2PA4A

Crystal structure of udp-glucose pyrophosphorylase from corynebacteria glutamicum in complex with magnesium and udp-glucose
Total Genus 91
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
91
sequence length
294
structure length
294
Chain Sequence
VKTVVVPAAGLGTRFLPATKTVPKELLPVVDTPGIELIAAEAAELGATRLAIITAPNKAGVLAHFERSSELEETLMERGKTDQVEIIRRAADLIKAVPVTQDKPLGLGHAVGLAESVLDDDEDVVAVMLPDDLVLPTGVMERMAQVRAEFGGSVLCAVEVSEADVSKYGIFEIEADTKDSDVKKVKGMVEKPAIEDAPSRLAATGRYLLDRKIFDALRRITPGAGGELQLTDAIDLLIDEGHPVHIVIHQGKRHDLGNPGGYIPACVDFGLSHPVYGAQLKDAIKQILAEHEAA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords UTP-GLUCOSE-1-PHOSPHATE URIDYLYLTRANSFERASE
publication title Active site geometry of glucose-1-phosphate uridylyltransferase.
pubmed doi rcsb
source organism Corynebacterium glutamicum atcc 13032
molecule tags Transferase
total genus 91
structure length 294
sequence length 294
chains with identical sequence B, C, D
ec nomenclature ec 2.7.7.9: UTP--glucose-1-phosphate uridylyltransferase.
pdb deposition date 2007-03-27
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.550.10 Alpha Beta Alpha-Beta Complex Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A 2pa4A00
1O0RA 3ZGGA 1ZI5A 4ASJA 4D11A 5BXCA 3V8ZA 3OH1A 1FO9A 3D8VA 4Y63A 2O1GA 4HOCA 3U2TA 3ZF8A 5FYEA 3U0XA 4G87A 1I52A 1ZIZA 5C48A 5C3BA 4G3PA 4LW3A 1W57A 3R2WA 3ZLLA 3USRA 2YESA 2P72A 3OH4A 2O1HA 5IDTA 2O1FA 1VH1A 3RMVA 3BCVA 1ZHJA 2P73A 4LW6A 4NALA 3U2XA 1XZ6A 2QH5A 3SX5A 4HG6A 2VS5A 4ECMA 4E1KA 4FCUA 1R82A 5IFYA 2OEFA 1O7OA 1ON6A 3SXGA 4MNDA 2D7RA 3D98A 4KPZA 1NMMB 5DDTA 1JYKA 1VPAA 2BO4A 2RJ8A 3I0HA 4AYJA 1WT2A 3RSBA 3U2VA 3EE5A 1ZJOA 3JUKA 4Y7GA 3OAMA 4G3QA 1HM9A 3I0GA 5AJOA 3RMWA 3F1YA 5C1HA 2QGIA 4NAIA 4Y6UA 1FXOA 2V0KA 1TVYA 2A8WA 3OH3A 5CQOA 1NHEB 1E5KA 2X5SA 2Y4JA 1G0RA 1H7QA 2ZU7A 2ZU8A 2WEEA 1ZCVA 3I0LA 1H4EA 4YS8A 5IDSA 2RJ7A 2RJ5A 3E26A 4G3SA 3T7OA 1GA8A 1ZI4A 3SXEA 2JCLA 3HL3A 5FUHA 1R80A 5CMFX 1S4OA 2VXLA 1GQ9A 1ZI3A 4EE3A 4B4GA 3OKRA 5CQMX 2BO8A 1YROB 5CMJA 1JVGA 1HM8A 3ZLKA 4CJ8A 1HJLA 4ARWA 2PGYA 2PA4A 2FYBA 2VD4A 2RJ6A 3I0DA 2V0JA 4AYLA 1LL0A 2AM3A 1HV9A 2FYDB 2V0LA 1VH3A 4B2XA 2ICYA 3DUVA 2JCKA 2VS4A 4IRPA 3BRKX 3V0NA 4AC3A 2QKXA 3LW6A 4FRPA 2I5KA 3I0JA 5CMGX 1H5SD 5FU8A 3T7MA 2VSHA 1PZTA 4P00A 4FRMA 1G8OA 2V0HA 2X65A 1H5TB 4FRDA 1G1LA 1XHBA 2ZU9A 1TZFA 1H3MA 3V0LA 1TW5A 4NAKA 1VGWA 1ZDFA 1GX4A 5CMIA 1ZCUA 2AM5A 1JYLA 1H5SB 1H7HA 4D11C 4HO9A 4Y9XA 1NQIB 1H7GA 4HO3A 1R7XA 5EJ1A 4D0ZA 1NWGB 4C2SA 2CU2A 1NKHB 5C4CA 2YQCA 2YQHA 3IOIA 3CGXA 5CMHA 2Z86A 3FOQA 3CKQA 1R7VA 4BQHA 2E8BA 2OI6A 2FFUA 4JISA 4B42A 4DDZA 5C36A 1R7UA 3V90A 4FCEA 3I0CA 4HO6A 4ASYA 3ST8A 1FXJA 2GGOA 1V82A 1ZJ1A 2AE7A 1ZJ2A 4HCQA 4CJCA 1FGXA 2I7BA 1VGTA 1ZJ0A 4AAWA 2WAWA 3CU0A 5AJNA 2V0IA 4FRAA 2FYAA 4KC1A 1R81A 2A8UA 1R7YA 3ZGFA 3N9WA 4HO2A 2Y4KA 1H4DA 1OMZA 2XMEA 2AECA 1VZXA 1INJA 4NANA 2PGVA 1LZ7A 1H7TA 1S4PA 1H5TA 1W55A 1FZWA 1PZYB 1YP4A 3SXCA 5C4EA 5C4BA 2YC3A 4Y7FA 2XMHA 4MYBA 1H7EA 4K6RA 2RIXA 2RJ1A 1G93A 2D7IA 3R3IA 2YQJA 4FRLA 4J18A 1V83A 1ZCTA 2Y4LA 1H5SA 5C38A 4HO4A 5FV9A 3JUJA 3CKJA 2XWLA 3SXDA 4M2BA 3CKNA 1V84A 1QGSA 1S4NA 2VSIA 2XWNA 2MZBA 3POLA 4XWIA 3D5NA 5AJPA 3Q80A 3OC9A 4KNRA 1JV3A 1VGZA 3SXBA 1ZI1A 1GX0A 4EEAA 4EEGA 1MP3A 3IOJA 4KC4A 1VGUA 1W77A 4FRBA 1G2VA 5HS2A 3FWWA 1JV1A 1ZJPA 1LZJA 3TQDA 2XWMA 3SX8A 4DE7A 2X5ZA 3Q7UA 4R7PA 1H4CA 5C3DA 2Y4MA 4EEOA 2WVKA 3I0EA 3I0KA 1MP5A 1GWVA 2BO7A 5CQPA 2WGZA 2VS3A 3OH2A 2E3DA 3SX7A 2YC5A 2YCMA 5C4DA 4EEMA 2D0JA 3CKOA 1FRWA 1FOAA 4Y7UA 3U0YA 2ICXA 4JD0A 4FQWA 1IINA 2WVMA 2AGDA 2JCJA 3DJ4A 1LZ0A 3PKQA 5L6VA 2RIYA 2PX7A 2APCA 3K8DA 4HO5A 5FTSA 4CVHA 1LL3A 4L41C 4EE4A 4B3UA 4ZDQA 3V0PA 3O3PA 4EVWA 4Y62A 4FREA 3SXAA 2Z87A 2JCOA 3F1CA 5J49A 2Q4JA 1WVCA 4CJBA 2P6WA 1H7FA 3PNNA 4UEGA 5FU0A 2Y7AA 4EE5A 1FO8A 2I5EA 5DDVA 1R7TA 1H7LA 5C49A 4Y7VA 2GGQA 3QVBA 1GWWA 4KXOA 4FRHA 4B5BA 4KQLA 4D0TA 1NF5B 4Y64A 5C1GA 3PKPA 1ZJ3A 4DECA 1O23B 3SPTA 1FGGA 1FWYA 2BO6A 5C1LA 3U2UA 1G23A 3V0MA 1OQMB 1VZTA 1Z90A 1QGQA 4KPXA 3OGZA 4HO8A 1HJJA 3CKVA 1WT1A 3U2WA 5C4FA 5C3AA 1MC3A 2VXMA 1JVDA 2UX8A 3I0IX 3V0QA 1H5RB 3Q4SA 3OH0A 2RJ4A 2W0VA 4M28A 4BMAA 1WT3A 1MP4A 5CQNX 2VFZA 5I1FA 1VICA 1H5SC 2YQSA 5JQQA 2AM4A 4HO0A 3SX3A 1ZCYA 1QG8A 1YP3A 5EIYA 3USQA 1VM8A 1SS9A 1LL2A 5C8RA 5EJZA 1O7QA 4KRVA 3T7NA 1G3LA 4KT7A 4Y6NA 2OEGA 1EYRA 1QWJA 4FRQA 4M4KA 2AESA 5FTVA 3JTJA 2RJ9A 3GUEA 4B4MA 4M2AA 4FROA 1K4VA 2OI7A 1YP2A 4KNXA 3K8EA 1VZUA 2RJ0A 2WE9A 3V8YA 1HM0A 2X60A 5C47A 4GBPA 4KC2A 1IIMA 1FR9A 5L6SA 4Y7TA 4D48A 5CQLX 2NXVA 4IRQA 3KIAA 2W0WA 1OMXA 4B2WA 4P02A 3DK5A 2FFVA 1TW1A 1ON8A 1FR8A 3V0OA 1FG5N 1LVWA 1WT0A 3E25A 1ZDGA 3NGWA 1H5RA 3TZTA 4B4BA 1G97A 2OI5A 2WVLA 1WSZA 2RIZA 1EZIA 1G95A 2AH9A 3I0FA 2DPWA 2RITA 3IOHA 2FY7A 2Y6PA 1LZIA 3V91A 1INIA 1KWSA 2FYCB 1G9RA 1GQCA
chains in the Genus database with same CATH superfamily
1O0RA 3ZGGA 1ZI5A 4ASJA 4D11A 5BXCA 3V8ZA 3OH1A 4Q7CA 1FO9A 3D8VA 4Y63A 2O1GA 4HOCA 3U2TA 3ZF8A 5FYEA 3U0XA 4G87A 1I52A 4FIXA 1ZIZA 5C48A 5C3BA 4G3PA 4LW3A 1W57A 3R2WA 3ZLLA 3USRA 2YESA 2P72A 3OH4A 2O1HA 5IDTA 2O1FA 1VH1A 3RMVA 3BCVA 1ZHJA 2P73A 4LW6A 4NALA 3U2XA 1XZ6A 2QH5A 3SX5A 4HG6A 2VS5A 4ECMA 4E1KA 4FCUA 1R82A 5IFYA 2OEFA 1O7OA 1ON6A 3SXGA 4MNDA 2D7RA 3D98A 4KPZA 1NMMB 5DDTA 1JYKA 1VPAA 2BO4A 2RJ8A 3I0HA 4AYJA 1WT2A 3RSBA 3U2VA 3EE5A 1ZJOA 3JUKA 4Y7GA 3OAMA 4G3QA 1HM9A 3I0GA 5AJOA 3RMWA 3F1YA 5C1HA 2QGIA 4NAIA 4Y6UA 1FXOA 2V0KA 1TVYA 2A8WA 2C0NA 3OH3A 5CQOA 1NHEB 1E5KA 2X5SA 2Y4JA 1G0RA 1H7QA 2ZU7A 2ZU8A 2WEEA 1ZCVA 3I0LA 1H4EA 4YS8A 5IDSA 2RJ7A 2RJ5A 3E26A 4G3SA 3T7OA 1GA8A 1ZI4A 3SXEA 2JCLA 3HL3A 5FUHA 1R80A 5CMFX 1S4OA 2VXLA 1GQ9A 1ZI3A 4EE3A 4B4GA 3OKRA 5CQMX 2BO8A 1YROB 5CMJA 1JVGA 1HM8A 3ZLKA 4CJ8A 1HJLA 4ARWA 2PGYA 2PA4A 2FYBA 2VD4A 2RJ6A 3I0DA 2V0JA 4AYLA 1LL0A 2AM3A 1HV9A 2FYDB 2V0LA 1VH3A 4B2XA 2ICYA 3DUVA 2JCKA 2VS4A 4IRPA 3BRKX 3V0NA 4AC3A 2QKXA 3LW6A 4FRPA 2I5KA 2J0BA 3I0JA 5CMGX 1H5SD 5FU8A 3T7MA 2VSHA 1PZTA 4P00A 4FRMA 1G8OA 2V0HA 2X65A 1H5TB 4FRDA 1G1LA 1XHBA 2ZU9A 1TZFA 1H3MA 3V0LA 1TW5A 4NAKA 1VGWA 1ZDFA 1GX4A 4O6NA 5CMIA 1ZCUA 2AM5A 1JYLA 1H5SB 1H7HA 4D11C 4HO9A 4Y9XA 1NQIB 1H7GA 4HO3A 1R7XA 5EJ1A 4D0ZA 1NWGB 4C2SA 2CU2A 1NKHB 5C4CA 2YQCA 2YQHA 3IOIA 3CGXA 5CMHA 2Z86A 3FOQA 3CKQA 1R7VA 4BQHA 2E8BA 2OI6A 2FFUA 4JISA 4FIYA 4B42A 4DDZA 5C36A 1R7UA 3V90A 4FCEA 3I0CA 4HO6A 4ASYA 3ST8A 1FXJA 2GGOA 1V82A 1ZJ1A 2AE7A 1ZJ2A 4HCQA 4CJCA 1FGXA 2I7BA 1VGTA 1ZJ0A 4AAWA 2WAWA 3CU0A 5AJNA 2V0IA 4FRAA 2FYAA 4KC1A 1R81A 2A8UA 1R7YA 3ZGFA 3N9WA 4HO2A 2Y4KA 1H4DA 1OMZA 2XMEA 2AECA 1VZXA 1INJA 4NANA 2PGVA 1LZ7A 1H7TA 1S4PA 1H5TA 1W55A 1FZWA 2VK9A 1PZYB 1YP4A 3SXCA 5C4EA 5C4BA 2YC3A 4Y7FA 2XMHA 4MYBA 1H7EA 4K6RA 2RIXA 2RJ1A 1G93A 2D7IA 3R3IA 2YQJA 4FRLA 4J18A 1V83A 1ZCTA 2Y4LA 1H5SA 5C38A 4HO4A 5FV9A 3JUJA 3CKJA 2XWLA 3SXDA 4M2BA 3CKNA 1V84A 1QGSA 1S4NA 2VSIA 2XWNA 2MZBA 3POLA 4XWIA 3D5NA 5AJPA 3Q80A 3OC9A 4KNRA 1JV3A 1VGZA 3SXBA 1ZI1A 1GX0A 4EEAA 4EEGA 1MP3A 3IOJA 4KC4A 1VGUA 1W77A 4FRBA 1G2VA 5HS2A 3FWWA 1JV1A 1ZJPA 1LZJA 3TQDA 2XWMA 3SX8A 4DE7A 2X5ZA 3Q7UA 4R7PA 1H4CA 5C3DA 2Y4MA 4EEOA 2WVKA 3I0EA 3I0KA 1MP5A 1GWVA 2BO7A 5CQPA 2WGZA 2VS3A 3OH2A 2E3DA 3SX7A 2YC5A 2YCMA 5C4DA 4EEMA 2D0JA 3CKOA 1FRWA 1FOAA 4Y7UA 3U0YA 2ICXA 4JD0A 4FQWA 1IINA 2WVMA 2AGDA 2JCJA 3DJ4A 1LZ0A 3PKQA 5L6VA 2RIYA 2PX7A 2APCA 3K8DA 4HO5A 5FTSA 4CVHA 1LL3A 4L41C 4EE4A 4B3UA 4ZDQA 3V0PA 3O3PA 4EVWA 4Y62A 4FREA 3SXAA 2Z87A 2JCOA 4MIXA 3F1CA 5J49A 2Q4JA 1WVCA 4CJBA 2P6WA 1H7FA 3PNNA 4UEGA 5FU0A 2Y7AA 4EE5A 1FO8A 2I5EA 5DDVA 1R7TA 1H7LA 5C49A 4Y7VA 2GGQA 3QVBA 1GWWA 4KXOA 4FRHA 4B5BA 4KQLA 4D0TA 1NF5B 4Y64A 5C1GA 3PKPA 1ZJ3A 4DECA 1O23B 3SPTA 1FGGA 1FWYA 2BO6A 5C1LA 3U2UA 1G23A 3V0MA 4O6MA 1OQMB 1VZTA 1Z90A 1QGQA 4KPXA 3OGZA 4HO8A 1HJJA 3CKVA 1WT1A 3U2WA 5C4FA 2J0AA 5C3AA 1MC3A 2VXMA 1JVDA 2UX8A 3I0IX 3V0QA 1H5RB 3Q4SA 3OH0A 2RJ4A 2W0VA 4M28A 4BMAA 1WT3A 1MP4A 5CQNX 2VFZA 5I1FA 1VICA 1H5SC 2YQSA 5JQQA 2AM4A 4HO0A 3SX3A 1ZCYA 1QG8A 1YP3A 5EIYA 3USQA 1VM8A 1SS9A 1LL2A 5C8RA 5EJZA 1O7QA 4KRVA 3T7NA 1G3LA 4KT7A 4Y6NA 2OEGA 1EYRA 1QWJA 4FRQA 4M4KA 2AESA 5FTVA 3JTJA 5D91A 2RJ9A 3GUEA 4B4MA 4M2AA 4FROA 1K4VA 2OI7A 1YP2A 4KNXA 3K8EA 1VZUA 2RJ0A 2WE9A 3V8YA 1HM0A 2X60A 5C47A 4GBPA 4KC2A 1IIMA 1FR9A 5L6SA 4Y7TA 4D48A 5CQLX 2NXVA 4IRQA 3KIAA 2W0WA 1OMXA 4B2WA 4P02A 3DK5A 2FFVA 1TW1A 1ON8A 1FR8A 3V0OA 1FG5N 1LVWA 1WT0A 3E25A 5D92A 1ZDGA 3NGWA 1H5RA 3TZTA 4B4BA 1G97A 2OI5A 2WVLA 1WSZA 2RIZA 1EZIA 1G95A 2AH9A 3I0FA 2DPWA 2RITA 3IOHA 2FY7A 2Y6PA 1LZIA 3V91A 1INIA 1KWSA 2FYCB 1G9RA 1GQCA
chains in the Genus database with same CATH topology
1O0RA 3ZGGA 1ZI5A 4ASJA 4D11A 5BXCA 3V8ZA 3OH1A 4Q7CA 1FO9A 3D8VA 4Y63A 2O1GA 4HOCA 3U2TA 3ZF8A 5FYEA 3U0XA 4G87A 1I52A 4FIXA 1ZIZA 5C48A 5C3BA 4G3PA 4LW3A 1W57A 3R2WA 3ZLLA 3USRA 2YESA 2P72A 3OH4A 2O1HA 5IDTA 2O1FA 1VH1A 3RMVA 3BCVA 1ZHJA 2P73A 4LW6A 4NALA 3U2XA 1XZ6A 2QH5A 3SX5A 4HG6A 2VS5A 4ECMA 4E1KA 4FCUA 1R82A 5IFYA 2OEFA 1O7OA 1ON6A 3SXGA 4MNDA 2D7RA 3D98A 4KPZA 1NMMB 5DDTA 1JYKA 1VPAA 2BO4A 2RJ8A 3I0HA 4AYJA 1WT2A 3RSBA 3U2VA 3EE5A 1ZJOA 3JUKA 4Y7GA 3OAMA 4G3QA 1HM9A 3I0GA 5AJOA 3RMWA 3F1YA 5C1HA 2QGIA 4NAIA 4Y6UA 1FXOA 2V0KA 1TVYA 2A8WA 2C0NA 3OH3A 5CQOA 1NHEB 1E5KA 2X5SA 2Y4JA 1G0RA 1H7QA 2ZU7A 2ZU8A 2WEEA 1ZCVA 3I0LA 1H4EA 4YS8A 5IDSA 2RJ7A 2RJ5A 3E26A 4G3SA 3T7OA 1GA8A 1ZI4A 3SXEA 2JCLA 3HL3A 5FUHA 1R80A 5CMFX 1S4OA 2VXLA 1GQ9A 1ZI3A 4EE3A 4B4GA 3OKRA 5CQMX 2BO8A 1YROB 5CMJA 1JVGA 1HM8A 3ZLKA 4CJ8A 1HJLA 4ARWA 2PGYA 2PA4A 2FYBA 2VD4A 2RJ6A 3I0DA 2V0JA 4AYLA 1LL0A 2AM3A 1HV9A 2FYDB 2V0LA 1VH3A 4B2XA 2ICYA 3DUVA 2JCKA 2VS4A 4IRPA 3BRKX 3V0NA 4AC3A 2QKXA 3LW6A 4FRPA 2I5KA 2J0BA 3I0JA 5CMGX 1H5SD 5FU8A 3T7MA 2VSHA 1PZTA 4P00A 4FRMA 1G8OA 2V0HA 2X65A 1H5TB 4FRDA 1G1LA 1XHBA 2ZU9A 1TZFA 1H3MA 3V0LA 1TW5A 4NAKA 1VGWA 1ZDFA 1GX4A 4O6NA 5CMIA 1ZCUA 2AM5A 1JYLA 1H5SB 1H7HA 4D11C 4HO9A 4Y9XA 1NQIB 1H7GA 4HO3A 1R7XA 5EJ1A 4D0ZA 1NWGB 4C2SA 2CU2A 1NKHB 5C4CA 2YQCA 2YQHA 3IOIA 3CGXA 5CMHA 2Z86A 3FOQA 3CKQA 1R7VA 4BQHA 2E8BA 2OI6A 2FFUA 4JISA 4FIYA 4B42A 4DDZA 5C36A 1R7UA 3V90A 4FCEA 3I0CA 4HO6A 4ASYA 3ST8A 1FXJA 2GGOA 1V82A 1ZJ1A 2AE7A 1ZJ2A 4HCQA 4CJCA 1FGXA 2I7BA 1VGTA 1ZJ0A 4AAWA 2WAWA 3CU0A 5AJNA 2V0IA 4FRAA 2FYAA 4KC1A 1R81A 2A8UA 1R7YA 3ZGFA 3N9WA 4HO2A 2Y4KA 1H4DA 1OMZA 2XMEA 2AECA 1VZXA 1INJA 4NANA 2PGVA 1LZ7A 1H7TA 1S4PA 1H5TA 1W55A 1FZWA 2VK9A 1PZYB 1YP4A 3SXCA 5C4EA 5C4BA 2YC3A 4Y7FA 2XMHA 4MYBA 1H7EA 4K6RA 2RIXA 2RJ1A 1G93A 2D7IA 3R3IA 2YQJA 4FRLA 4J18A 1V83A 1ZCTA 2Y4LA 1H5SA 5C38A 4HO4A 5FV9A 3JUJA 3CKJA 2XWLA 3SXDA 4M2BA 3CKNA 1V84A 1QGSA 1S4NA 2VSIA 2XWNA 2MZBA 3POLA 4XWIA 3D5NA 5AJPA 3Q80A 3OC9A 4KNRA 1JV3A 1VGZA 3SXBA 1ZI1A 1GX0A 4EEAA 4EEGA 1MP3A 3IOJA 4KC4A 1VGUA 1W77A 4FRBA 1G2VA 5HS2A 3FWWA 1JV1A 1ZJPA 1LZJA 3TQDA 2XWMA 3SX8A 4DE7A 2X5ZA 3Q7UA 4R7PA 1H4CA 5C3DA 2Y4MA 4EEOA 2WVKA 3I0EA 3I0KA 1MP5A 1GWVA 2BO7A 5CQPA 2WGZA 2VS3A 3OH2A 2E3DA 3SX7A 2YC5A 2YCMA 5C4DA 4EEMA 2D0JA 3CKOA 1FRWA 1FOAA 4Y7UA 3U0YA 2ICXA 4JD0A 4FQWA 1IINA 2WVMA 2AGDA 2JCJA 3DJ4A 1LZ0A 3PKQA 5L6VA 2RIYA 2PX7A 2APCA 3K8DA 4HO5A 5FTSA 4CVHA 1LL3A 4L41C 4EE4A 4B3UA 4ZDQA 3V0PA 3O3PA 4EVWA 4Y62A 4FREA 3SXAA 2Z87A 2JCOA 4MIXA 3F1CA 5J49A 2Q4JA 1WVCA 4CJBA 2P6WA 1H7FA 3PNNA 4UEGA 5FU0A 2Y7AA 4EE5A 1FO8A 2I5EA 5DDVA 1R7TA 1H7LA 5C49A 4Y7VA 2GGQA 3QVBA 1GWWA 4KXOA 4FRHA 4B5BA 4KQLA 4D0TA 1NF5B 4Y64A 5C1GA 3PKPA 1ZJ3A 4DECA 1O23B 3SPTA 1FGGA 1FWYA 2BO6A 5C1LA 3U2UA 1G23A 3V0MA 4O6MA 1OQMB 1VZTA 1Z90A 1QGQA 4KPXA 3OGZA 4HO8A 1HJJA 3CKVA 1WT1A 3U2WA 5C4FA 2J0AA 5C3AA 1MC3A 2VXMA 1JVDA 2UX8A 3I0IX 3V0QA 1H5RB 3Q4SA 3OH0A 2RJ4A 2W0VA 4M28A 4BMAA 1WT3A 1MP4A 5CQNX 2VFZA 5I1FA 1VICA 1H5SC 2YQSA 5JQQA 2AM4A 4HO0A 3SX3A 1ZCYA 1QG8A 1YP3A 5EIYA 3USQA 1VM8A 1SS9A 1LL2A 5C8RA 5EJZA 1O7QA 4KRVA 3T7NA 1G3LA 4KT7A 4Y6NA 2OEGA 1EYRA 1QWJA 4FRQA 4M4KA 2AESA 5FTVA 3JTJA 5D91A 2RJ9A 3GUEA 4B4MA 4M2AA 4FROA 1K4VA 2OI7A 1YP2A 4KNXA 3K8EA 1VZUA 2RJ0A 2WE9A 3V8YA 1HM0A 2X60A 5C47A 4GBPA 4KC2A 1IIMA 1FR9A 5L6SA 4Y7TA 4D48A 5CQLX 2NXVA 4IRQA 3KIAA 2W0WA 1OMXA 4B2WA 4P02A 3DK5A 2FFVA 1TW1A 1ON8A 1FR8A 3V0OA 1FG5N 1LVWA 1WT0A 3E25A 5D92A 1ZDGA 3NGWA 1H5RA 3TZTA 4B4BA 1G97A 2OI5A 2WVLA 1WSZA 2RIZA 1EZIA 1G95A 2AH9A 3I0FA 2DPWA 2RITA 3IOHA 2FY7A 2Y6PA 1LZIA 3V91A 1INIA 1KWSA 2FYCB 1G9RA 1GQCA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1O0R A;  3ZGG A;  1ZI5 A;  4ASJ A;  4D11 A;  5BXC A;  3V8Z A;  3OH1 A;  1FO9 A;  3D8V A;  4Y63 A;  2O1G A;  4HOC A;  3U2T A;  3ZF8 A;  5FYE A;  3U0X A;  4G87 A;  1I52 A;  1ZIZ A;  5C48 A;  5C3B A;  4G3P A;  4LW3 A;  1W57 A;  3R2W A;  3ZLL A;  3USR A;  2YES A;  2P72 A;  3OH4 A;  2O1H A;  5IDT A;  2O1F A;  1VH1 A;  3RMV A;  3BCV A;  1ZHJ A;  2P73 A;  4LW6 A;  4NAL A;  3U2X A;  1XZ6 A;  2QH5 A;  3SX5 A;  4HG6 A;  2VS5 A;  4ECM A;  4E1K A;  4FCU A;  1R82 A;  5IFY A;  2OEF A;  1O7O A;  1ON6 A;  3SXG A;  4MND A;  2D7R A;  3D98 A;  4KPZ A;  1NMM B;  5DDT A;  1JYK A;  1VPA A;  2BO4 A;  2RJ8 A;  3I0H A;  4AYJ A;  1WT2 A;  3RSB A;  3U2V A;  3EE5 A;  1ZJO A;  3JUK A;  4Y7G A;  3OAM A;  4G3Q A;  1HM9 A;  3I0G A;  5AJO A;  3RMW A;  3F1Y A;  5C1H A;  2QGI A;  4NAI A;  4Y6U A;  1FXO A;  2V0K A;  1TVY A;  2A8W A;  3OH3 A;  5CQO A;  1NHE B;  1E5K A;  2X5S A;  2Y4J A;  1G0R A;  1H7Q A;  2ZU7 A;  2ZU8 A;  2WEE A;  1ZCV A;  3I0L A;  1H4E A;  4YS8 A;  5IDS A;  2RJ7 A;  2RJ5 A;  3E26 A;  4G3S A;  3T7O A;  1GA8 A;  1ZI4 A;  3SXE A;  2JCL A;  3HL3 A;  5FUH A;  1R80 A;  5CMF X;  1S4O A;  2VXL A;  1GQ9 A;  1ZI3 A;  4EE3 A;  4B4G A;  3OKR A;  5CQM X;  2BO8 A;  1YRO B;  5CMJ A;  1JVG A;  1HM8 A;  3ZLK A;  4CJ8 A;  1HJL A;  4ARW A;  2PGY A;  2PA4 A;  2FYB A;  2VD4 A;  2RJ6 A;  3I0D A;  2V0J A;  4AYL A;  1LL0 A;  2AM3 A;  1HV9 A;  2FYD B;  2V0L A;  1VH3 A;  4B2X A;  2ICY A;  3DUV A;  2JCK A;  2VS4 A;  4IRP A;  3BRK X;  3V0N A;  4AC3 A;  2QKX A;  3LW6 A;  4FRP A;  2I5K A;  3I0J A;  5CMG X;  1H5S D;  5FU8 A;  3T7M A;  2VSH A;  1PZT A;  4P00 A;  4FRM A;  1G8O A;  2V0H A;  2X65 A;  1H5T B;  4FRD A;  1G1L A;  1XHB A;  2ZU9 A;  1TZF A;  1H3M A;  3V0L A;  1TW5 A;  4NAK A;  1VGW A;  1ZDF A;  1GX4 A;  5CMI A;  1ZCU A;  2AM5 A;  1JYL A;  1H5S B;  1H7H A;  4D11 C;  4HO9 A;  4Y9X A;  1NQI B;  1H7G A;  4HO3 A;  1R7X A;  5EJ1 A;  4D0Z A;  1NWG B;  4C2S A;  2CU2 A;  1NKH B;  5C4C A;  2YQC A;  2YQH A;  3IOI A;  3CGX A;  5CMH A;  2Z86 A;  3FOQ A;  3CKQ A;  1R7V A;  4BQH A;  2E8B A;  2OI6 A;  2FFU A;  4JIS A;  4B42 A;  4DDZ A;  5C36 A;  1R7U A;  3V90 A;  4FCE A;  3I0C A;  4HO6 A;  4ASY A;  3ST8 A;  1FXJ A;  2GGO A;  1V82 A;  1ZJ1 A;  2AE7 A;  1ZJ2 A;  4HCQ A;  4CJC A;  1FGX A;  2I7B A;  1VGT A;  1ZJ0 A;  4AAW A;  2WAW A;  3CU0 A;  5AJN A;  2V0I A;  4FRA A;  2FYA A;  4KC1 A;  1R81 A;  2A8U A;  1R7Y A;  3ZGF A;  3N9W A;  4HO2 A;  2Y4K A;  1H4D A;  1OMZ A;  2XME A;  2AEC A;  1VZX A;  1INJ A;  4NAN A;  2PGV A;  1LZ7 A;  1H7T A;  1S4P A;  1H5T A;  1W55 A;  1FZW A;  1PZY B;  1YP4 A;  3SXC A;  5C4E A;  5C4B A;  2YC3 A;  4Y7F A;  2XMH A;  4MYB A;  1H7E A;  4K6R A;  2RIX A;  2RJ1 A;  1G93 A;  2D7I A;  3R3I A;  2YQJ A;  4FRL A;  4J18 A;  1V83 A;  1ZCT A;  2Y4L A;  1H5S A;  5C38 A;  4HO4 A;  5FV9 A;  3JUJ A;  3CKJ A;  2XWL A;  3SXD A;  4M2B A;  3CKN A;  1V84 A;  1QGS A;  1S4N A;  2VSI A;  2XWN A;  2MZB A;  3POL A;  4XWI A;  3D5N A;  5AJP A;  3Q80 A;  3OC9 A;  4KNR A;  1JV3 A;  1VGZ A;  3SXB A;  1ZI1 A;  1GX0 A;  4EEA A;  4EEG A;  1MP3 A;  3IOJ A;  4KC4 A;  1VGU A;  1W77 A;  4FRB A;  1G2V A;  5HS2 A;  3FWW A;  1JV1 A;  1ZJP A;  1LZJ A;  3TQD A;  2XWM A;  3SX8 A;  4DE7 A;  2X5Z A;  3Q7U A;  4R7P A;  1H4C A;  5C3D A;  2Y4M A;  4EEO A;  2WVK A;  3I0E A;  3I0K A;  1MP5 A;  1GWV A;  2BO7 A;  5CQP A;  2WGZ A;  2VS3 A;  3OH2 A;  2E3D A;  3SX7 A;  2YC5 A;  2YCM A;  5C4D A;  4EEM A;  2D0J A;  3CKO A;  1FRW A;  1FOA A;  4Y7U A;  3U0Y A;  2ICX A;  4JD0 A;  4FQW A;  1IIN A;  2WVM A;  2AGD A;  2JCJ A;  3DJ4 A;  1LZ0 A;  3PKQ A;  5L6V A;  2RIY A;  2PX7 A;  2APC A;  3K8D A;  4HO5 A;  5FTS A;  4CVH A;  1LL3 A;  4L41 C;  4EE4 A;  4B3U A;  4ZDQ A;  3V0P A;  3O3P A;  4EVW A;  4Y62 A;  4FRE A;  3SXA A;  2Z87 A;  2JCO A;  3F1C A;  5J49 A;  2Q4J A;  1WVC A;  4CJB A;  2P6W A;  1H7F A;  3PNN A;  4UEG A;  5FU0 A;  2Y7A A;  4EE5 A;  1FO8 A;  2I5E A;  5DDV A;  1R7T A;  1H7L A;  5C49 A;  4Y7V A;  2GGQ A;  3QVB A;  1GWW A;  4KXO A;  4FRH A;  4B5B A;  4KQL A;  4D0T A;  1NF5 B;  4Y64 A;  5C1G A;  3PKP A;  1ZJ3 A;  4DEC A;  1O23 B;  3SPT A;  1FGG A;  1FWY A;  2BO6 A;  5C1L A;  3U2U A;  1G23 A;  3V0M A;  1OQM B;  1VZT A;  1Z90 A;  1QGQ A;  4KPX A;  3OGZ A;  4HO8 A;  1HJJ A;  3CKV A;  1WT1 A;  3U2W A;  5C4F A;  5C3A A;  1MC3 A;  2VXM A;  1JVD A;  2UX8 A;  3I0I X;  3V0Q A;  1H5R B;  3Q4S A;  3OH0 A;  2RJ4 A;  2W0V A;  4M28 A;  4BMA A;  1WT3 A;  1MP4 A;  5CQN X;  2VFZ A;  5I1F A;  1VIC A;  1H5S C;  2YQS A;  5JQQ A;  2AM4 A;  4HO0 A;  3SX3 A;  1ZCY A;  1QG8 A;  1YP3 A;  5EIY A;  3USQ A;  1VM8 A;  1SS9 A;  1LL2 A;  5C8R A;  5EJZ A;  1O7Q A;  4KRV A;  3T7N A;  1G3L A;  4KT7 A;  4Y6N A;  2OEG A;  1EYR A;  1QWJ A;  4FRQ A;  4M4K A;  2AES A;  5FTV A;  3JTJ A;  2RJ9 A;  3GUE A;  4B4M A;  4M2A A;  4FRO A;  1K4V A;  2OI7 A;  1YP2 A;  4KNX A;  3K8E A;  1VZU A;  2RJ0 A;  2WE9 A;  3V8Y A;  1HM0 A;  2X60 A;  5C47 A;  4GBP A;  4KC2 A;  1IIM A;  1FR9 A;  5L6S A;  4Y7T A;  4D48 A;  5CQL X;  2NXV A;  4IRQ A;  3KIA A;  2W0W A;  1OMX A;  4B2W A;  4P02 A;  3DK5 A;  2FFV A;  1TW1 A;  1ON8 A;  1FR8 A;  3V0O A;  1FG5 N;  1LVW A;  1WT0 A;  3E25 A;  1ZDG A;  3NGW A;  1H5R A;  3TZT A;  4B4B A;  1G97 A;  2OI5 A;  2WVL A;  1WSZ A;  2RIZ A;  1EZI A;  1G95 A;  2AH9 A;  3I0F A;  2DPW A;  2RIT A;  3IOH A;  2FY7 A;  2Y6P A;  1LZI A;  3V91 A;  1INI A;  1KWS A;  2FYC B;  1G9R A;  1GQC A; 
#chains in the Genus database with same CATH topology
 1O0R A;  3ZGG A;  1ZI5 A;  4ASJ A;  4D11 A;  5BXC A;  3V8Z A;  3OH1 A;  4Q7C A;  1FO9 A;  3D8V A;  4Y63 A;  2O1G A;  4HOC A;  3U2T A;  3ZF8 A;  5FYE A;  3U0X A;  4G87 A;  1I52 A;  4FIX A;  1ZIZ A;  5C48 A;  5C3B A;  4G3P A;  4LW3 A;  1W57 A;  3R2W A;  3ZLL A;  3USR A;  2YES A;  2P72 A;  3OH4 A;  2O1H A;  5IDT A;  2O1F A;  1VH1 A;  3RMV A;  3BCV A;  1ZHJ A;  2P73 A;  4LW6 A;  4NAL A;  3U2X A;  1XZ6 A;  2QH5 A;  3SX5 A;  4HG6 A;  2VS5 A;  4ECM A;  4E1K A;  4FCU A;  1R82 A;  5IFY A;  2OEF A;  1O7O A;  1ON6 A;  3SXG A;  4MND A;  2D7R A;  3D98 A;  4KPZ A;  1NMM B;  5DDT A;  1JYK A;  1VPA A;  2BO4 A;  2RJ8 A;  3I0H A;  4AYJ A;  1WT2 A;  3RSB A;  3U2V A;  3EE5 A;  1ZJO A;  3JUK A;  4Y7G A;  3OAM A;  4G3Q A;  1HM9 A;  3I0G A;  5AJO A;  3RMW A;  3F1Y A;  5C1H A;  2QGI A;  4NAI A;  4Y6U A;  1FXO A;  2V0K A;  1TVY A;  2A8W A;  2C0N A;  3OH3 A;  5CQO A;  1NHE B;  1E5K A;  2X5S A;  2Y4J A;  1G0R A;  1H7Q A;  2ZU7 A;  2ZU8 A;  2WEE A;  1ZCV A;  3I0L A;  1H4E A;  4YS8 A;  5IDS A;  2RJ7 A;  2RJ5 A;  3E26 A;  4G3S A;  3T7O A;  1GA8 A;  1ZI4 A;  3SXE A;  2JCL A;  3HL3 A;  5FUH A;  1R80 A;  5CMF X;  1S4O A;  2VXL A;  1GQ9 A;  1ZI3 A;  4EE3 A;  4B4G A;  3OKR A;  5CQM X;  2BO8 A;  1YRO B;  5CMJ A;  1JVG A;  1HM8 A;  3ZLK A;  4CJ8 A;  1HJL A;  4ARW A;  2PGY A;  2PA4 A;  2FYB A;  2VD4 A;  2RJ6 A;  3I0D A;  2V0J A;  4AYL A;  1LL0 A;  2AM3 A;  1HV9 A;  2FYD B;  2V0L A;  1VH3 A;  4B2X A;  2ICY A;  3DUV A;  2JCK A;  2VS4 A;  4IRP A;  3BRK X;  3V0N A;  4AC3 A;  2QKX A;  3LW6 A;  4FRP A;  2I5K A;  2J0B A;  3I0J A;  5CMG X;  1H5S D;  5FU8 A;  3T7M A;  2VSH A;  1PZT A;  4P00 A;  4FRM A;  1G8O A;  2V0H A;  2X65 A;  1H5T B;  4FRD A;  1G1L A;  1XHB A;  2ZU9 A;  1TZF A;  1H3M A;  3V0L A;  1TW5 A;  4NAK A;  1VGW A;  1ZDF A;  1GX4 A;  4O6N A;  5CMI A;  1ZCU A;  2AM5 A;  1JYL A;  1H5S B;  1H7H A;  4D11 C;  4HO9 A;  4Y9X A;  1NQI B;  1H7G A;  4HO3 A;  1R7X A;  5EJ1 A;  4D0Z A;  1NWG B;  4C2S A;  2CU2 A;  1NKH B;  5C4C A;  2YQC A;  2YQH A;  3IOI A;  3CGX A;  5CMH A;  2Z86 A;  3FOQ A;  3CKQ A;  1R7V A;  4BQH A;  2E8B A;  2OI6 A;  2FFU A;  4JIS A;  4FIY A;  4B42 A;  4DDZ A;  5C36 A;  1R7U A;  3V90 A;  4FCE A;  3I0C A;  4HO6 A;  4ASY A;  3ST8 A;  1FXJ A;  2GGO A;  1V82 A;  1ZJ1 A;  2AE7 A;  1ZJ2 A;  4HCQ A;  4CJC A;  1FGX A;  2I7B A;  1VGT A;  1ZJ0 A;  4AAW A;  2WAW A;  3CU0 A;  5AJN A;  2V0I A;  4FRA A;  2FYA A;  4KC1 A;  1R81 A;  2A8U A;  1R7Y A;  3ZGF A;  3N9W A;  4HO2 A;  2Y4K A;  1H4D A;  1OMZ A;  2XME A;  2AEC A;  1VZX A;  1INJ A;  4NAN A;  2PGV A;  1LZ7 A;  1H7T A;  1S4P A;  1H5T A;  1W55 A;  1FZW A;  2VK9 A;  1PZY B;  1YP4 A;  3SXC A;  5C4E A;  5C4B A;  2YC3 A;  4Y7F A;  2XMH A;  4MYB A;  1H7E A;  4K6R A;  2RIX A;  2RJ1 A;  1G93 A;  2D7I A;  3R3I A;  2YQJ A;  4FRL A;  4J18 A;  1V83 A;  1ZCT A;  2Y4L A;  1H5S A;  5C38 A;  4HO4 A;  5FV9 A;  3JUJ A;  3CKJ A;  2XWL A;  3SXD A;  4M2B A;  3CKN A;  1V84 A;  1QGS A;  1S4N A;  2VSI A;  2XWN A;  2MZB A;  3POL A;  4XWI A;  3D5N A;  5AJP A;  3Q80 A;  3OC9 A;  4KNR A;  1JV3 A;  1VGZ A;  3SXB A;  1ZI1 A;  1GX0 A;  4EEA A;  4EEG A;  1MP3 A;  3IOJ A;  4KC4 A;  1VGU A;  1W77 A;  4FRB A;  1G2V A;  5HS2 A;  3FWW A;  1JV1 A;  1ZJP A;  1LZJ A;  3TQD A;  2XWM A;  3SX8 A;  4DE7 A;  2X5Z A;  3Q7U A;  4R7P A;  1H4C A;  5C3D A;  2Y4M A;  4EEO A;  2WVK A;  3I0E A;  3I0K A;  1MP5 A;  1GWV A;  2BO7 A;  5CQP A;  2WGZ A;  2VS3 A;  3OH2 A;  2E3D A;  3SX7 A;  2YC5 A;  2YCM A;  5C4D A;  4EEM A;  2D0J A;  3CKO A;  1FRW A;  1FOA A;  4Y7U A;  3U0Y A;  2ICX A;  4JD0 A;  4FQW A;  1IIN A;  2WVM A;  2AGD A;  2JCJ A;  3DJ4 A;  1LZ0 A;  3PKQ A;  5L6V A;  2RIY A;  2PX7 A;  2APC A;  3K8D A;  4HO5 A;  5FTS A;  4CVH A;  1LL3 A;  4L41 C;  4EE4 A;  4B3U A;  4ZDQ A;  3V0P A;  3O3P A;  4EVW A;  4Y62 A;  4FRE A;  3SXA A;  2Z87 A;  2JCO A;  4MIX A;  3F1C A;  5J49 A;  2Q4J A;  1WVC A;  4CJB A;  2P6W A;  1H7F A;  3PNN A;  4UEG A;  5FU0 A;  2Y7A A;  4EE5 A;  1FO8 A;  2I5E A;  5DDV A;  1R7T A;  1H7L A;  5C49 A;  4Y7V A;  2GGQ A;  3QVB A;  1GWW A;  4KXO A;  4FRH A;  4B5B A;  4KQL A;  4D0T A;  1NF5 B;  4Y64 A;  5C1G A;  3PKP A;  1ZJ3 A;  4DEC A;  1O23 B;  3SPT A;  1FGG A;  1FWY A;  2BO6 A;  5C1L A;  3U2U A;  1G23 A;  3V0M A;  4O6M A;  1OQM B;  1VZT A;  1Z90 A;  1QGQ A;  4KPX A;  3OGZ A;  4HO8 A;  1HJJ A;  3CKV A;  1WT1 A;  3U2W A;  5C4F A;  2J0A A;  5C3A A;  1MC3 A;  2VXM A;  1JVD A;  2UX8 A;  3I0I X;  3V0Q A;  1H5R B;  3Q4S A;  3OH0 A;  2RJ4 A;  2W0V A;  4M28 A;  4BMA A;  1WT3 A;  1MP4 A;  5CQN X;  2VFZ A;  5I1F A;  1VIC A;  1H5S C;  2YQS A;  5JQQ A;  2AM4 A;  4HO0 A;  3SX3 A;  1ZCY A;  1QG8 A;  1YP3 A;  5EIY A;  3USQ A;  1VM8 A;  1SS9 A;  1LL2 A;  5C8R A;  5EJZ A;  1O7Q A;  4KRV A;  3T7N A;  1G3L A;  4KT7 A;  4Y6N A;  2OEG A;  1EYR A;  1QWJ A;  4FRQ A;  4M4K A;  2AES A;  5FTV A;  3JTJ A;  5D91 A;  2RJ9 A;  3GUE A;  4B4M A;  4M2A A;  4FRO A;  1K4V A;  2OI7 A;  1YP2 A;  4KNX A;  3K8E A;  1VZU A;  2RJ0 A;  2WE9 A;  3V8Y A;  1HM0 A;  2X60 A;  5C47 A;  4GBP A;  4KC2 A;  1IIM A;  1FR9 A;  5L6S A;  4Y7T A;  4D48 A;  5CQL X;  2NXV A;  4IRQ A;  3KIA A;  2W0W A;  1OMX A;  4B2W A;  4P02 A;  3DK5 A;  2FFV A;  1TW1 A;  1ON8 A;  1FR8 A;  3V0O A;  1FG5 N;  1LVW A;  1WT0 A;  3E25 A;  5D92 A;  1ZDG A;  3NGW A;  1H5R A;  3TZT A;  4B4B A;  1G97 A;  2OI5 A;  2WVL A;  1WSZ A;  2RIZ A;  1EZI A;  1G95 A;  2AH9 A;  3I0F A;  2DPW A;  2RIT A;  3IOH A;  2FY7 A;  2Y6P A;  1LZI A;  3V91 A;  1INI A;  1KWS A;  2FYC B;  1G9R A;  1GQC A; 
#chains in the Genus database with same CATH homology
 1O0R A;  3ZGG A;  1ZI5 A;  4ASJ A;  4D11 A;  5BXC A;  3V8Z A;  3OH1 A;  4Q7C A;  1FO9 A;  3D8V A;  4Y63 A;  2O1G A;  4HOC A;  3U2T A;  3ZF8 A;  5FYE A;  3U0X A;  4G87 A;  1I52 A;  4FIX A;  1ZIZ A;  5C48 A;  5C3B A;  4G3P A;  4LW3 A;  1W57 A;  3R2W A;  3ZLL A;  3USR A;  2YES A;  2P72 A;  3OH4 A;  2O1H A;  5IDT A;  2O1F A;  1VH1 A;  3RMV A;  3BCV A;  1ZHJ A;  2P73 A;  4LW6 A;  4NAL A;  3U2X A;  1XZ6 A;  2QH5 A;  3SX5 A;  4HG6 A;  2VS5 A;  4ECM A;  4E1K A;  4FCU A;  1R82 A;  5IFY A;  2OEF A;  1O7O A;  1ON6 A;  3SXG A;  4MND A;  2D7R A;  3D98 A;  4KPZ A;  1NMM B;  5DDT A;  1JYK A;  1VPA A;  2BO4 A;  2RJ8 A;  3I0H A;  4AYJ A;  1WT2 A;  3RSB A;  3U2V A;  3EE5 A;  1ZJO A;  3JUK A;  4Y7G A;  3OAM A;  4G3Q A;  1HM9 A;  3I0G A;  5AJO A;  3RMW A;  3F1Y A;  5C1H A;  2QGI A;  4NAI A;  4Y6U A;  1FXO A;  2V0K A;  1TVY A;  2A8W A;  2C0N A;  3OH3 A;  5CQO A;  1NHE B;  1E5K A;  2X5S A;  2Y4J A;  1G0R A;  1H7Q A;  2ZU7 A;  2ZU8 A;  2WEE A;  1ZCV A;  3I0L A;  1H4E A;  4YS8 A;  5IDS A;  2RJ7 A;  2RJ5 A;  3E26 A;  4G3S A;  3T7O A;  1GA8 A;  1ZI4 A;  3SXE A;  2JCL A;  3HL3 A;  5FUH A;  1R80 A;  5CMF X;  1S4O A;  2VXL A;  1GQ9 A;  1ZI3 A;  4EE3 A;  4B4G A;  3OKR A;  5CQM X;  2BO8 A;  1YRO B;  5CMJ A;  1JVG A;  1HM8 A;  3ZLK A;  4CJ8 A;  1HJL A;  4ARW A;  2PGY A;  2PA4 A;  2FYB A;  2VD4 A;  2RJ6 A;  3I0D A;  2V0J A;  4AYL A;  1LL0 A;  2AM3 A;  1HV9 A;  2FYD B;  2V0L A;  1VH3 A;  4B2X A;  2ICY A;  3DUV A;  2JCK A;  2VS4 A;  4IRP A;  3BRK X;  3V0N A;  4AC3 A;  2QKX A;  3LW6 A;  4FRP A;  2I5K A;  2J0B A;  3I0J A;  5CMG X;  1H5S D;  5FU8 A;  3T7M A;  2VSH A;  1PZT A;  4P00 A;  4FRM A;  1G8O A;  2V0H A;  2X65 A;  1H5T B;  4FRD A;  1G1L A;  1XHB A;  2ZU9 A;  1TZF A;  1H3M A;  3V0L A;  1TW5 A;  4NAK A;  1VGW A;  1ZDF A;  1GX4 A;  4O6N A;  5CMI A;  1ZCU A;  2AM5 A;  1JYL A;  1H5S B;  1H7H A;  4D11 C;  4HO9 A;  4Y9X A;  1NQI B;  1H7G A;  4HO3 A;  1R7X A;  5EJ1 A;  4D0Z A;  1NWG B;  4C2S A;  2CU2 A;  1NKH B;  5C4C A;  2YQC A;  2YQH A;  3IOI A;  3CGX A;  5CMH A;  2Z86 A;  3FOQ A;  3CKQ A;  1R7V A;  4BQH A;  2E8B A;  2OI6 A;  2FFU A;  4JIS A;  4FIY A;  4B42 A;  4DDZ A;  5C36 A;  1R7U A;  3V90 A;  4FCE A;  3I0C A;  4HO6 A;  4ASY A;  3ST8 A;  1FXJ A;  2GGO A;  1V82 A;  1ZJ1 A;  2AE7 A;  1ZJ2 A;  4HCQ A;  4CJC A;  1FGX A;  2I7B A;  1VGT A;  1ZJ0 A;  4AAW A;  2WAW A;  3CU0 A;  5AJN A;  2V0I A;  4FRA A;  2FYA A;  4KC1 A;  1R81 A;  2A8U A;  1R7Y A;  3ZGF A;  3N9W A;  4HO2 A;  2Y4K A;  1H4D A;  1OMZ A;  2XME A;  2AEC A;  1VZX A;  1INJ A;  4NAN A;  2PGV A;  1LZ7 A;  1H7T A;  1S4P A;  1H5T A;  1W55 A;  1FZW A;  2VK9 A;  1PZY B;  1YP4 A;  3SXC A;  5C4E A;  5C4B A;  2YC3 A;  4Y7F A;  2XMH A;  4MYB A;  1H7E A;  4K6R A;  2RIX A;  2RJ1 A;  1G93 A;  2D7I A;  3R3I A;  2YQJ A;  4FRL A;  4J18 A;  1V83 A;  1ZCT A;  2Y4L A;  1H5S A;  5C38 A;  4HO4 A;  5FV9 A;  3JUJ A;  3CKJ A;  2XWL A;  3SXD A;  4M2B A;  3CKN A;  1V84 A;  1QGS A;  1S4N A;  2VSI A;  2XWN A;  2MZB A;  3POL A;  4XWI A;  3D5N A;  5AJP A;  3Q80 A;  3OC9 A;  4KNR A;  1JV3 A;  1VGZ A;  3SXB A;  1ZI1 A;  1GX0 A;  4EEA A;  4EEG A;  1MP3 A;  3IOJ A;  4KC4 A;  1VGU A;  1W77 A;  4FRB A;  1G2V A;  5HS2 A;  3FWW A;  1JV1 A;  1ZJP A;  1LZJ A;  3TQD A;  2XWM A;  3SX8 A;  4DE7 A;  2X5Z A;  3Q7U A;  4R7P A;  1H4C A;  5C3D A;  2Y4M A;  4EEO A;  2WVK A;  3I0E A;  3I0K A;  1MP5 A;  1GWV A;  2BO7 A;  5CQP A;  2WGZ A;  2VS3 A;  3OH2 A;  2E3D A;  3SX7 A;  2YC5 A;  2YCM A;  5C4D A;  4EEM A;  2D0J A;  3CKO A;  1FRW A;  1FOA A;  4Y7U A;  3U0Y A;  2ICX A;  4JD0 A;  4FQW A;  1IIN A;  2WVM A;  2AGD A;  2JCJ A;  3DJ4 A;  1LZ0 A;  3PKQ A;  5L6V A;  2RIY A;  2PX7 A;  2APC A;  3K8D A;  4HO5 A;  5FTS A;  4CVH A;  1LL3 A;  4L41 C;  4EE4 A;  4B3U A;  4ZDQ A;  3V0P A;  3O3P A;  4EVW A;  4Y62 A;  4FRE A;  3SXA A;  2Z87 A;  2JCO A;  4MIX A;  3F1C A;  5J49 A;  2Q4J A;  1WVC A;  4CJB A;  2P6W A;  1H7F A;  3PNN A;  4UEG A;  5FU0 A;  2Y7A A;  4EE5 A;  1FO8 A;  2I5E A;  5DDV A;  1R7T A;  1H7L A;  5C49 A;  4Y7V A;  2GGQ A;  3QVB A;  1GWW A;  4KXO A;  4FRH A;  4B5B A;  4KQL A;  4D0T A;  1NF5 B;  4Y64 A;  5C1G A;  3PKP A;  1ZJ3 A;  4DEC A;  1O23 B;  3SPT A;  1FGG A;  1FWY A;  2BO6 A;  5C1L A;  3U2U A;  1G23 A;  3V0M A;  4O6M A;  1OQM B;  1VZT A;  1Z90 A;  1QGQ A;  4KPX A;  3OGZ A;  4HO8 A;  1HJJ A;  3CKV A;  1WT1 A;  3U2W A;  5C4F A;  2J0A A;  5C3A A;  1MC3 A;  2VXM A;  1JVD A;  2UX8 A;  3I0I X;  3V0Q A;  1H5R B;  3Q4S A;  3OH0 A;  2RJ4 A;  2W0V A;  4M28 A;  4BMA A;  1WT3 A;  1MP4 A;  5CQN X;  2VFZ A;  5I1F A;  1VIC A;  1H5S C;  2YQS A;  5JQQ A;  2AM4 A;  4HO0 A;  3SX3 A;  1ZCY A;  1QG8 A;  1YP3 A;  5EIY A;  3USQ A;  1VM8 A;  1SS9 A;  1LL2 A;  5C8R A;  5EJZ A;  1O7Q A;  4KRV A;  3T7N A;  1G3L A;  4KT7 A;  4Y6N A;  2OEG A;  1EYR A;  1QWJ A;  4FRQ A;  4M4K A;  2AES A;  5FTV A;  3JTJ A;  5D91 A;  2RJ9 A;  3GUE A;  4B4M A;  4M2A A;  4FRO A;  1K4V A;  2OI7 A;  1YP2 A;  4KNX A;  3K8E A;  1VZU A;  2RJ0 A;  2WE9 A;  3V8Y A;  1HM0 A;  2X60 A;  5C47 A;  4GBP A;  4KC2 A;  1IIM A;  1FR9 A;  5L6S A;  4Y7T A;  4D48 A;  5CQL X;  2NXV A;  4IRQ A;  3KIA A;  2W0W A;  1OMX A;  4B2W A;  4P02 A;  3DK5 A;  2FFV A;  1TW1 A;  1ON8 A;  1FR8 A;  3V0O A;  1FG5 N;  1LVW A;  1WT0 A;  3E25 A;  5D92 A;  1ZDG A;  3NGW A;  1H5R A;  3TZT A;  4B4B A;  1G97 A;  2OI5 A;  2WVL A;  1WSZ A;  2RIZ A;  1EZI A;  1G95 A;  2AH9 A;  3I0F A;  2DPW A;  2RIT A;  3IOH A;  2FY7 A;  2Y6P A;  1LZI A;  3V91 A;  1INI A;  1KWS A;  2FYC B;  1G9R A;  1GQC A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...