2RJ0A

B-specific alpha-1,3-galactosyltransferase g176r mutant + udp+ mn2+
Total Genus 92
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
92
sequence length
284
structure length
281
Chain Sequence
FMVSLPRMVYPQPKVLTPCRKDVLVVTPWLAPIVWEGTFNIDILNEQFRLQNTTIGLTVFAIKKYVAFLKLFLETAEKHFMVGHRVHYYVFTDQPAAVPRVTLGTGRQLSVLEVRRWQDVSMRRMEMISDFCERRFLSEVDYLVCVDVDMEFRDHVGVEILTPLFGTLHPSFYGSSREAFTYERRPQSQAYIPKDEGDFYYMGAFFGGSVQEVQRLTRACHQAMMVDQANGIEAVWHDESHLNKYLLRHKPTKVLSPEYLWDQQLLGWPAVLRKLRFTAVP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords Glycoprotein-fucosylgalactoside alpha-galactosyltransferase
publication title ABO(H) blood group A and B glycosyltransferases recognize substrate via specific conformational changes.
pubmed doi rcsb
source organism Homo sapiens
total genus 92
structure length 281
sequence length 284
ec nomenclature ec 2.4.1.37: Fucosylgalactoside 3-alpha-galactosyltransferase.
pdb deposition date 2007-10-14
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.550.10 Alpha Beta Alpha-Beta Complex Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A 2rj0A00
1WVCA 2ICXA 2YQHA 4KXOA 1EZIA 3D98A 4Y7FA 5AJOA 1FXOA 5FU8A 5L6SA 2O1GA 2RJ4A 4KNXA 4HG6A 4M4KA 1O0RA 3OKRA 4Y64A 1H5SA 3I0JA 4G3SA 4C2SA 5IDTA 3JUJA 4LW3A 3CKVA 4Y6NA 4D11A 1ZJOA 4G87A 1IINA 3NGWA 1ZJ3A 5CQLX 1WT0A 3SXCA 1H7FA 1Z90A 2YQJA 2AM4A 3DJ4A 3I0GA 2PGVA 5CMJA 3SXEA 1G2VA 1JVGA 1R80A 4MNDA 1H7LA 3IOJA 4EEMA 2O1FA 1VM8A 3RMWA 1FXJA 3O3PA 1LVWA 2Z87A 4DE7A 4KNRA 1W55A 3Q4SA 3SXGA 2BO4A 3EE5A 3KIAA 4FRHA 1ZIZA 1WT2A 1LL3A 3JTJA 4FRAA 3ZLKA 4D48A 2FFUA 4EEGA 3E26A 4J18A 2UX8A 2YQCA 3V8ZA 2QGIA 1R7VA 2A8WA 4Y63A 5EIYA 3IOIA 2VXMA 2X5SA 1JV1A 2JCKA 1NMMB 2P73A 3N9WA 3PNNA 1G23A 1H3MA 5C3AA 4D0TA 2V0HA 2X60A 4FRQA 1ZCTA 2OI7A 2X5ZA 3I0FA 1TW1A 1SS9A 3ZGFA 5C1LA 2AH9A 5AJNA 4Y9XA 4NAIA 2ZU7A 4NALA 1ON6A 2XWLA 1O7QA 4B2WA 4CJCA 5CQOA 2I5EA 5C8RA 2Y7AA 3F1YA 5CMIA 4EE4A 4ZDQA 1KWSA 3TQDA 4AAWA 1MP4A 2NXVA 3PKPA 3QVBA 3ZF8A 1FO9A 1V83A 4Y7TA 1O7OA 2BO7A 4CVHA 4HOCA 1ZJ2A 3SXBA 4B4GA 2GGOA 3U2XA 4IRQA 1H5TB 3V0LA 2Q4JA 3OH1A 4MYBA 3CKQA 1FZWA 2RITA 4P02A 3V91A 1VPAA 3I0DA 3CKNA 2WVLA 1GX0A 1V84A 4JISA 1HM9A 1HM8A 2D7IA 2XWMA 4KQLA 1ZJ1A 4FCEA 3K8EA 5BXCA 3SX5A 3E25A 1S4OA 4ASJA 1G9RA 4K6RA 2YCMA 4Y62A 5CMHA 3HL3A 1VH3A 1VGZA 2I7BA 2WAWA 1O23B 2PA4A 1TVYA 2AM3A 2PX7A 1H4DA 2V0KA 4FRLA 3OH2A 1GX4A 1FRWA 4LW6A 2P72A 2VXLA 1LZIA 1FWYA 3V90A 3USQA 2OI6A 1G3LA 5CMFX 1VZXA 3I0CA 3T7MA 4L41C 2VS5A 4D0ZA 1R7YA 1XZ6A 3IOHA 1NKHB 1YP2A 2P6WA 1XHBA 4B2XA 2VS3A 5C4CA 1R7UA 2AESA 2AM5A 1H7TA 4B4BA 1G93A 4M2BA 1FO8A 3RMVA 1MP5A 4HO8A 3OAMA 3BCVA 3T7NA 1ZI1A 3ZLLA 2FYDB 2BO8A 5C4BA 3U0XA 3OH3A 1ZI4A 1LL2A 1GA8A 1H5RA 5CMGX 2WEEA 1HV9A 1IIMA 1EYRA 3D8VA 3LW6A 3SX8A 1ZCYA 4CJBA 1MC3A 2W0VA 4B42A 2Y6PA 2I5KA 1FR9A 1H5SB 3Q7UA 1OQMB 1FR8A 5FTSA 4EE5A 1LZJA 2VSIA 1ZI3A 4HO2A 1VZTA 1MP3A 2GGQA 1NQIB 1ZDGA 4BMAA 2AE7A 5C48A 1HM0A 1R7XA 4M28A 1JYLA 1TW5A 1TZFA 4ARWA 1W57A 3I0IX 1S4NA 1V82A 4EE3A 3U2UA 4XWIA 5FUHA 2RJ9A 2QKXA 5IDSA 5FTVA 3F1CA 2O1HA 1W77A 3OC9A 4AC3A 5C3DA 3U0YA 1R81A 5C4EA 2RIXA 1E5KA 2W0WA 2YQSA 3V0NA 1NHEB 1H7HA 3D5NA 2ZU8A 4CJ8A 4KC2A 3SXAA 1S4PA 1ZDFA 3R2WA 5DDVA 5C1GA 2E8BA 5IFYA 4B5BA 2JCJA 1H4CA 1G95A 3SPTA 1G1LA 1H5SC 1YP3A 4KRVA 1FG5N 3DUVA 1JV3A 1ZI5A 1INJA 5FYEA 2PGYA 3CGXA 4FREA 4D11C 1ZHJA 1INIA 2APCA 4FRBA 2WVMA 1JYKA 2RJ6A 1NWGB 1LL0A 1PZTA 4NANA 4P00A 1NF5B 5CQMX 3ST8A 2Y4LA 1VH1A 1K4VA 2VFZA 2JCOA 4Y6UA 2ZU9A 5EJZA 3GUEA 2XMHA 4GBPA 4HO4A 1PZYB 1QGSA 1VGTA 2RIYA 3ZGGA 4EEOA 3BRKX 3TZTA 2V0IA 3U2VA 3V0MA 5C38A 3V0QA 1FOAA 5L6VA 4HO0A 2Y4KA 5DDTA 3U2WA 2YC5A 3V0PA 2AGDA 3POLA 2MZBA 2QH5A 4DDZA 2BO6A 4FROA 5C1HA 3CKOA 3USRA 2RJ7A 2X65A 1ZJ0A 4KT7A 3V8YA 2RJ0A 3JUKA 5JQQA 1YP4A 1G97A 1I52A 4E1KA 3I0EA 1FGGA 3OH0A 4Y7VA 4EEAA 5HS2A 1VGWA 1ZCVA 3CU0A 4B4MA 4KPXA 4G3PA 1VICA 2JCLA 1H7EA 1G8OA 5C4DA 1ON8A 3V0OA 5C3BA 5EJ1A 1R82A 4KC4A 1VZUA 4Y7GA 4R7PA 5CQNX 4ASYA 1GQCA 3OGZA 2FYCB 1FGXA 1H5SD 1QWJA 1GQ9A 2RJ5A 4Y7UA 4BQHA 3SX3A 4FRPA 3PKQA 2WGZA 3Q80A 2DPWA 1QGQA 3R3IA 5FV9A 3T7OA 4HO3A 2FFVA 1OMXA 5C49A 1QG8A 2VSHA 5FU0A 1H5TA 2A8UA 4NAKA 1JVDA 4EVWA 1H4EA 3SX7A 1GWVA 1HJJA 2OEGA 4ECMA 1ZCUA 2VS4A 2Y4MA 5C47A 1ZJPA 1WSZA 4FRMA 2Y4JA 2D7RA 3FWWA 1H5RB 3OH4A 4IRPA 2WVKA 3CKJA 4M2AA 3U2TA 1H7GA 4UEGA 1HJLA 2OI5A 2E3DA 3I0KA 2ICYA 5AJPA 1GWWA 3K8DA 2Z86A 4KPZA 4HO9A 1OMZA 2D0JA 5C36A 1WT3A 5C4FA 2RIZA 4YS8A 4AYJA 2RJ8A 4AYLA 5I1FA 1G0RA 1LZ7A 2V0JA 1YROB 2XWNA 4DECA 1LZ0A 3SXDA 3I0HA 2YC3A 2FYBA 2CU2A 2XMEA 2VD4A 4B3UA 2OEFA 4HO5A 4FQWA 2AECA 3DK5A 4FCUA 3I0LA 1H7QA 2RJ1A 4FRDA 2V0LA 2FY7A 2YESA 1R7TA 3FOQA 4JD0A 3RSBA 1VGUA 4HCQA 2FYAA 5CQPA 4HO6A 4G3QA 1WT1A 4KC1A 5J49A 2WE9A
chains in the Genus database with same CATH superfamily
1WVCA 2ICXA 2YQHA 4KXOA 1EZIA 3D98A 4Y7FA 5AJOA 1FXOA 5FU8A 5L6SA 2O1GA 2RJ4A 4KNXA 4HG6A 4M4KA 1O0RA 3OKRA 4Y64A 1H5SA 3I0JA 4G3SA 4C2SA 5IDTA 3JUJA 4LW3A 3CKVA 4Y6NA 4D11A 1ZJOA 4G87A 1IINA 3NGWA 1ZJ3A 5CQLX 1WT0A 3SXCA 1H7FA 1Z90A 2YQJA 2AM4A 3DJ4A 3I0GA 2PGVA 5CMJA 3SXEA 1G2VA 1JVGA 1R80A 4MNDA 1H7LA 3IOJA 4EEMA 2O1FA 1VM8A 3RMWA 1FXJA 3O3PA 1LVWA 2Z87A 4DE7A 4KNRA 1W55A 3Q4SA 3SXGA 2BO4A 3EE5A 3KIAA 4FRHA 1ZIZA 1WT2A 1LL3A 2C0NA 3JTJA 4FRAA 3ZLKA 4D48A 2FFUA 4EEGA 3E26A 4J18A 2UX8A 2YQCA 3V8ZA 2QGIA 1R7VA 2A8WA 4Y63A 5EIYA 3IOIA 2VXMA 2X5SA 1JV1A 2JCKA 1NMMB 2P73A 3N9WA 3PNNA 1G23A 1H3MA 5C3AA 4D0TA 2V0HA 2X60A 4FRQA 1ZCTA 2OI7A 2X5ZA 3I0FA 1TW1A 1SS9A 3ZGFA 5C1LA 2AH9A 5AJNA 4Y9XA 4NAIA 2ZU7A 4NALA 1ON6A 2XWLA 1O7QA 4B2WA 4CJCA 5CQOA 2I5EA 5C8RA 2Y7AA 3F1YA 5CMIA 4EE4A 4ZDQA 1KWSA 3TQDA 4AAWA 1MP4A 2NXVA 3PKPA 3QVBA 3ZF8A 1FO9A 1V83A 4Y7TA 1O7OA 2BO7A 4CVHA 4HOCA 1ZJ2A 3SXBA 4B4GA 2GGOA 3U2XA 4IRQA 1H5TB 3V0LA 2Q4JA 3OH1A 4MYBA 3CKQA 1FZWA 2RITA 4O6NA 4P02A 5D92A 3V91A 1VPAA 3I0DA 3CKNA 2WVLA 1GX0A 1V84A 4JISA 1HM9A 1HM8A 2D7IA 2XWMA 4KQLA 1ZJ1A 4FCEA 3K8EA 5BXCA 3SX5A 3E25A 1S4OA 4ASJA 1G9RA 4K6RA 2YCMA 4Y62A 5CMHA 3HL3A 1VH3A 1VGZA 2I7BA 2WAWA 1O23B 4MIXA 2PA4A 1TVYA 2AM3A 2PX7A 4O6MA 1H4DA 2V0KA 4FRLA 3OH2A 1GX4A 1FRWA 4LW6A 2P72A 2VXLA 1LZIA 1FWYA 3V90A 3USQA 2OI6A 1G3LA 5CMFX 1VZXA 3I0CA 3T7MA 4L41C 2VS5A 4D0ZA 1R7YA 1XZ6A 3IOHA 1NKHB 1YP2A 2P6WA 1XHBA 4B2XA 2VS3A 5C4CA 1R7UA 2AESA 2AM5A 1H7TA 4B4BA 1G93A 4M2BA 1FO8A 3RMVA 1MP5A 4HO8A 3OAMA 3BCVA 3T7NA 1ZI1A 3ZLLA 2FYDB 2BO8A 5C4BA 3U0XA 3OH3A 1ZI4A 1LL2A 1GA8A 1H5RA 5CMGX 2WEEA 4Q7CA 1HV9A 1IIMA 1EYRA 3D8VA 3LW6A 3SX8A 1ZCYA 4CJBA 1MC3A 2W0VA 5D91A 4B42A 2Y6PA 2I5KA 1FR9A 1H5SB 3Q7UA 1OQMB 1FR8A 5FTSA 4EE5A 1LZJA 2VSIA 1ZI3A 4HO2A 1VZTA 1MP3A 2GGQA 1NQIB 1ZDGA 4BMAA 2AE7A 5C48A 1HM0A 1R7XA 4M28A 1JYLA 1TW5A 1TZFA 4ARWA 1W57A 3I0IX 1S4NA 1V82A 4EE3A 3U2UA 4XWIA 5FUHA 2RJ9A 2QKXA 5IDSA 5FTVA 3F1CA 2O1HA 1W77A 3OC9A 4AC3A 5C3DA 3U0YA 1R81A 5C4EA 2RIXA 1E5KA 2W0WA 2YQSA 3V0NA 1NHEB 1H7HA 3D5NA 2ZU8A 4CJ8A 4KC2A 3SXAA 1S4PA 1ZDFA 3R2WA 5DDVA 5C1GA 2E8BA 5IFYA 4B5BA 2JCJA 1H4CA 1G95A 3SPTA 1G1LA 1H5SC 1YP3A 4KRVA 1FG5N 2VK9A 3DUVA 1JV3A 1ZI5A 1INJA 5FYEA 2PGYA 3CGXA 4FREA 4D11C 1ZHJA 1INIA 2APCA 4FRBA 2WVMA 1JYKA 2RJ6A 1NWGB 1LL0A 1PZTA 4NANA 4P00A 1NF5B 5CQMX 3ST8A 2Y4LA 1VH1A 1K4VA 2VFZA 2JCOA 4Y6UA 2ZU9A 5EJZA 3GUEA 2XMHA 4GBPA 4HO4A 1PZYB 1QGSA 1VGTA 2RIYA 3ZGGA 4EEOA 3BRKX 3TZTA 2V0IA 3U2VA 3V0MA 5C38A 3V0QA 1FOAA 5L6VA 4HO0A 2Y4KA 5DDTA 3U2WA 2YC5A 4FIXA 3V0PA 2AGDA 3POLA 2MZBA 2QH5A 4DDZA 2BO6A 4FROA 5C1HA 3CKOA 3USRA 2RJ7A 2X65A 1ZJ0A 4KT7A 3V8YA 2RJ0A 3JUKA 5JQQA 1YP4A 1G97A 1I52A 4E1KA 3I0EA 1FGGA 3OH0A 4Y7VA 4EEAA 5HS2A 1VGWA 1ZCVA 3CU0A 4B4MA 4KPXA 4G3PA 4FIYA 1VICA 2JCLA 1H7EA 1G8OA 5C4DA 1ON8A 3V0OA 5C3BA 5EJ1A 2J0AA 1R82A 4KC4A 1VZUA 4Y7GA 4R7PA 5CQNX 4ASYA 1GQCA 3OGZA 2FYCB 1FGXA 1H5SD 1QWJA 1GQ9A 2RJ5A 4Y7UA 4BQHA 3SX3A 4FRPA 3PKQA 2WGZA 3Q80A 2DPWA 1QGQA 3R3IA 5FV9A 3T7OA 4HO3A 2FFVA 1OMXA 5C49A 1QG8A 2VSHA 5FU0A 1H5TA 2A8UA 4NAKA 1JVDA 4EVWA 1H4EA 3SX7A 1GWVA 1HJJA 2OEGA 4ECMA 1ZCUA 2VS4A 2Y4MA 5C47A 1ZJPA 1WSZA 4FRMA 2Y4JA 2D7RA 3FWWA 1H5RB 3OH4A 4IRPA 2WVKA 3CKJA 4M2AA 3U2TA 1H7GA 4UEGA 1HJLA 2OI5A 2E3DA 3I0KA 2ICYA 5AJPA 1GWWA 3K8DA 2Z86A 4KPZA 4HO9A 1OMZA 2D0JA 5C36A 1WT3A 5C4FA 2RIZA 4YS8A 4AYJA 2RJ8A 4AYLA 5I1FA 1G0RA 1LZ7A 2V0JA 1YROB 2J0BA 2XWNA 4DECA 1LZ0A 3SXDA 3I0HA 2YC3A 2FYBA 2CU2A 2XMEA 2VD4A 4B3UA 2OEFA 4HO5A 4FQWA 2AECA 3DK5A 4FCUA 3I0LA 1H7QA 2RJ1A 4FRDA 2V0LA 2FY7A 2YESA 1R7TA 3FOQA 4JD0A 3RSBA 1VGUA 4HCQA 2FYAA 5CQPA 4HO6A 4G3QA 1WT1A 4KC1A 5J49A 2WE9A
chains in the Genus database with same CATH topology
1WVCA 2ICXA 2YQHA 4KXOA 1EZIA 3D98A 4Y7FA 5AJOA 1FXOA 5FU8A 5L6SA 2O1GA 2RJ4A 4KNXA 4HG6A 4M4KA 1O0RA 3OKRA 4Y64A 1H5SA 3I0JA 4G3SA 4C2SA 5IDTA 3JUJA 4LW3A 3CKVA 4Y6NA 4D11A 1ZJOA 4G87A 1IINA 3NGWA 1ZJ3A 5CQLX 1WT0A 3SXCA 1H7FA 1Z90A 2YQJA 2AM4A 3DJ4A 3I0GA 2PGVA 5CMJA 3SXEA 1G2VA 1JVGA 1R80A 4MNDA 1H7LA 3IOJA 4EEMA 2O1FA 1VM8A 3RMWA 1FXJA 3O3PA 1LVWA 2Z87A 4DE7A 4KNRA 1W55A 3Q4SA 3SXGA 2BO4A 3EE5A 3KIAA 4FRHA 1ZIZA 1WT2A 1LL3A 2C0NA 3JTJA 4FRAA 3ZLKA 4D48A 2FFUA 4EEGA 3E26A 4J18A 2UX8A 2YQCA 3V8ZA 2QGIA 1R7VA 2A8WA 4Y63A 5EIYA 3IOIA 2VXMA 2X5SA 1JV1A 2JCKA 1NMMB 2P73A 3N9WA 3PNNA 1G23A 1H3MA 5C3AA 4D0TA 2V0HA 2X60A 4FRQA 1ZCTA 2OI7A 2X5ZA 3I0FA 1TW1A 1SS9A 3ZGFA 5C1LA 2AH9A 5AJNA 4Y9XA 4NAIA 2ZU7A 4NALA 1ON6A 2XWLA 1O7QA 4B2WA 4CJCA 5CQOA 2I5EA 5C8RA 2Y7AA 3F1YA 5CMIA 4EE4A 4ZDQA 1KWSA 3TQDA 4AAWA 1MP4A 2NXVA 3PKPA 3QVBA 3ZF8A 1FO9A 1V83A 4Y7TA 1O7OA 2BO7A 4CVHA 4HOCA 1ZJ2A 3SXBA 4B4GA 2GGOA 3U2XA 4IRQA 1H5TB 3V0LA 2Q4JA 3OH1A 4MYBA 3CKQA 1FZWA 2RITA 4O6NA 4P02A 5D92A 3V91A 1VPAA 3I0DA 3CKNA 2WVLA 1GX0A 1V84A 4JISA 1HM9A 1HM8A 2D7IA 2XWMA 4KQLA 1ZJ1A 4FCEA 3K8EA 5BXCA 3SX5A 3E25A 1S4OA 4ASJA 1G9RA 4K6RA 2YCMA 4Y62A 5CMHA 3HL3A 1VH3A 1VGZA 2I7BA 2WAWA 1O23B 4MIXA 2PA4A 1TVYA 2AM3A 2PX7A 4O6MA 1H4DA 2V0KA 4FRLA 3OH2A 1GX4A 1FRWA 4LW6A 2P72A 2VXLA 1LZIA 1FWYA 3V90A 3USQA 2OI6A 1G3LA 5CMFX 1VZXA 3I0CA 3T7MA 4L41C 2VS5A 4D0ZA 1R7YA 1XZ6A 3IOHA 1NKHB 1YP2A 2P6WA 1XHBA 4B2XA 2VS3A 5C4CA 1R7UA 2AESA 2AM5A 1H7TA 4B4BA 1G93A 4M2BA 1FO8A 3RMVA 1MP5A 4HO8A 3OAMA 3BCVA 3T7NA 1ZI1A 3ZLLA 2FYDB 2BO8A 5C4BA 3U0XA 3OH3A 1ZI4A 1LL2A 1GA8A 1H5RA 5CMGX 2WEEA 4Q7CA 1HV9A 1IIMA 1EYRA 3D8VA 3LW6A 3SX8A 1ZCYA 4CJBA 1MC3A 2W0VA 5D91A 4B42A 2Y6PA 2I5KA 1FR9A 1H5SB 3Q7UA 1OQMB 1FR8A 5FTSA 4EE5A 1LZJA 2VSIA 1ZI3A 4HO2A 1VZTA 1MP3A 2GGQA 1NQIB 1ZDGA 4BMAA 2AE7A 5C48A 1HM0A 1R7XA 4M28A 1JYLA 1TW5A 1TZFA 4ARWA 1W57A 3I0IX 1S4NA 1V82A 4EE3A 3U2UA 4XWIA 5FUHA 2RJ9A 2QKXA 5IDSA 5FTVA 3F1CA 2O1HA 1W77A 3OC9A 4AC3A 5C3DA 3U0YA 1R81A 5C4EA 2RIXA 1E5KA 2W0WA 2YQSA 3V0NA 1NHEB 1H7HA 3D5NA 2ZU8A 4CJ8A 4KC2A 3SXAA 1S4PA 1ZDFA 3R2WA 5DDVA 5C1GA 2E8BA 5IFYA 4B5BA 2JCJA 1H4CA 1G95A 3SPTA 1G1LA 1H5SC 1YP3A 4KRVA 1FG5N 2VK9A 3DUVA 1JV3A 1ZI5A 1INJA 5FYEA 2PGYA 3CGXA 4FREA 4D11C 1ZHJA 1INIA 2APCA 4FRBA 2WVMA 1JYKA 2RJ6A 1NWGB 1LL0A 1PZTA 4NANA 4P00A 1NF5B 5CQMX 3ST8A 2Y4LA 1VH1A 1K4VA 2VFZA 2JCOA 4Y6UA 2ZU9A 5EJZA 3GUEA 2XMHA 4GBPA 4HO4A 1PZYB 1QGSA 1VGTA 2RIYA 3ZGGA 4EEOA 3BRKX 3TZTA 2V0IA 3U2VA 3V0MA 5C38A 3V0QA 1FOAA 5L6VA 4HO0A 2Y4KA 5DDTA 3U2WA 2YC5A 4FIXA 3V0PA 2AGDA 3POLA 2MZBA 2QH5A 4DDZA 2BO6A 4FROA 5C1HA 3CKOA 3USRA 2RJ7A 2X65A 1ZJ0A 4KT7A 3V8YA 2RJ0A 3JUKA 5JQQA 1YP4A 1G97A 1I52A 4E1KA 3I0EA 1FGGA 3OH0A 4Y7VA 4EEAA 5HS2A 1VGWA 1ZCVA 3CU0A 4B4MA 4KPXA 4G3PA 4FIYA 1VICA 2JCLA 1H7EA 1G8OA 5C4DA 1ON8A 3V0OA 5C3BA 5EJ1A 2J0AA 1R82A 4KC4A 1VZUA 4Y7GA 4R7PA 5CQNX 4ASYA 1GQCA 3OGZA 2FYCB 1FGXA 1H5SD 1QWJA 1GQ9A 2RJ5A 4Y7UA 4BQHA 3SX3A 4FRPA 3PKQA 2WGZA 3Q80A 2DPWA 1QGQA 3R3IA 5FV9A 3T7OA 4HO3A 2FFVA 1OMXA 5C49A 1QG8A 2VSHA 5FU0A 1H5TA 2A8UA 4NAKA 1JVDA 4EVWA 1H4EA 3SX7A 1GWVA 1HJJA 2OEGA 4ECMA 1ZCUA 2VS4A 2Y4MA 5C47A 1ZJPA 1WSZA 4FRMA 2Y4JA 2D7RA 3FWWA 1H5RB 3OH4A 4IRPA 2WVKA 3CKJA 4M2AA 3U2TA 1H7GA 4UEGA 1HJLA 2OI5A 2E3DA 3I0KA 2ICYA 5AJPA 1GWWA 3K8DA 2Z86A 4KPZA 4HO9A 1OMZA 2D0JA 5C36A 1WT3A 5C4FA 2RIZA 4YS8A 4AYJA 2RJ8A 4AYLA 5I1FA 1G0RA 1LZ7A 2V0JA 1YROB 2J0BA 2XWNA 4DECA 1LZ0A 3SXDA 3I0HA 2YC3A 2FYBA 2CU2A 2XMEA 2VD4A 4B3UA 2OEFA 4HO5A 4FQWA 2AECA 3DK5A 4FCUA 3I0LA 1H7QA 2RJ1A 4FRDA 2V0LA 2FY7A 2YESA 1R7TA 3FOQA 4JD0A 3RSBA 1VGUA 4HCQA 2FYAA 5CQPA 4HO6A 4G3QA 1WT1A 4KC1A 5J49A 2WE9A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1WVC A;  2ICX A;  2YQH A;  4KXO A;  1EZI A;  3D98 A;  4Y7F A;  5AJO A;  1FXO A;  5FU8 A;  5L6S A;  2O1G A;  2RJ4 A;  4KNX A;  4HG6 A;  4M4K A;  1O0R A;  3OKR A;  4Y64 A;  1H5S A;  3I0J A;  4G3S A;  4C2S A;  5IDT A;  3JUJ A;  4LW3 A;  3CKV A;  4Y6N A;  4D11 A;  1ZJO A;  4G87 A;  1IIN A;  3NGW A;  1ZJ3 A;  5CQL X;  1WT0 A;  3SXC A;  1H7F A;  1Z90 A;  2YQJ A;  2AM4 A;  3DJ4 A;  3I0G A;  2PGV A;  5CMJ A;  3SXE A;  1G2V A;  1JVG A;  1R80 A;  4MND A;  1H7L A;  3IOJ A;  4EEM A;  2O1F A;  1VM8 A;  3RMW A;  1FXJ A;  3O3P A;  1LVW A;  2Z87 A;  4DE7 A;  4KNR A;  1W55 A;  3Q4S A;  3SXG A;  2BO4 A;  3EE5 A;  3KIA A;  4FRH A;  1ZIZ A;  1WT2 A;  1LL3 A;  3JTJ A;  4FRA A;  3ZLK A;  4D48 A;  2FFU A;  4EEG A;  3E26 A;  4J18 A;  2UX8 A;  2YQC A;  3V8Z A;  2QGI A;  1R7V A;  2A8W A;  4Y63 A;  5EIY A;  3IOI A;  2VXM A;  2X5S A;  1JV1 A;  2JCK A;  1NMM B;  2P73 A;  3N9W A;  3PNN A;  1G23 A;  1H3M A;  5C3A A;  4D0T A;  2V0H A;  2X60 A;  4FRQ A;  1ZCT A;  2OI7 A;  2X5Z A;  3I0F A;  1TW1 A;  1SS9 A;  3ZGF A;  5C1L A;  2AH9 A;  5AJN A;  4Y9X A;  4NAI A;  2ZU7 A;  4NAL A;  1ON6 A;  2XWL A;  1O7Q A;  4B2W A;  4CJC A;  5CQO A;  2I5E A;  5C8R A;  2Y7A A;  3F1Y A;  5CMI A;  4EE4 A;  4ZDQ A;  1KWS A;  3TQD A;  4AAW A;  1MP4 A;  2NXV A;  3PKP A;  3QVB A;  3ZF8 A;  1FO9 A;  1V83 A;  4Y7T A;  1O7O A;  2BO7 A;  4CVH A;  4HOC A;  1ZJ2 A;  3SXB A;  4B4G A;  2GGO A;  3U2X A;  4IRQ A;  1H5T B;  3V0L A;  2Q4J A;  3OH1 A;  4MYB A;  3CKQ A;  1FZW A;  2RIT A;  4P02 A;  3V91 A;  1VPA A;  3I0D A;  3CKN A;  2WVL A;  1GX0 A;  1V84 A;  4JIS A;  1HM9 A;  1HM8 A;  2D7I A;  2XWM A;  4KQL A;  1ZJ1 A;  4FCE A;  3K8E A;  5BXC A;  3SX5 A;  3E25 A;  1S4O A;  4ASJ A;  1G9R A;  4K6R A;  2YCM A;  4Y62 A;  5CMH A;  3HL3 A;  1VH3 A;  1VGZ A;  2I7B A;  2WAW A;  1O23 B;  2PA4 A;  1TVY A;  2AM3 A;  2PX7 A;  1H4D A;  2V0K A;  4FRL A;  3OH2 A;  1GX4 A;  1FRW A;  4LW6 A;  2P72 A;  2VXL A;  1LZI A;  1FWY A;  3V90 A;  3USQ A;  2OI6 A;  1G3L A;  5CMF X;  1VZX A;  3I0C A;  3T7M A;  4L41 C;  2VS5 A;  4D0Z A;  1R7Y A;  1XZ6 A;  3IOH A;  1NKH B;  1YP2 A;  2P6W A;  1XHB A;  4B2X A;  2VS3 A;  5C4C A;  1R7U A;  2AES A;  2AM5 A;  1H7T A;  4B4B A;  1G93 A;  4M2B A;  1FO8 A;  3RMV A;  1MP5 A;  4HO8 A;  3OAM A;  3BCV A;  3T7N A;  1ZI1 A;  3ZLL A;  2FYD B;  2BO8 A;  5C4B A;  3U0X A;  3OH3 A;  1ZI4 A;  1LL2 A;  1GA8 A;  1H5R A;  5CMG X;  2WEE A;  1HV9 A;  1IIM A;  1EYR A;  3D8V A;  3LW6 A;  3SX8 A;  1ZCY A;  4CJB A;  1MC3 A;  2W0V A;  4B42 A;  2Y6P A;  2I5K A;  1FR9 A;  1H5S B;  3Q7U A;  1OQM B;  1FR8 A;  5FTS A;  4EE5 A;  1LZJ A;  2VSI A;  1ZI3 A;  4HO2 A;  1VZT A;  1MP3 A;  2GGQ A;  1NQI B;  1ZDG A;  4BMA A;  2AE7 A;  5C48 A;  1HM0 A;  1R7X A;  4M28 A;  1JYL A;  1TW5 A;  1TZF A;  4ARW A;  1W57 A;  3I0I X;  1S4N A;  1V82 A;  4EE3 A;  3U2U A;  4XWI A;  5FUH A;  2RJ9 A;  2QKX A;  5IDS A;  5FTV A;  3F1C A;  2O1H A;  1W77 A;  3OC9 A;  4AC3 A;  5C3D A;  3U0Y A;  1R81 A;  5C4E A;  2RIX A;  1E5K A;  2W0W A;  2YQS A;  3V0N A;  1NHE B;  1H7H A;  3D5N A;  2ZU8 A;  4CJ8 A;  4KC2 A;  3SXA A;  1S4P A;  1ZDF A;  3R2W A;  5DDV A;  5C1G A;  2E8B A;  5IFY A;  4B5B A;  2JCJ A;  1H4C A;  1G95 A;  3SPT A;  1G1L A;  1H5S C;  1YP3 A;  4KRV A;  1FG5 N;  3DUV A;  1JV3 A;  1ZI5 A;  1INJ A;  5FYE A;  2PGY A;  3CGX A;  4FRE A;  4D11 C;  1ZHJ A;  1INI A;  2APC A;  4FRB A;  2WVM A;  1JYK A;  2RJ6 A;  1NWG B;  1LL0 A;  1PZT A;  4NAN A;  4P00 A;  1NF5 B;  5CQM X;  3ST8 A;  2Y4L A;  1VH1 A;  1K4V A;  2VFZ A;  2JCO A;  4Y6U A;  2ZU9 A;  5EJZ A;  3GUE A;  2XMH A;  4GBP A;  4HO4 A;  1PZY B;  1QGS A;  1VGT A;  2RIY A;  3ZGG A;  4EEO A;  3BRK X;  3TZT A;  2V0I A;  3U2V A;  3V0M A;  5C38 A;  3V0Q A;  1FOA A;  5L6V A;  4HO0 A;  2Y4K A;  5DDT A;  3U2W A;  2YC5 A;  3V0P A;  2AGD A;  3POL A;  2MZB A;  2QH5 A;  4DDZ A;  2BO6 A;  4FRO A;  5C1H A;  3CKO A;  3USR A;  2RJ7 A;  2X65 A;  1ZJ0 A;  4KT7 A;  3V8Y A;  2RJ0 A;  3JUK A;  5JQQ A;  1YP4 A;  1G97 A;  1I52 A;  4E1K A;  3I0E A;  1FGG A;  3OH0 A;  4Y7V A;  4EEA A;  5HS2 A;  1VGW A;  1ZCV A;  3CU0 A;  4B4M A;  4KPX A;  4G3P A;  1VIC A;  2JCL A;  1H7E A;  1G8O A;  5C4D A;  1ON8 A;  3V0O A;  5C3B A;  5EJ1 A;  1R82 A;  4KC4 A;  1VZU A;  4Y7G A;  4R7P A;  5CQN X;  4ASY A;  1GQC A;  3OGZ A;  2FYC B;  1FGX A;  1H5S D;  1QWJ A;  1GQ9 A;  2RJ5 A;  4Y7U A;  4BQH A;  3SX3 A;  4FRP A;  3PKQ A;  2WGZ A;  3Q80 A;  2DPW A;  1QGQ A;  3R3I A;  5FV9 A;  3T7O A;  4HO3 A;  2FFV A;  1OMX A;  5C49 A;  1QG8 A;  2VSH A;  5FU0 A;  1H5T A;  2A8U A;  4NAK A;  1JVD A;  4EVW A;  1H4E A;  3SX7 A;  1GWV A;  1HJJ A;  2OEG A;  4ECM A;  1ZCU A;  2VS4 A;  2Y4M A;  5C47 A;  1ZJP A;  1WSZ A;  4FRM A;  2Y4J A;  2D7R A;  3FWW A;  1H5R B;  3OH4 A;  4IRP A;  2WVK A;  3CKJ A;  4M2A A;  3U2T A;  1H7G A;  4UEG A;  1HJL A;  2OI5 A;  2E3D A;  3I0K A;  2ICY A;  5AJP A;  1GWW A;  3K8D A;  2Z86 A;  4KPZ A;  4HO9 A;  1OMZ A;  2D0J A;  5C36 A;  1WT3 A;  5C4F A;  2RIZ A;  4YS8 A;  4AYJ A;  2RJ8 A;  4AYL A;  5I1F A;  1G0R A;  1LZ7 A;  2V0J A;  1YRO B;  2XWN A;  4DEC A;  1LZ0 A;  3SXD A;  3I0H A;  2YC3 A;  2FYB A;  2CU2 A;  2XME A;  2VD4 A;  4B3U A;  2OEF A;  4HO5 A;  4FQW A;  2AEC A;  3DK5 A;  4FCU A;  3I0L A;  1H7Q A;  2RJ1 A;  4FRD A;  2V0L A;  2FY7 A;  2YES A;  1R7T A;  3FOQ A;  4JD0 A;  3RSB A;  1VGU A;  4HCQ A;  2FYA A;  5CQP A;  4HO6 A;  4G3Q A;  1WT1 A;  4KC1 A;  5J49 A;  2WE9 A; 
#chains in the Genus database with same CATH topology
 1WVC A;  2ICX A;  2YQH A;  4KXO A;  1EZI A;  3D98 A;  4Y7F A;  5AJO A;  1FXO A;  5FU8 A;  5L6S A;  2O1G A;  2RJ4 A;  4KNX A;  4HG6 A;  4M4K A;  1O0R A;  3OKR A;  4Y64 A;  1H5S A;  3I0J A;  4G3S A;  4C2S A;  5IDT A;  3JUJ A;  4LW3 A;  3CKV A;  4Y6N A;  4D11 A;  1ZJO A;  4G87 A;  1IIN A;  3NGW A;  1ZJ3 A;  5CQL X;  1WT0 A;  3SXC A;  1H7F A;  1Z90 A;  2YQJ A;  2AM4 A;  3DJ4 A;  3I0G A;  2PGV A;  5CMJ A;  3SXE A;  1G2V A;  1JVG A;  1R80 A;  4MND A;  1H7L A;  3IOJ A;  4EEM A;  2O1F A;  1VM8 A;  3RMW A;  1FXJ A;  3O3P A;  1LVW A;  2Z87 A;  4DE7 A;  4KNR A;  1W55 A;  3Q4S A;  3SXG A;  2BO4 A;  3EE5 A;  3KIA A;  4FRH A;  1ZIZ A;  1WT2 A;  1LL3 A;  2C0N A;  3JTJ A;  4FRA A;  3ZLK A;  4D48 A;  2FFU A;  4EEG A;  3E26 A;  4J18 A;  2UX8 A;  2YQC A;  3V8Z A;  2QGI A;  1R7V A;  2A8W A;  4Y63 A;  5EIY A;  3IOI A;  2VXM A;  2X5S A;  1JV1 A;  2JCK A;  1NMM B;  2P73 A;  3N9W A;  3PNN A;  1G23 A;  1H3M A;  5C3A A;  4D0T A;  2V0H A;  2X60 A;  4FRQ A;  1ZCT A;  2OI7 A;  2X5Z A;  3I0F A;  1TW1 A;  1SS9 A;  3ZGF A;  5C1L A;  2AH9 A;  5AJN A;  4Y9X A;  4NAI A;  2ZU7 A;  4NAL A;  1ON6 A;  2XWL A;  1O7Q A;  4B2W A;  4CJC A;  5CQO A;  2I5E A;  5C8R A;  2Y7A A;  3F1Y A;  5CMI A;  4EE4 A;  4ZDQ A;  1KWS A;  3TQD A;  4AAW A;  1MP4 A;  2NXV A;  3PKP A;  3QVB A;  3ZF8 A;  1FO9 A;  1V83 A;  4Y7T A;  1O7O A;  2BO7 A;  4CVH A;  4HOC A;  1ZJ2 A;  3SXB A;  4B4G A;  2GGO A;  3U2X A;  4IRQ A;  1H5T B;  3V0L A;  2Q4J A;  3OH1 A;  4MYB A;  3CKQ A;  1FZW A;  2RIT A;  4O6N A;  4P02 A;  5D92 A;  3V91 A;  1VPA A;  3I0D A;  3CKN A;  2WVL A;  1GX0 A;  1V84 A;  4JIS A;  1HM9 A;  1HM8 A;  2D7I A;  2XWM A;  4KQL A;  1ZJ1 A;  4FCE A;  3K8E A;  5BXC A;  3SX5 A;  3E25 A;  1S4O A;  4ASJ A;  1G9R A;  4K6R A;  2YCM A;  4Y62 A;  5CMH A;  3HL3 A;  1VH3 A;  1VGZ A;  2I7B A;  2WAW A;  1O23 B;  4MIX A;  2PA4 A;  1TVY A;  2AM3 A;  2PX7 A;  4O6M A;  1H4D A;  2V0K A;  4FRL A;  3OH2 A;  1GX4 A;  1FRW A;  4LW6 A;  2P72 A;  2VXL A;  1LZI A;  1FWY A;  3V90 A;  3USQ A;  2OI6 A;  1G3L A;  5CMF X;  1VZX A;  3I0C A;  3T7M A;  4L41 C;  2VS5 A;  4D0Z A;  1R7Y A;  1XZ6 A;  3IOH A;  1NKH B;  1YP2 A;  2P6W A;  1XHB A;  4B2X A;  2VS3 A;  5C4C A;  1R7U A;  2AES A;  2AM5 A;  1H7T A;  4B4B A;  1G93 A;  4M2B A;  1FO8 A;  3RMV A;  1MP5 A;  4HO8 A;  3OAM A;  3BCV A;  3T7N A;  1ZI1 A;  3ZLL A;  2FYD B;  2BO8 A;  5C4B A;  3U0X A;  3OH3 A;  1ZI4 A;  1LL2 A;  1GA8 A;  1H5R A;  5CMG X;  2WEE A;  4Q7C A;  1HV9 A;  1IIM A;  1EYR A;  3D8V A;  3LW6 A;  3SX8 A;  1ZCY A;  4CJB A;  1MC3 A;  2W0V A;  5D91 A;  4B42 A;  2Y6P A;  2I5K A;  1FR9 A;  1H5S B;  3Q7U A;  1OQM B;  1FR8 A;  5FTS A;  4EE5 A;  1LZJ A;  2VSI A;  1ZI3 A;  4HO2 A;  1VZT A;  1MP3 A;  2GGQ A;  1NQI B;  1ZDG A;  4BMA A;  2AE7 A;  5C48 A;  1HM0 A;  1R7X A;  4M28 A;  1JYL A;  1TW5 A;  1TZF A;  4ARW A;  1W57 A;  3I0I X;  1S4N A;  1V82 A;  4EE3 A;  3U2U A;  4XWI A;  5FUH A;  2RJ9 A;  2QKX A;  5IDS A;  5FTV A;  3F1C A;  2O1H A;  1W77 A;  3OC9 A;  4AC3 A;  5C3D A;  3U0Y A;  1R81 A;  5C4E A;  2RIX A;  1E5K A;  2W0W A;  2YQS A;  3V0N A;  1NHE B;  1H7H A;  3D5N A;  2ZU8 A;  4CJ8 A;  4KC2 A;  3SXA A;  1S4P A;  1ZDF A;  3R2W A;  5DDV A;  5C1G A;  2E8B A;  5IFY A;  4B5B A;  2JCJ A;  1H4C A;  1G95 A;  3SPT A;  1G1L A;  1H5S C;  1YP3 A;  4KRV A;  1FG5 N;  2VK9 A;  3DUV A;  1JV3 A;  1ZI5 A;  1INJ A;  5FYE A;  2PGY A;  3CGX A;  4FRE A;  4D11 C;  1ZHJ A;  1INI A;  2APC A;  4FRB A;  2WVM A;  1JYK A;  2RJ6 A;  1NWG B;  1LL0 A;  1PZT A;  4NAN A;  4P00 A;  1NF5 B;  5CQM X;  3ST8 A;  2Y4L A;  1VH1 A;  1K4V A;  2VFZ A;  2JCO A;  4Y6U A;  2ZU9 A;  5EJZ A;  3GUE A;  2XMH A;  4GBP A;  4HO4 A;  1PZY B;  1QGS A;  1VGT A;  2RIY A;  3ZGG A;  4EEO A;  3BRK X;  3TZT A;  2V0I A;  3U2V A;  3V0M A;  5C38 A;  3V0Q A;  1FOA A;  5L6V A;  4HO0 A;  2Y4K A;  5DDT A;  3U2W A;  2YC5 A;  4FIX A;  3V0P A;  2AGD A;  3POL A;  2MZB A;  2QH5 A;  4DDZ A;  2BO6 A;  4FRO A;  5C1H A;  3CKO A;  3USR A;  2RJ7 A;  2X65 A;  1ZJ0 A;  4KT7 A;  3V8Y A;  2RJ0 A;  3JUK A;  5JQQ A;  1YP4 A;  1G97 A;  1I52 A;  4E1K A;  3I0E A;  1FGG A;  3OH0 A;  4Y7V A;  4EEA A;  5HS2 A;  1VGW A;  1ZCV A;  3CU0 A;  4B4M A;  4KPX A;  4G3P A;  4FIY A;  1VIC A;  2JCL A;  1H7E A;  1G8O A;  5C4D A;  1ON8 A;  3V0O A;  5C3B A;  5EJ1 A;  2J0A A;  1R82 A;  4KC4 A;  1VZU A;  4Y7G A;  4R7P A;  5CQN X;  4ASY A;  1GQC A;  3OGZ A;  2FYC B;  1FGX A;  1H5S D;  1QWJ A;  1GQ9 A;  2RJ5 A;  4Y7U A;  4BQH A;  3SX3 A;  4FRP A;  3PKQ A;  2WGZ A;  3Q80 A;  2DPW A;  1QGQ A;  3R3I A;  5FV9 A;  3T7O A;  4HO3 A;  2FFV A;  1OMX A;  5C49 A;  1QG8 A;  2VSH A;  5FU0 A;  1H5T A;  2A8U A;  4NAK A;  1JVD A;  4EVW A;  1H4E A;  3SX7 A;  1GWV A;  1HJJ A;  2OEG A;  4ECM A;  1ZCU A;  2VS4 A;  2Y4M A;  5C47 A;  1ZJP A;  1WSZ A;  4FRM A;  2Y4J A;  2D7R A;  3FWW A;  1H5R B;  3OH4 A;  4IRP A;  2WVK A;  3CKJ A;  4M2A A;  3U2T A;  1H7G A;  4UEG A;  1HJL A;  2OI5 A;  2E3D A;  3I0K A;  2ICY A;  5AJP A;  1GWW A;  3K8D A;  2Z86 A;  4KPZ A;  4HO9 A;  1OMZ A;  2D0J A;  5C36 A;  1WT3 A;  5C4F A;  2RIZ A;  4YS8 A;  4AYJ A;  2RJ8 A;  4AYL A;  5I1F A;  1G0R A;  1LZ7 A;  2V0J A;  1YRO B;  2J0B A;  2XWN A;  4DEC A;  1LZ0 A;  3SXD A;  3I0H A;  2YC3 A;  2FYB A;  2CU2 A;  2XME A;  2VD4 A;  4B3U A;  2OEF A;  4HO5 A;  4FQW A;  2AEC A;  3DK5 A;  4FCU A;  3I0L A;  1H7Q A;  2RJ1 A;  4FRD A;  2V0L A;  2FY7 A;  2YES A;  1R7T A;  3FOQ A;  4JD0 A;  3RSB A;  1VGU A;  4HCQ A;  2FYA A;  5CQP A;  4HO6 A;  4G3Q A;  1WT1 A;  4KC1 A;  5J49 A;  2WE9 A; 
#chains in the Genus database with same CATH homology
 1WVC A;  2ICX A;  2YQH A;  4KXO A;  1EZI A;  3D98 A;  4Y7F A;  5AJO A;  1FXO A;  5FU8 A;  5L6S A;  2O1G A;  2RJ4 A;  4KNX A;  4HG6 A;  4M4K A;  1O0R A;  3OKR A;  4Y64 A;  1H5S A;  3I0J A;  4G3S A;  4C2S A;  5IDT A;  3JUJ A;  4LW3 A;  3CKV A;  4Y6N A;  4D11 A;  1ZJO A;  4G87 A;  1IIN A;  3NGW A;  1ZJ3 A;  5CQL X;  1WT0 A;  3SXC A;  1H7F A;  1Z90 A;  2YQJ A;  2AM4 A;  3DJ4 A;  3I0G A;  2PGV A;  5CMJ A;  3SXE A;  1G2V A;  1JVG A;  1R80 A;  4MND A;  1H7L A;  3IOJ A;  4EEM A;  2O1F A;  1VM8 A;  3RMW A;  1FXJ A;  3O3P A;  1LVW A;  2Z87 A;  4DE7 A;  4KNR A;  1W55 A;  3Q4S A;  3SXG A;  2BO4 A;  3EE5 A;  3KIA A;  4FRH A;  1ZIZ A;  1WT2 A;  1LL3 A;  2C0N A;  3JTJ A;  4FRA A;  3ZLK A;  4D48 A;  2FFU A;  4EEG A;  3E26 A;  4J18 A;  2UX8 A;  2YQC A;  3V8Z A;  2QGI A;  1R7V A;  2A8W A;  4Y63 A;  5EIY A;  3IOI A;  2VXM A;  2X5S A;  1JV1 A;  2JCK A;  1NMM B;  2P73 A;  3N9W A;  3PNN A;  1G23 A;  1H3M A;  5C3A A;  4D0T A;  2V0H A;  2X60 A;  4FRQ A;  1ZCT A;  2OI7 A;  2X5Z A;  3I0F A;  1TW1 A;  1SS9 A;  3ZGF A;  5C1L A;  2AH9 A;  5AJN A;  4Y9X A;  4NAI A;  2ZU7 A;  4NAL A;  1ON6 A;  2XWL A;  1O7Q A;  4B2W A;  4CJC A;  5CQO A;  2I5E A;  5C8R A;  2Y7A A;  3F1Y A;  5CMI A;  4EE4 A;  4ZDQ A;  1KWS A;  3TQD A;  4AAW A;  1MP4 A;  2NXV A;  3PKP A;  3QVB A;  3ZF8 A;  1FO9 A;  1V83 A;  4Y7T A;  1O7O A;  2BO7 A;  4CVH A;  4HOC A;  1ZJ2 A;  3SXB A;  4B4G A;  2GGO A;  3U2X A;  4IRQ A;  1H5T B;  3V0L A;  2Q4J A;  3OH1 A;  4MYB A;  3CKQ A;  1FZW A;  2RIT A;  4O6N A;  4P02 A;  5D92 A;  3V91 A;  1VPA A;  3I0D A;  3CKN A;  2WVL A;  1GX0 A;  1V84 A;  4JIS A;  1HM9 A;  1HM8 A;  2D7I A;  2XWM A;  4KQL A;  1ZJ1 A;  4FCE A;  3K8E A;  5BXC A;  3SX5 A;  3E25 A;  1S4O A;  4ASJ A;  1G9R A;  4K6R A;  2YCM A;  4Y62 A;  5CMH A;  3HL3 A;  1VH3 A;  1VGZ A;  2I7B A;  2WAW A;  1O23 B;  4MIX A;  2PA4 A;  1TVY A;  2AM3 A;  2PX7 A;  4O6M A;  1H4D A;  2V0K A;  4FRL A;  3OH2 A;  1GX4 A;  1FRW A;  4LW6 A;  2P72 A;  2VXL A;  1LZI A;  1FWY A;  3V90 A;  3USQ A;  2OI6 A;  1G3L A;  5CMF X;  1VZX A;  3I0C A;  3T7M A;  4L41 C;  2VS5 A;  4D0Z A;  1R7Y A;  1XZ6 A;  3IOH A;  1NKH B;  1YP2 A;  2P6W A;  1XHB A;  4B2X A;  2VS3 A;  5C4C A;  1R7U A;  2AES A;  2AM5 A;  1H7T A;  4B4B A;  1G93 A;  4M2B A;  1FO8 A;  3RMV A;  1MP5 A;  4HO8 A;  3OAM A;  3BCV A;  3T7N A;  1ZI1 A;  3ZLL A;  2FYD B;  2BO8 A;  5C4B A;  3U0X A;  3OH3 A;  1ZI4 A;  1LL2 A;  1GA8 A;  1H5R A;  5CMG X;  2WEE A;  4Q7C A;  1HV9 A;  1IIM A;  1EYR A;  3D8V A;  3LW6 A;  3SX8 A;  1ZCY A;  4CJB A;  1MC3 A;  2W0V A;  5D91 A;  4B42 A;  2Y6P A;  2I5K A;  1FR9 A;  1H5S B;  3Q7U A;  1OQM B;  1FR8 A;  5FTS A;  4EE5 A;  1LZJ A;  2VSI A;  1ZI3 A;  4HO2 A;  1VZT A;  1MP3 A;  2GGQ A;  1NQI B;  1ZDG A;  4BMA A;  2AE7 A;  5C48 A;  1HM0 A;  1R7X A;  4M28 A;  1JYL A;  1TW5 A;  1TZF A;  4ARW A;  1W57 A;  3I0I X;  1S4N A;  1V82 A;  4EE3 A;  3U2U A;  4XWI A;  5FUH A;  2RJ9 A;  2QKX A;  5IDS A;  5FTV A;  3F1C A;  2O1H A;  1W77 A;  3OC9 A;  4AC3 A;  5C3D A;  3U0Y A;  1R81 A;  5C4E A;  2RIX A;  1E5K A;  2W0W A;  2YQS A;  3V0N A;  1NHE B;  1H7H A;  3D5N A;  2ZU8 A;  4CJ8 A;  4KC2 A;  3SXA A;  1S4P A;  1ZDF A;  3R2W A;  5DDV A;  5C1G A;  2E8B A;  5IFY A;  4B5B A;  2JCJ A;  1H4C A;  1G95 A;  3SPT A;  1G1L A;  1H5S C;  1YP3 A;  4KRV A;  1FG5 N;  2VK9 A;  3DUV A;  1JV3 A;  1ZI5 A;  1INJ A;  5FYE A;  2PGY A;  3CGX A;  4FRE A;  4D11 C;  1ZHJ A;  1INI A;  2APC A;  4FRB A;  2WVM A;  1JYK A;  2RJ6 A;  1NWG B;  1LL0 A;  1PZT A;  4NAN A;  4P00 A;  1NF5 B;  5CQM X;  3ST8 A;  2Y4L A;  1VH1 A;  1K4V A;  2VFZ A;  2JCO A;  4Y6U A;  2ZU9 A;  5EJZ A;  3GUE A;  2XMH A;  4GBP A;  4HO4 A;  1PZY B;  1QGS A;  1VGT A;  2RIY A;  3ZGG A;  4EEO A;  3BRK X;  3TZT A;  2V0I A;  3U2V A;  3V0M A;  5C38 A;  3V0Q A;  1FOA A;  5L6V A;  4HO0 A;  2Y4K A;  5DDT A;  3U2W A;  2YC5 A;  4FIX A;  3V0P A;  2AGD A;  3POL A;  2MZB A;  2QH5 A;  4DDZ A;  2BO6 A;  4FRO A;  5C1H A;  3CKO A;  3USR A;  2RJ7 A;  2X65 A;  1ZJ0 A;  4KT7 A;  3V8Y A;  2RJ0 A;  3JUK A;  5JQQ A;  1YP4 A;  1G97 A;  1I52 A;  4E1K A;  3I0E A;  1FGG A;  3OH0 A;  4Y7V A;  4EEA A;  5HS2 A;  1VGW A;  1ZCV A;  3CU0 A;  4B4M A;  4KPX A;  4G3P A;  4FIY A;  1VIC A;  2JCL A;  1H7E A;  1G8O A;  5C4D A;  1ON8 A;  3V0O A;  5C3B A;  5EJ1 A;  2J0A A;  1R82 A;  4KC4 A;  1VZU A;  4Y7G A;  4R7P A;  5CQN X;  4ASY A;  1GQC A;  3OGZ A;  2FYC B;  1FGX A;  1H5S D;  1QWJ A;  1GQ9 A;  2RJ5 A;  4Y7U A;  4BQH A;  3SX3 A;  4FRP A;  3PKQ A;  2WGZ A;  3Q80 A;  2DPW A;  1QGQ A;  3R3I A;  5FV9 A;  3T7O A;  4HO3 A;  2FFV A;  1OMX A;  5C49 A;  1QG8 A;  2VSH A;  5FU0 A;  1H5T A;  2A8U A;  4NAK A;  1JVD A;  4EVW A;  1H4E A;  3SX7 A;  1GWV A;  1HJJ A;  2OEG A;  4ECM A;  1ZCU A;  2VS4 A;  2Y4M A;  5C47 A;  1ZJP A;  1WSZ A;  4FRM A;  2Y4J A;  2D7R A;  3FWW A;  1H5R B;  3OH4 A;  4IRP A;  2WVK A;  3CKJ A;  4M2A A;  3U2T A;  1H7G A;  4UEG A;  1HJL A;  2OI5 A;  2E3D A;  3I0K A;  2ICY A;  5AJP A;  1GWW A;  3K8D A;  2Z86 A;  4KPZ A;  4HO9 A;  1OMZ A;  2D0J A;  5C36 A;  1WT3 A;  5C4F A;  2RIZ A;  4YS8 A;  4AYJ A;  2RJ8 A;  4AYL A;  5I1F A;  1G0R A;  1LZ7 A;  2V0J A;  1YRO B;  2J0B A;  2XWN A;  4DEC A;  1LZ0 A;  3SXD A;  3I0H A;  2YC3 A;  2FYB A;  2CU2 A;  2XME A;  2VD4 A;  4B3U A;  2OEF A;  4HO5 A;  4FQW A;  2AEC A;  3DK5 A;  4FCU A;  3I0L A;  1H7Q A;  2RJ1 A;  4FRD A;  2V0L A;  2FY7 A;  2YES A;  1R7T A;  3FOQ A;  4JD0 A;  3RSB A;  1VGU A;  4HCQ A;  2FYA A;  5CQP A;  4HO6 A;  4G3Q A;  1WT1 A;  4KC1 A;  5J49 A;  2WE9 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...