUA 3TQDA 3RMVA 2VXLA 3ZGGA 2FY7A 1GQ9A 3POLA 2VFZA 2AESA 2BO7A 1G23A 1V82A 1W57A 4HO6A 3ZLLA 3I0JA 2RJ0A 5AJPA 3V0MA 2JCKA 5C3AA 1FR8A 1LL2A 2FYAA 3I0IX 4HO9A 5DDVA 1H4EA 2QGIA 2RJ4A 3OH1A 1VZTA 3I0CA 4AYJA 5C4CA 2W0WA 3D5NA 4HO3A 4IRPA 1G2VA 2YQHA 3SXEA 1FWYA 1ZDFA 3F1YA 4Y62A 3R2WA 4CJ8A 3SXGA 4KXOA 1LZ7A 1TW1A 1VH3A 2Y4MA 1H5RB 1W77A 2WVLA 2V0HA 1GX0A 5C48A 1R80A 1OMXA 1ZJ1A 2J0BA 2XWMA 3U0YA 3T7NA 2FYBA 2E3DA 1H5RA 2OEFA 2WAWA 2BO8A 3NGWA 3Q4SA 3CU0A 3V0NA 3ST8A 2RJ8A 5CQNX 1ZI1A 1EYRA 4Y9XA 1H5SA 1ZI4A 5CQPA 3V8ZA 2QH5A 2OEGA 1ZJ0A 3OH4A 4Y7GA 1G93A 1JYKA 4BMAA 2FFUA 5I1FA 1V84A 4KC4A 3JTJA 1FR9A 4KC1A 1R82A 1PZTA 4MNDA 4FRPA 5C47A 1IINA 5EJZA 4CJCA 2RJ6A 1H7EA 3R3IA 4KNXA 1H7TA 4ECMA 1NMMB 1ZI5A 2A8WA 2AM4A 3V0PA 1MP4A 4HO5A 3SX3A 1O7QA 2AM3A 1NWGB 2X60A 4B42A 4FIYA 3PKPA 1NKHB 4FQWA 4GBPA 2WVKA 1QWJA 5CMIA 4Y7VA 4FRBA 2W0VA 4FCEA 1QGSA 4ASJA 2FYCB 2VK9A 1S4OA 1JYLA 1HJLA 2RIZA 2P73A 3LW6A 1NHEB 2Y4KA 5C36A 2DPWA 3SX5A 4JD0A 1NF5B 1VH1A 3RSBA 4FRAA 3CKOA 3K8EA 5C4FA 4EEAA 3SXDA 1H5TB 3CKQA 4LW3A 3U2UA 3I0FA 1MP3A 4HO4A 1R7YA 1R7TA 2A8UA 2V0JA 1R81A 5FTSA 4B4BA 4AC3A 2ICXA 1GWVA 3OAMA 1E5KA 1H7HA 2D0JA 4KT7A 4D48A 3IOHA 2VS5A 1INJA 3HL3A 5IDSA 1FXOA 1H5TA 1KWSA 4Y63A 1VZUA 1ZIZA 2VS3A 3CKNA 1TZFA 1JV3A 2Y4LA 2E8BA 3BRKX 1HM9A 1LVWA 4KPZA 4M28A 2O1HA 2O1FA 1ON8A 4HG6A 1G8OA 2YC5A 1EZIA 2BO6A 1LL0A 1TW5A 1GX4A 1GA8A 5CMGX 1GWWA 2ZU9A 2BO4A 3KIAA 3Q7UA 5IFYA 4HOCA 1XHBA 2Z86A 1H4DA 3I0KA 5DDTA 1WT2A 2V0KA 5BXCA 4MIXA 3SX7A 4FRQA 1XZ6A 3U2TA 1HM8A 3IOIA 4NAKA 2J0AA 3USQA 4XWIA 1QG8A 4KRVA 3V0LA 3USRA 5C3BA 2AECA 2WEEA 2X65A 4Y7FA 4Y7TA 3SX8A 3I0LA 2FFVA 2JCOA 2APCA 3ZF8A 5FYEA 2MZBA 4M2BA 4ARWA 2O1GA 1WVCA 5CMJA 5L6SA 3GUEA 3CKJA 2V0IA 1VZXA 2FYDB 2OI7A 3F1CA 2I7BA 5CMFX 3DJ4A 3SXAA 3U0XA 4IRQA 3U2VA 4G3SA 3V0QA 2Y4JA 5IDTA 2YCMA 3ZGFA 3JUKA 1VGTA 1NQIB 2D7RA 5C3DA 2WE9A 3PKQA 3I0EA 4JISA 1H7LA 4FREA 4DDZA 3TZTA 2RJ9A 2YQSA 5AJNA 5D92A 5FU8A 4EEOA 3Q80A 2NXVA 4BQHA 4AYLA 3SXCA 1MC3A 1HM0A 4KPXA 4B3UA 1H5SD 3N9WA 3V91A 5HS2A 3K8DA 1K4VA 1ZCUA 2D7IA 4G3PA 3FWWA 3SPTA 4FRMA 1MP5A 1Z90A 5C1LA 1ZJ2A 4O6MA 4AAWA 1YROB 1ZCTA 2AGDA 1FO8A 3OC9A 4KC2A 3E25A 1OMZA 2X5ZA 1R7XA 4EEGA 5C38A 4HCQA 2XMEA 1WT3A 3E26A 4D0TA 1FRWA 2PX7A 5CQLX 2Y6PA 4Q7CA 4HO2A 2GGQA 3SXBA 1ON6A 1JVGA 4FRHA 1VM8A 4J18A 1TVYA 5FV9A 1G95A 3I0HA 3V90A 5C49A 1FG5N 2CU2A 2RJ1A 4D0ZA 3OH2A 3QVBA 1VGWA 3T7MA 5EJ1A 1LZJA 5FTVA 1HJJA 2VD4A 5FUHA 1H7FA 4Y6UA 2RIYA 1LZIA 4FROA 3T7OA 2OI6A 3CGXA 1VGZA 4B4GA 3DUVA 4B4MA 4KQLA 1G9RA 1PZYB 1YP4A 4CJBA 1H7QA 2ICYA 1G0RA 1R7VA 3O3PA 4Y6NA 2ZU7A 1FXJA 4G3QA 1G97A 4LW6A 1LZ0A 4K6RA 2ZU8A 2C0NA 2YQJA 3D8VA 4ASYA 1YP3A 3OGZA 4UEGA 1R7UA 5L6VA 2WVMA 5C4DA 4M2AA 1ZJ3A 4O6NA 5AJOA 3ZLKA 1ZDGA 1WT1A 2Z87A 5C1HA 2RJ5A 1VPAA 2VSHA 4HO8A 3D98A 1FZWA 5C4BA 1LL3A 5J49A 1IIMA 5C1GA 1VICA 5JQQA 4D11A 1WSZA 4G87A 4M4KA 4FIXA 4EE5A 1ZJOA 2VSIA 2Q4JA 2YQCA 3JUJA 2JCJA 3IOJA 4P02A 1H5SB 1H3MA 1SS9A 1ZHJA 2XWLA
chains in the Genus database with same CATH topology
4NAIA 1H7GA 1ZJPA 4B2XA 2JCLA 3I0DA 4R7PA 1FOAA 2XWNA 1FO9A 1FGXA 3OH3A 2AE7A 5C4EA 3OKRA 1ZCYA 1JVDA 5D91A 4NANA 2RIXA 3FOQA 4EE4A 2UX8A 5CQMX 3DK5A 1JV1A 4Y64A 1ZCVA 2YESA 4ZDQA 4D11C 2OI5A 1GQCA 1V83A 1W55A 3EE5A 4HO0A 3CKVA 4C2SA 2PA4A 5CQOA 4E1KA 2XMHA 4MYBA 4Y7UA 4YS8A 2I5KA 3PNNA 1S4PA 4CVHA 1O7OA 4FCUA 3V8YA 2GGOA 4P00A 3U2XA 1WT0A 3V0OA 2YC3A 1H4CA 2PGYA 2VXMA 4FRLA 3RMWA 2AM5A 1H5SC 2I5EA 2X5SA 2RJ7A 5FU0A 4EE3A 1INIA 1ZI3A 4EEMA 4KNRA 5EIYA 1O0RA 1FGGA 1S4NA 2V0LA 3U2WA 4DE7A 2WGZA 1G1LA 2P6WA 2VS4A 1G3LA 2PGVA 1I52A 2Y7AA 1QGQA 4FRDA 1YP2A 4B5BA 1HV9A 5CMHA 3OH0A 4EVWA 3I0GA 4L41C 1O23B 5C8RA 3BCVA 2QKXA 1OQMB 4NALA 4DECA 2AH9A 4B2WA 2RITA 2P72A 1VGUA 3TQDA 3RMVA 2VXLA 3ZGGA 2FY7A 1GQ9A 3POLA 2VFZA 2AESA 2BO7A 1G23A 1V82A 1W57A 4HO6A 3ZLLA 3I0JA 2RJ0A 5AJPA 3V0MA 2JCKA 5C3AA 1FR8A 1LL2A 2FYAA 3I0IX 4HO9A 5DDVA 1H4EA 2QGIA 2RJ4A 3OH1A 1VZTA 3I0CA 4AYJA 5C4CA 2W0WA 3D5NA 4HO3A 4IRPA 1G2VA 2YQHA 3SXEA 1FWYA 1ZDFA 3F1YA 4Y62A 3R2WA 4CJ8A 3SXGA 4KXOA 1LZ7A 1TW1A 1VH3A 2Y4MA 1H5RB 1W77A 2WVLA 2V0HA 1GX0A 5C48A 1R80A 1OMXA 1ZJ1A 2J0BA 2XWMA 3U0YA 3T7NA 2FYBA 2E3DA 1H5RA 2OEFA 2WAWA 2BO8A 3NGWA 3Q4SA 3CU0A 3V0NA 3ST8A 2RJ8A 5CQNX 1ZI1A 1EYRA 4Y9XA 1H5SA 1ZI4A 5CQPA 3V8ZA 2QH5A 2OEGA 1ZJ0A 3OH4A 4Y7GA 1G93A 1JYKA 4BMAA 2FFUA 5I1FA 1V84A 4KC4A 3JTJA 1FR9A 4KC1A 1R82A 1PZTA 4MNDA 4FRPA 5C47A 1IINA 5EJZA 4CJCA 2RJ6A 1H7EA 3R3IA 4KNXA 1H7TA 4ECMA 1NMMB 1ZI5A 2A8WA 2AM4A 3V0PA 1MP4A 4HO5A 3SX3A 1O7QA 2AM3A 1NWGB 2X60A 4B42A 4FIYA 3PKPA 1NKHB 4FQWA 4GBPA 2WVKA 1QWJA 5CMIA 4Y7VA 4FRBA 2W0VA 4FCEA 1QGSA 4ASJA 2FYCB 2VK9A 1S4OA 1JYLA 1HJLA 2RIZA 2P73A 3LW6A 1NHEB 2Y4KA 5C36A 2DPWA 3SX5A 4JD0A 1NF5B 1VH1A 3RSBA 4FRAA 3CKOA 3K8EA 5C4FA 4EEAA 3SXDA 1H5TB 3CKQA 4LW3A 3U2UA 3I0FA 1MP3A 4HO4A 1R7YA 1R7TA 2A8UA 2V0JA 1R81A 5FTSA 4B4BA 4AC3A 2ICXA 1GWVA 3OAMA 1E5KA 1H7HA 2D0JA 4KT7A 4D48A 3IOHA 2VS5A 1INJA 3HL3A 5IDSA 1FXOA 1H5TA 1KWSA 4Y63A 1VZUA 1ZIZA 2VS3A 3CKNA 1TZFA 1JV3A 2Y4LA 2E8BA 3BRKX 1HM9A 1LVWA 4KPZA 4M28A 2O1HA 2O1FA 1ON8A 4HG6A 1G8OA 2YC5A 1EZIA 2BO6A 1LL0A 1TW5A 1GX4A 1GA8A 5CMGX 1GWWA 2ZU9A 2BO4A 3KIAA 3Q7UA 5IFYA 4HOCA 1XHBA 2Z86A 1H4DA 3I0KA 5DDTA 1WT2A 2V0KA 5BXCA 4MIXA 3SX7A 4FRQA 1XZ6A 3U2TA 1HM8A 3IOIA 4NAKA 2J0AA 3USQA 4XWIA 1QG8A 4KRVA 3V0LA 3USRA 5C3BA 2AECA 2WEEA 2X65A 4Y7FA 4Y7TA 3SX8A 3I0LA 2FFVA 2JCOA 2APCA 3ZF8A 5FYEA 2MZBA 4M2BA 4ARWA 2O1GA 1WVCA 5CMJA 5L6SA 3GUEA 3CKJA 2V0IA 1VZXA 2FYDB 2OI7A 3F1CA 2I7BA 5CMFX 3DJ4A 3SXAA 3U0XA 4IRQA 3U2VA 4G3SA 3V0QA 2Y4JA 5IDTA 2YCMA 3ZGFA 3JUKA 1VGTA 1NQIB 2D7RA 5C3DA 2WE9A 3PKQA 3I0EA 4JISA 1H7LA 4FREA 4DDZA 3TZTA 2RJ9A 2YQSA 5AJNA 5D92A 5FU8A 4EEOA 3Q80A 2NXVA 4BQHA 4AYLA 3SXCA 1MC3A 1HM0A 4KPXA 4B3UA 1H5SD 3N9WA 3V91A 5HS2A 3K8DA 1K4VA 1ZCUA 2D7IA 4G3PA 3FWWA 3SPTA 4FRMA 1MP5A 1Z90A 5C1LA 1ZJ2A 4O6MA 4AAWA 1YROB 1ZCTA 2AGDA 1FO8A 3OC9A 4KC2A 3E25A 1OMZA 2X5ZA 1R7XA 4EEGA 5C38A 4HCQA 2XMEA 1WT3A 3E26A 4D0TA 1FRWA 2PX7A 5CQLX 2Y6PA 4Q7CA 4HO2A 2GGQA 3SXBA 1ON6A 1JVGA 4FRHA 1VM8A 4J18A 1TVYA 5FV9A 1G95A 3I0HA 3V90A 5C49A 1FG5N 2CU2A 2RJ1A 4D0ZA 3OH2A 3QVBA 1VGWA 3T7MA 5EJ1A 1LZJA 5FTVA 1HJJA 2VD4A 5FUHA 1H7FA 4Y6UA 2RIYA 1LZIA 4FROA 3T7OA 2OI6A 3CGXA 1VGZA 4B4GA 3DUVA 4B4MA 4KQLA 1G9RA 1PZYB 1YP4A 4CJBA 1H7QA 2ICYA 1G0RA 1R7VA 3O3PA 4Y6NA 2ZU7A 1FXJA 4G3QA 1G97A 4LW6A 1LZ0A 4K6RA 2ZU8A 2C0NA 2YQJA 3D8VA 4ASYA 1YP3A 3OGZA 4UEGA 1R7UA 5L6VA 2WVMA 5C4DA 4M2AA 1ZJ3A 4O6NA 5AJOA 3ZLKA 1ZDGA 1WT1A 2Z87A 5C1HA 2RJ5A 1VPAA 2VSHA 4HO8A 3D98A 1FZWA 5C4BA 1LL3A 5J49A 1IIMA 5C1GA 1VICA 5JQQA 4D11A 1WSZA 4G87A 4M4KA 4FIXA 4EE5A 1ZJOA 2VSIA 2Q4JA 2YQCA 3JUJA 2JCJA 3IOJA 4P02A 1H5SB 1H3MA 1SS9A 1ZHJA 2XWLA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4NAI A;  1H7G A;  1ZJP A;  4B2X A;  2JCL A;  3I0D A;  4R7P A;  1FOA A;  2XWN A;  1FO9 A;  1FGX A;  3OH3 A;  2AE7 A;  5C4E A;  3OKR A;  1ZCY A;  1JVD A;  4NAN A;  2RIX A;  3FOQ A;  4EE4 A;  2UX8 A;  5CQM X;  3DK5 A;  1JV1 A;  4Y64 A;  1ZCV A;  2YES A;  4ZDQ A;  4D11 C;  2OI5 A;  1GQC A;  1V83 A;  1W55 A;  3EE5 A;  4HO0 A;  3CKV A;  4C2S A;  2PA4 A;  5CQO A;  4E1K A;  2XMH A;  4MYB A;  4Y7U A;  4YS8 A;  2I5K A;  3PNN A;  1S4P A;  4CVH A;  1O7O A;  4FCU A;  3V8Y A;  2GGO A;  4P00 A;  3U2X A;  1WT0 A;  3V0O A;  2YC3 A;  1H4C A;  2PGY A;  2VXM A;  4FRL A;  3RMW A;  2AM5 A;  1H5S C;  2I5E A;  2X5S A;  2RJ7 A;  5FU0 A;  4EE3 A;  1INI A;  1ZI3 A;  4EEM A;  4KNR A;  5EIY A;  1O0R A;  1FGG A;  1S4N A;  2V0L A;  3U2W A;  4DE7 A;  2WGZ A;  1G1L A;  2P6W A;  2VS4 A;  1G3L A;  2PGV A;  1I52 A;  2Y7A A;  1QGQ A;  4FRD A;  1YP2 A;  4B5B A;  1HV9 A;  5CMH A;  3OH0 A;  4EVW A;  3I0G A;  4L41 C;  1O23 B;  5C8R A;  3BCV A;  2QKX A;  1OQM B;  4NAL A;  4DEC A;  2AH9 A;  4B2W A;  2RIT A;  2P72 A;  1VGU A;  3TQD A;  3RMV A;  2VXL A;  3ZGG A;  2FY7 A;  1GQ9 A;  3POL A;  2VFZ A;  2AES A;  2BO7 A;  1G23 A;  1V82 A;  1W57 A;  4HO6 A;  3ZLL A;  3I0J A;  2RJ0 A;  5AJP A;  3V0M A;  2JCK A;  5C3A A;  1FR8 A;  1LL2 A;  2FYA A;  3I0I X;  4HO9 A;  5DDV A;  1H4E A;  2QGI A;  2RJ4 A;  3OH1 A;  1VZT A;  3I0C A;  4AYJ A;  5C4C A;  2W0W A;  3D5N A;  4HO3 A;  4IRP A;  1G2V A;  2YQH A;  3SXE A;  1FWY A;  1ZDF A;  3F1Y A;  4Y62 A;  3R2W A;  4CJ8 A;  3SXG A;  4KXO A;  1LZ7 A;  1TW1 A;  1VH3 A;  2Y4M A;  1H5R B;  1W77 A;  2WVL A;  2V0H A;  1GX0 A;  5C48 A;  1R80 A;  1OMX A;  1ZJ1 A;  2XWM A;  3U0Y A;  3T7N A;  2FYB A;  2E3D A;  1H5R A;  2OEF A;  2WAW A;  2BO8 A;  3NGW A;  3Q4S A;  3CU0 A;  3V0N A;  3ST8 A;  2RJ8 A;  5CQN X;  1ZI1 A;  1EYR A;  4Y9X A;  1H5S A;  1ZI4 A;  5CQP A;  3V8Z A;  2QH5 A;  2OEG A;  1ZJ0 A;  3OH4 A;  4Y7G A;  1G93 A;  1JYK A;  4BMA A;  2FFU A;  5I1F A;  1V84 A;  4KC4 A;  3JTJ A;  1FR9 A;  4KC1 A;  1R82 A;  1PZT A;  4MND A;  4FRP A;  5C47 A;  1IIN A;  5EJZ A;  4CJC A;  2RJ6 A;  1H7E A;  3R3I A;  4KNX A;  1H7T A;  4ECM A;  1NMM B;  1ZI5 A;  2A8W A;  2AM4 A;  3V0P A;  1MP4 A;  4HO5 A;  3SX3 A;  1O7Q A;  2AM3 A;  1NWG B;  2X60 A;  4B42 A;  3PKP A;  1NKH B;  4FQW A;  4GBP A;  2WVK A;  1QWJ A;  5CMI A;  4Y7V A;  4FRB A;  2W0V A;  4FCE A;  1QGS A;  4ASJ A;  2FYC B;  1S4O A;  1JYL A;  1HJL A;  2RIZ A;  2P73 A;  3LW6 A;  1NHE B;  2Y4K A;  5C36 A;  2DPW A;  3SX5 A;  4JD0 A;  1NF5 B;  1VH1 A;  3RSB A;  4FRA A;  3CKO A;  3K8E A;  5C4F A;  4EEA A;  3SXD A;  1H5T B;  3CKQ A;  4LW3 A;  3U2U A;  3I0F A;  1MP3 A;  4HO4 A;  1R7Y A;  1R7T A;  2A8U A;  2V0J A;  1R81 A;  5FTS A;  4B4B A;  4AC3 A;  2ICX A;  1GWV A;  3OAM A;  1E5K A;  1H7H A;  2D0J A;  4KT7 A;  4D48 A;  3IOH A;  2VS5 A;  1INJ A;  3HL3 A;  5IDS A;  1FXO A;  1H5T A;  1KWS A;  4Y63 A;  1VZU A;  1ZIZ A;  2VS3 A;  3CKN A;  1TZF A;  1JV3 A;  2Y4L A;  2E8B A;  3BRK X;  1HM9 A;  1LVW A;  4KPZ A;  4M28 A;  2O1H A;  2O1F A;  1ON8 A;  4HG6 A;  1G8O A;  2YC5 A;  1EZI A;  2BO6 A;  1LL0 A;  1TW5 A;  1GX4 A;  1GA8 A;  5CMG X;  1GWW A;  2ZU9 A;  2BO4 A;  3KIA A;  3Q7U A;  5IFY A;  4HOC A;  1XHB A;  2Z86 A;  1H4D A;  3I0K A;  5DDT A;  1WT2 A;  2V0K A;  5BXC A;  3SX7 A;  4FRQ A;  1XZ6 A;  3U2T A;  1HM8 A;  3IOI A;  4NAK A;  3USQ A;  4XWI A;  1QG8 A;  4KRV A;  3V0L A;  3USR A;  5C3B A;  2AEC A;  2WEE A;  2X65 A;  4Y7F A;  4Y7T A;  3SX8 A;  3I0L A;  2FFV A;  2JCO A;  2APC A;  3ZF8 A;  5FYE A;  2MZB A;  4M2B A;  4ARW A;  2O1G A;  1WVC A;  5CMJ A;  5L6S A;  3GUE A;  3CKJ A;  2V0I A;  1VZX A;  2FYD B;  2OI7 A;  3F1C A;  2I7B A;  5CMF X;  3DJ4 A;  3SXA A;  3U0X A;  4IRQ A;  3U2V A;  4G3S A;  3V0Q A;  2Y4J A;  5IDT A;  2YCM A;  3ZGF A;  3JUK A;  1VGT A;  1NQI B;  2D7R A;  5C3D A;  2WE9 A;  3PKQ A;  3I0E A;  4JIS A;  1H7L A;  4FRE A;  4DDZ A;  3TZT A;  2RJ9 A;  2YQS A;  5AJN A;  5FU8 A;  4EEO A;  3Q80 A;  2NXV A;  4BQH A;  4AYL A;  3SXC A;  1MC3 A;  1HM0 A;  4KPX A;  4B3U A;  1H5S D;  3N9W A;  3V91 A;  5HS2 A;  3K8D A;  1K4V A;  1ZCU A;  2D7I A;  4G3P A;  3FWW A;  3SPT A;  4FRM A;  1MP5 A;  1Z90 A;  5C1L A;  1ZJ2 A;  4AAW A;  1YRO B;  1ZCT A;  2AGD A;  1FO8 A;  3OC9 A;  4KC2 A;  3E25 A;  1OMZ A;  2X5Z A;  1R7X A;  4EEG A;  5C38 A;  4HCQ A;  2XME A;  1WT3 A;  3E26 A;  4D0T A;  1FRW A;  2PX7 A;  5CQL X;  2Y6P A;  4HO2 A;  2GGQ A;  3SXB A;  1ON6 A;  1JVG A;  4FRH A;  1VM8 A;  4J18 A;  1TVY A;  5FV9 A;  1G95 A;  3I0H A;  3V90 A;  5C49 A;  1FG5 N;  2CU2 A;  2RJ1 A;  4D0Z A;  3OH2 A;  3QVB A;  1VGW A;  3T7M A;  5EJ1 A;  1LZJ A;  5FTV A;  1HJJ A;  2VD4 A;  5FUH A;  1H7F A;  4Y6U A;  2RIY A;  1LZI A;  4FRO A;  3T7O A;  2OI6 A;  3CGX A;  1VGZ A;  4B4G A;  3DUV A;  4B4M A;  4KQL A;  1G9R A;  1PZY B;  1YP4 A;  4CJB A;  1H7Q A;  2ICY A;  1G0R A;  1R7V A;  3O3P A;  4Y6N A;  2ZU7 A;  1FXJ A;  4G3Q A;  1G97 A;  4LW6 A;  1LZ0 A;  4K6R A;  2ZU8 A;  4ASY A;  2YQJ A;  3D8V A;  1YP3 A;  3OGZ A;  4UEG A;  1R7U A;  5L6V A;  2WVM A;  5C4D A;  4M2A A;  1ZJ3 A;  5AJO A;  3ZLK A;  1ZDG A;  1WT1 A;  2Z87 A;  5C1H A;  2RJ5 A;  1VPA A;  2VSH A;  4HO8 A;  3D98 A;  1FZW A;  5C4B A;  1LL3 A;  5J49 A;  1IIM A;  5C1G A;  1VIC A;  5JQQ A;  4D11 A;  1WSZ A;  4G87 A;  4M4K A;  4EE5 A;  1ZJO A;  2VSI A;  2Q4J A;  2YQC A;  3JUJ A;  2JCJ A;  3IOJ A;  4P02 A;  1H5S B;  1H3M A;  1SS9 A;  1ZHJ A;  2XWL A; 
#chains in the Genus database with same CATH topology
 4NAI A;  1H7G A;  1ZJP A;  4B2X A;  2JCL A;  3I0D A;  4R7P A;  1FOA A;  2XWN A;  1FO9 A;  1FGX A;  3OH3 A;  2AE7 A;  5C4E A;  3OKR A;  1ZCY A;  1JVD A;  5D91 A;  4NAN A;  2RIX A;  3FOQ A;  4EE4 A;  2UX8 A;  5CQM X;  3DK5 A;  1JV1 A;  4Y64 A;  1ZCV A;  2YES A;  4ZDQ A;  4D11 C;  2OI5 A;  1GQC A;  1V83 A;  1W55 A;  3EE5 A;  4HO0 A;  3CKV A;  4C2S A;  2PA4 A;  5CQO A;  4E1K A;  2XMH A;  4MYB A;  4Y7U A;  4YS8 A;  2I5K A;  3PNN A;  1S4P A;  4CVH A;  1O7O A;  4FCU A;  3V8Y A;  2GGO A;  4P00 A;  3U2X A;  1WT0 A;  3V0O A;  2YC3 A;  1H4C A;  2PGY A;  2VXM A;  4FRL A;  3RMW A;  2AM5 A;  1H5S C;  2I5E A;  2X5S A;  2RJ7 A;  5FU0 A;  4EE3 A;  1INI A;  1ZI3 A;  4EEM A;  4KNR A;  5EIY A;  1O0R A;  1FGG A;  1S4N A;  2V0L A;  3U2W A;  4DE7 A;  2WGZ A;  1G1L A;  2P6W A;  2VS4 A;  1G3L A;  2PGV A;  1I52 A;  2Y7A A;  1QGQ A;  4FRD A;  1YP2 A;  4B5B A;  1HV9 A;  5CMH A;  3OH0 A;  4EVW A;  3I0G A;  4L41 C;  1O23 B;  5C8R A;  3BCV A;  2QKX A;  1OQM B;  4NAL A;  4DEC A;  2AH9 A;  4B2W A;  2RIT A;  2P72 A;  1VGU A;  3TQD A;  3RMV A;  2VXL A;  3ZGG A;  2FY7 A;  1GQ9 A;  3POL A;  2VFZ A;  2AES A;  2BO7 A;  1G23 A;  1V82 A;  1W57 A;  4HO6 A;  3ZLL A;  3I0J A;  2RJ0 A;  5AJP A;  3V0M A;  2JCK A;  5C3A A;  1FR8 A;  1LL2 A;  2FYA A;  3I0I X;  4HO9 A;  5DDV A;  1H4E A;  2QGI A;  2RJ4 A;  3OH1 A;  1VZT A;  3I0C A;  4AYJ A;  5C4C A;  2W0W A;  3D5N A;  4HO3 A;  4IRP A;  1G2V A;  2YQH A;  3SXE A;  1FWY A;  1ZDF A;  3F1Y A;  4Y62 A;  3R2W A;  4CJ8 A;  3SXG A;  4KXO A;  1LZ7 A;  1TW1 A;  1VH3 A;  2Y4M A;  1H5R B;  1W77 A;  2WVL A;  2V0H A;  1GX0 A;  5C48 A;  1R80 A;  1OMX A;  1ZJ1 A;  2J0B A;  2XWM A;  3U0Y A;  3T7N A;  2FYB A;  2E3D A;  1H5R A;  2OEF A;  2WAW A;  2BO8 A;  3NGW A;  3Q4S A;  3CU0 A;  3V0N A;  3ST8 A;  2RJ8 A;  5CQN X;  1ZI1 A;  1EYR A;  4Y9X A;  1H5S A;  1ZI4 A;  5CQP A;  3V8Z A;  2QH5 A;  2OEG A;  1ZJ0 A;  3OH4 A;  4Y7G A;  1G93 A;  1JYK A;  4BMA A;  2FFU A;  5I1F A;  1V84 A;  4KC4 A;  3JTJ A;  1FR9 A;  4KC1 A;  1R82 A;  1PZT A;  4MND A;  4FRP A;  5C47 A;  1IIN A;  5EJZ A;  4CJC A;  2RJ6 A;  1H7E A;  3R3I A;  4KNX A;  1H7T A;  4ECM A;  1NMM B;  1ZI5 A;  2A8W A;  2AM4 A;  3V0P A;  1MP4 A;  4HO5 A;  3SX3 A;  1O7Q A;  2AM3 A;  1NWG B;  2X60 A;  4B42 A;  4FIY A;  3PKP A;  1NKH B;  4FQW A;  4GBP A;  2WVK A;  1QWJ A;  5CMI A;  4Y7V A;  4FRB A;  2W0V A;  4FCE A;  1QGS A;  4ASJ A;  2FYC B;  2VK9 A;  1S4O A;  1JYL A;  1HJL A;  2RIZ A;  2P73 A;  3LW6 A;  1NHE B;  2Y4K A;  5C36 A;  2DPW A;  3SX5 A;  4JD0 A;  1NF5 B;  1VH1 A;  3RSB A;  4FRA A;  3CKO A;  3K8E A;  5C4F A;  4EEA A;  3SXD A;  1H5T B;  3CKQ A;  4LW3 A;  3U2U A;  3I0F A;  1MP3 A;  4HO4 A;  1R7Y A;  1R7T A;  2A8U A;  2V0J A;  1R81 A;  5FTS A;  4B4B A;  4AC3 A;  2ICX A;  1GWV A;  3OAM A;  1E5K A;  1H7H A;  2D0J A;  4KT7 A;  4D48 A;  3IOH A;  2VS5 A;  1INJ A;  3HL3 A;  5IDS A;  1FXO A;  1H5T A;  1KWS A;  4Y63 A;  1VZU A;  1ZIZ A;  2VS3 A;  3CKN A;  1TZF A;  1JV3 A;  2Y4L A;  2E8B A;  3BRK X;  1HM9 A;  1LVW A;  4KPZ A;  4M28 A;  2O1H A;  2O1F A;  1ON8 A;  4HG6 A;  1G8O A;  2YC5 A;  1EZI A;  2BO6 A;  1LL0 A;  1TW5 A;  1GX4 A;  1GA8 A;  5CMG X;  1GWW A;  2ZU9 A;  2BO4 A;  3KIA A;  3Q7U A;  5IFY A;  4HOC A;  1XHB A;  2Z86 A;  1H4D A;  3I0K A;  5DDT A;  1WT2 A;  2V0K A;  5BXC A;  4MIX A;  3SX7 A;  4FRQ A;  1XZ6 A;  3U2T A;  1HM8 A;  3IOI A;  4NAK A;  2J0A A;  3USQ A;  4XWI A;  1QG8 A;  4KRV A;  3V0L A;  3USR A;  5C3B A;  2AEC A;  2WEE A;  2X65 A;  4Y7F A;  4Y7T A;  3SX8 A;  3I0L A;  2FFV A;  2JCO A;  2APC A;  3ZF8 A;  5FYE A;  2MZB A;  4M2B A;  4ARW A;  2O1G A;  1WVC A;  5CMJ A;  5L6S A;  3GUE A;  3CKJ A;  2V0I A;  1VZX A;  2FYD B;  2OI7 A;  3F1C A;  2I7B A;  5CMF X;  3DJ4 A;  3SXA A;  3U0X A;  4IRQ A;  3U2V A;  4G3S A;  3V0Q A;  2Y4J A;  5IDT A;  2YCM A;  3ZGF A;  3JUK A;  1VGT A;  1NQI B;  2D7R A;  5C3D A;  2WE9 A;  3PKQ A;  3I0E A;  4JIS A;  1H7L A;  4FRE A;  4DDZ A;  3TZT A;  2RJ9 A;  2YQS A;  5AJN A;  5D92 A;  5FU8 A;  4EEO A;  3Q80 A;  2NXV A;  4BQH A;  4AYL A;  3SXC A;  1MC3 A;  1HM0 A;  4KPX A;  4B3U A;  1H5S D;  3N9W A;  3V91 A;  5HS2 A;  3K8D A;  1K4V A;  1ZCU A;  2D7I A;  4G3P A;  3FWW A;  3SPT A;  4FRM A;  1MP5 A;  1Z90 A;  5C1L A;  1ZJ2 A;  4O6M A;  4AAW A;  1YRO B;  1ZCT A;  2AGD A;  1FO8 A;  3OC9 A;  4KC2 A;  3E25 A;  1OMZ A;  2X5Z A;  1R7X A;  4EEG A;  5C38 A;  4HCQ A;  2XME A;  1WT3 A;  3E26 A;  4D0T A;  1FRW A;  2PX7 A;  5CQL X;  2Y6P A;  4Q7C A;  4HO2 A;  2GGQ A;  3SXB A;  1ON6 A;  1JVG A;  4FRH A;  1VM8 A;  4J18 A;  1TVY A;  5FV9 A;  1G95 A;  3I0H A;  3V90 A;  5C49 A;  1FG5 N;  2CU2 A;  2RJ1 A;  4D0Z A;  3OH2 A;  3QVB A;  1VGW A;  3T7M A;  5EJ1 A;  1LZJ A;  5FTV A;  1HJJ A;  2VD4 A;  5FUH A;  1H7F A;  4Y6U A;  2RIY A;  1LZI A;  4FRO A;  3T7O A;  2OI6 A;  3CGX A;  1VGZ A;  4B4G A;  3DUV A;  4B4M A;  4KQL A;  1G9R A;  1PZY B;  1YP4 A;  4CJB A;  1H7Q A;  2ICY A;  1G0R A;  1R7V A;  3O3P A;  4Y6N A;  2ZU7 A;  1FXJ A;  4G3Q A;  1G97 A;  4LW6 A;  1LZ0 A;  4K6R A;  2ZU8 A;  2C0N A;  2YQJ A;  3D8V A;  4ASY A;  1YP3 A;  3OGZ A;  4UEG A;  1R7U A;  5L6V A;  2WVM A;  5C4D A;  4M2A A;  1ZJ3 A;  4O6N A;  5AJO A;  3ZLK A;  1ZDG A;  1WT1 A;  2Z87 A;  5C1H A;  2RJ5 A;  1VPA A;  2VSH A;  4HO8 A;  3D98 A;  1FZW A;  5C4B A;  1LL3 A;  5J49 A;  1IIM A;  5C1G A;  1VIC A;  5JQQ A;  4D11 A;  1WSZ A;  4G87 A;  4M4K A;  4FIX A;  4EE5 A;  1ZJO A;  2VSI A;  2Q4J A;  2YQC A;  3JUJ A;  2JCJ A;  3IOJ A;  4P02 A;  1H5S B;  1H3M A;  1SS9 A;  1ZHJ A;  2XWL A; 
#chains in the Genus database with same CATH homology
 4NAI A;  1H7G A;  1ZJP A;  4B2X A;  2JCL A;  3I0D A;  4R7P A;  1FOA A;  2XWN A;  1FO9 A;  1FGX A;  3OH3 A;  2AE7 A;  5C4E A;  3OKR A;  1ZCY A;  1JVD A;  5D91 A;  4NAN A;  2RIX A;  3FOQ A;  4EE4 A;  2UX8 A;  5CQM X;  3DK5 A;  1JV1 A;  4Y64 A;  1ZCV A;  2YES A;  4ZDQ A;  4D11 C;  2OI5 A;  1GQC A;  1V83 A;  1W55 A;  3EE5 A;  4HO0 A;  3CKV A;  4C2S A;  2PA4 A;  5CQO A;  4E1K A;  2XMH A;  4MYB A;  4Y7U A;  4YS8 A;  2I5K A;  3PNN A;  1S4P A;  4CVH A;  1O7O A;  4FCU A;  3V8Y A;  2GGO A;  4P00 A;  3U2X A;  1WT0 A;  3V0O A;  2YC3 A;  1H4C A;  2PGY A;  2VXM A;  4FRL A;  3RMW A;  2AM5 A;  1H5S C;  2I5E A;  2X5S A;  2RJ7 A;  5FU0 A;  4EE3 A;  1INI A;  1ZI3 A;  4EEM A;  4KNR A;  5EIY A;  1O0R A;  1FGG A;  1S4N A;  2V0L A;  3U2W A;  4DE7 A;  2WGZ A;  1G1L A;  2P6W A;  2VS4 A;  1G3L A;  2PGV A;  1I52 A;  2Y7A A;  1QGQ A;  4FRD A;  1YP2 A;  4B5B A;  1HV9 A;  5CMH A;  3OH0 A;  4EVW A;  3I0G A;  4L41 C;  1O23 B;  5C8R A;  3BCV A;  2QKX A;  1OQM B;  4NAL A;  4DEC A;  2AH9 A;  4B2W A;  2RIT A;  2P72 A;  1VGU A;  3TQD A;  3RMV A;  2VXL A;  3ZGG A;  2FY7 A;  1GQ9 A;  3POL A;  2VFZ A;  2AES A;  2BO7 A;  1G23 A;  1V82 A;  1W57 A;  4HO6 A;  3ZLL A;  3I0J A;  2RJ0 A;  5AJP A;  3V0M A;  2JCK A;  5C3A A;  1FR8 A;  1LL2 A;  2FYA A;  3I0I X;  4HO9 A;  5DDV A;  1H4E A;  2QGI A;  2RJ4 A;  3OH1 A;  1VZT A;  3I0C A;  4AYJ A;  5C4C A;  2W0W A;  3D5N A;  4HO3 A;  4IRP A;  1G2V A;  2YQH A;  3SXE A;  1FWY A;  1ZDF A;  3F1Y A;  4Y62 A;  3R2W A;  4CJ8 A;  3SXG A;  4KXO A;  1LZ7 A;  1TW1 A;  1VH3 A;  2Y4M A;  1H5R B;  1W77 A;  2WVL A;  2V0H A;  1GX0 A;  5C48 A;  1R80 A;  1OMX A;  1ZJ1 A;  2J0B A;  2XWM A;  3U0Y A;  3T7N A;  2FYB A;  2E3D A;  1H5R A;  2OEF A;  2WAW A;  2BO8 A;  3NGW A;  3Q4S A;  3CU0 A;  3V0N A;  3ST8 A;  2RJ8 A;  5CQN X;  1ZI1 A;  1EYR A;  4Y9X A;  1H5S A;  1ZI4 A;  5CQP A;  3V8Z A;  2QH5 A;  2OEG A;  1ZJ0 A;  3OH4 A;  4Y7G A;  1G93 A;  1JYK A;  4BMA A;  2FFU A;  5I1F A;  1V84 A;  4KC4 A;  3JTJ A;  1FR9 A;  4KC1 A;  1R82 A;  1PZT A;  4MND A;  4FRP A;  5C47 A;  1IIN A;  5EJZ A;  4CJC A;  2RJ6 A;  1H7E A;  3R3I A;  4KNX A;  1H7T A;  4ECM A;  1NMM B;  1ZI5 A;  2A8W A;  2AM4 A;  3V0P A;  1MP4 A;  4HO5 A;  3SX3 A;  1O7Q A;  2AM3 A;  1NWG B;  2X60 A;  4B42 A;  4FIY A;  3PKP A;  1NKH B;  4FQW A;  4GBP A;  2WVK A;  1QWJ A;  5CMI A;  4Y7V A;  4FRB A;  2W0V A;  4FCE A;  1QGS A;  4ASJ A;  2FYC B;  2VK9 A;  1S4O A;  1JYL A;  1HJL A;  2RIZ A;  2P73 A;  3LW6 A;  1NHE B;  2Y4K A;  5C36 A;  2DPW A;  3SX5 A;  4JD0 A;  1NF5 B;  1VH1 A;  3RSB A;  4FRA A;  3CKO A;  3K8E A;  5C4F A;  4EEA A;  3SXD A;  1H5T B;  3CKQ A;  4LW3 A;  3U2U A;  3I0F A;  1MP3 A;  4HO4 A;  1R7Y A;  1R7T A;  2A8U A;  2V0J A;  1R81 A;  5FTS A;  4B4B A;  4AC3 A;  2ICX A;  1GWV A;  3OAM A;  1E5K A;  1H7H A;  2D0J A;  4KT7 A;  4D48 A;  3IOH A;  2VS5 A;  1INJ A;  3HL3 A;  5IDS A;  1FXO A;  1H5T A;  1KWS A;  4Y63 A;  1VZU A;  1ZIZ A;  2VS3 A;  3CKN A;  1TZF A;  1JV3 A;  2Y4L A;  2E8B A;  3BRK X;  1HM9 A;  1LVW A;  4KPZ A;  4M28 A;  2O1H A;  2O1F A;  1ON8 A;  4HG6 A;  1G8O A;  2YC5 A;  1EZI A;  2BO6 A;  1LL0 A;  1TW5 A;  1GX4 A;  1GA8 A;  5CMG X;  1GWW A;  2ZU9 A;  2BO4 A;  3KIA A;  3Q7U A;  5IFY A;  4HOC A;  1XHB A;  2Z86 A;  1H4D A;  3I0K A;  5DDT A;  1WT2 A;  2V0K A;  5BXC A;  4MIX A;  3SX7 A;  4FRQ A;  1XZ6 A;  3U2T A;  1HM8 A;  3IOI A;  4NAK A;  2J0A A;  3USQ A;  4XWI A;  1QG8 A;  4KRV A;  3V0L A;  3USR A;  5C3B A;  2AEC A;  2WEE A;  2X65 A;  4Y7F A;  4Y7T A;  3SX8 A;  3I0L A;  2FFV A;  2JCO A;  2APC A;  3ZF8 A;  5FYE A;  2MZB A;  4M2B A;  4ARW A;  2O1G A;  1WVC A;  5CMJ A;  5L6S A;  3GUE A;  3CKJ A;  2V0I A;  1VZX A;  2FYD B;  2OI7 A;  3F1C A;  2I7B A;  5CMF X;  3DJ4 A;  3SXA A;  3U0X A;  4IRQ A;  3U2V A;  4G3S A;  3V0Q A;  2Y4J A;  5IDT A;  2YCM A;  3ZGF A;  3JUK A;  1VGT A;  1NQI B;  2D7R A;  5C3D A;  2WE9 A;  3PKQ A;  3I0E A;  4JIS A;  1H7L A;  4FRE A;  4DDZ A;  3TZT A;  2RJ9 A;  2YQS A;  5AJN A;  5D92 A;  5FU8 A;  4EEO A;  3Q80 A;  2NXV A;  4BQH A;  4AYL A;  3SXC A;  1MC3 A;  1HM0 A;  4KPX A;  4B3U A;  1H5S D;  3N9W A;  3V91 A;  5HS2 A;  3K8D A;  1K4V A;  1ZCU A;  2D7I A;  4G3P A;  3FWW A;  3SPT A;  4FRM A;  1MP5 A;  1Z90 A;  5C1L A;  1ZJ2 A;  4O6M A;  4AAW A;  1YRO B;  1ZCT A;  2AGD A;  1FO8 A;  3OC9 A;  4KC2 A;  3E25 A;  1OMZ A;  2X5Z A;  1R7X A;  4EEG A;  5C38 A;  4HCQ A;  2XME A;  1WT3 A;  3E26 A;  4D0T A;  1FRW A;  2PX7 A;  5CQL X;  2Y6P A;  4Q7C A;  4HO2 A;  2GGQ A;  3SXB A;  1ON6 A;  1JVG A;  4FRH A;  1VM8 A;  4J18 A;  1TVY A;  5FV9 A;  1G95 A;  3I0H A;  3V90 A;  5C49 A;  1FG5 N;  2CU2 A;  2RJ1 A;  4D0Z A;  3OH2 A;  3QVB A;  1VGW A;  3T7M A;  5EJ1 A;  1LZJ A;  5FTV A;  1HJJ A;  2VD4 A;  5FUH A;  1H7F A;  4Y6U A;  2RIY A;  1LZI A;  4FRO A;  3T7O A;  2OI6 A;  3CGX A;  1VGZ A;  4B4G A;  3DUV A;  4B4M A;  4KQL A;  1G9R A;  1PZY B;  1YP4 A;  4CJB A;  1H7Q A;  2ICY A;  1G0R A;  1R7V A;  3O3P A;  4Y6N A;  2ZU7 A;  1FXJ A;  4G3Q A;  1G97 A;  4LW6 A;  1LZ0 A;  4K6R A;  2ZU8 A;  2C0N A;  2YQJ A;  3D8V A;  4ASY A;  1YP3 A;  3OGZ A;  4UEG A;  1R7U A;  5L6V A;  2WVM A;  5C4D A;  4M2A A;  1ZJ3 A;  4O6N A;  5AJO A;  3ZLK A;  1ZDG A;  1WT1 A;  2Z87 A;  5C1H A;  2RJ5 A;  1VPA A;  2VSH A;  4HO8 A;  3D98 A;  1FZW A;  5C4B A;  1LL3 A;  5J49 A;  1IIM A;  5C1G A;  1VIC A;  5JQQ A;  4D11 A;  1WSZ A;  4G87 A;  4M4K A;  4FIX A;  4EE5 A;  1ZJO A;  2VSI A;  2Q4J A;  2YQC A;  3JUJ A;  2JCJ A;  3IOJ A;  4P02 A;  1H5S B;  1H3M A;  1SS9 A;  1ZHJ A;  2XWL A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...