2PA4A

Crystal structure of udp-glucose pyrophosphorylase from corynebacteria glutamicum in complex with magnesium and udp-glucose
Total Genus 91
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
91
sequence length
294
structure length
294
Chain Sequence
VKTVVVPAAGLGTRFLPATKTVPKELLPVVDTPGIELIAAEAAELGATRLAIITAPNKAGVLAHFERSSELEETLMERGKTDQVEIIRRAADLIKAVPVTQDKPLGLGHAVGLAESVLDDDEDVVAVMLPDDLVLPTGVMERMAQVRAEFGGSVLCAVEVSEADVSKYGIFEIEADTKDSDVKKVKGMVEKPAIEDAPSRLAATGRYLLDRKIFDALRRITPGAGGELQLTDAIDLLIDEGHPVHIVIHQGKRHDLGNPGGYIPACVDFGLSHPVYGAQLKDAIKQILAEHEAA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords UTP-GLUCOSE-1-PHOSPHATE URIDYLYLTRANSFERASE
publication title Active site geometry of glucose-1-phosphate uridylyltransferase.
pubmed doi rcsb
source organism Corynebacterium glutamicum atcc 13032
total genus 91
structure length 294
sequence length 294
chains with identical sequence B, C, D
ec nomenclature ec 2.7.7.9: UTP--glucose-1-phosphate uridylyltransferase.
pdb deposition date 2007-03-27
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.550.10 Alpha Beta Alpha-Beta Complex Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A 2pa4A00
1LL2A 1NMMB 2X5ZA 2V0JA 3T7MA 1QGQA 1LZIA 2FY7A 2XMHA 2E8BA 3KIAA 3PNNA 4Y64A 1G23A 3D98A 3V8YA 1S4OA 4FREA 4MYBA 5L6VA 3IOJA 1HM8A 4DE7A 1TVYA 5C47A 4HO9A 2Y4LA 3U2XA 3T7OA 1JVDA 4CVHA 2X5SA 3V0PA 1MP4A 5C36A 1OMZA 2X60A 3HL3A 4FCEA 1VGZA 4UEGA 4AYLA 4EEOA 1FXJA 1LZ0A 4FRMA 4EE3A 4HO3A 1IIMA 1H7HA 2AM5A 2ICYA 1WT1A 1ZJ3A 3I0KA 1NHEB 1O7QA 5AJOA 1HM0A 3BCVA 5C4BA 2RJ7A 2RIYA 2VS4A 2AH9A 3JUJA 3K8EA 2RJ4A 5C4EA 2AESA 3ZF8A 2VD4A 2DPWA 2AM3A 2PA4A 2BO8A 1ZIZA 3E26A 4G3QA 1TW1A 4Y7TA 1ZJ2A 4R7PA 1NQIB 5C1GA 5C49A 3CU0A 4J18A 2FYCB 3GUEA 5EJ1A 1OMXA 2YCMA 3I0CA 3O3PA 1R7YA 4HCQA 1QG8A 2MZBA 4KPZA 4HO2A 1TZFA 4KT7A 2WVKA 1ZDFA 2P72A 4BMAA 3U2WA 1V82A 1ZI1A 3Q4SA 1LZJA 1QWJA 2Y6PA 3JTJA 1GA8A 2RITA 4Y62A 3SX3A 4DECA 4B2WA 4JD0A 3LW6A 1G1LA 2X65A 1FRWA 2P6WA 4FROA 1GQ9A 3NGWA 2VSHA 4KPXA 4AYJA 3ST8A 3I0EA 5IDSA 3OH3A 1JV3A 5C38A 5C1LA 5DDVA 1GX0A 3FOQA 2WVLA 3CKVA 5C4DA 4LW3A 1VZTA 1V84A 3RMWA 3ZLLA 1FOAA 3OH1A 1NWGB 1KWSA 2JCOA 2VSIA 2YC3A 2XWMA 4D11C 5BXCA 1EYRA 4NAKA 3V8ZA 1H4EA 2ZU8A 4CJCA 2I7BA 5AJPA 5C3AA 1VH1A 1K4VA 2FYBA 3ZGGA 1ZCTA 5AJNA 2I5KA 2RJ5A 1ZCVA 2ICXA 4B4BA 1NF5B 1VH3A 4NANA 4Y63A 2E3DA 4P00A 3V0QA 1WT3A 4IRPA 1FG5N 3I0DA 1FO9A 4NAIA 3Q7UA 4G87A 1W57A 4B5BA 4ARWA 2Y4KA 5C4CA 1G8OA 1W55A 2XWNA 3V0LA 2PX7A 2PGYA 2AGDA 1R80A 2YESA 4NALA 2Y4JA 2AM4A 1HV9A 3TQDA 1WSZA 2ZU9A 3ZGFA 3I0GA 1ZJPA 1ZJ0A 3U2TA 1O0RA 2OEGA 3EE5A 3SXAA 3OH2A 4FRLA 4D0ZA 5C4FA 2I5EA 2O1GA 2QKXA 2RJ9A 1GX4A 1WT0A 3IOIA 2W0VA 1ZI3A 1GWWA 3CKQA 2JCKA 3OGZA 2Z86A 3I0IX 4MNDA 4FRQA 2D7IA 2XWLA 1G3LA 3CKNA 5CMIA 1ZJ1A 5CMFX 5IFYA 4KXOA 5C8RA 4KQLA 5IDTA 4B3UA 3SXDA 5CMHA 1G9RA 1WT2A 5CQPA 5HS2A 2XMEA 4KNXA 1FR8A 1G0RA 1HJLA 2RJ0A 2RJ6A 1INJA 3SXBA 3FWWA 1EZIA 4HOCA 2NXVA 3D8VA 3RSBA 2OI7A 1ZDGA 4K6RA 4G3SA 1V83A 1G2VA 1R7VA 2Y7AA 4M2BA 1XZ6A 3SXEA 1NKHB 4LW6A 2YC5A 1R7UA 2UX8A 1G95A 4M4KA 3PKPA 3U2VA 5EIYA 3F1YA 1FGXA 3U0XA 5CQMX 3POLA 3JUKA 1R82A 4D11A 3U0YA 4Y6UA 2V0HA 4FRAA 2BO7A 4EEMA 5FYEA 5FV9A 1Z90A 5J49A 1H5RB 3SXGA 4GBPA 4KRVA 4B4MA 5CMJA 5I1FA 5C48A 1ZCYA 2APCA 2YQCA 1R7XA 2AE7A 2OEFA 1JVGA 2VS5A 4CJBA 4D48A 4Y6NA 1YP4A 3OAMA 2VXLA 4HO0A 3OC9A 1FWYA 1O7OA 4XWIA 2WGZA 4DDZA 1FGGA 3N9WA 4FRBA 3CKJA 4FRHA 4AC3A 5JQQA 3QVBA 2GGQA 4P02A 3I0LA 1H5TB 1VGWA 1H7TA 2PGVA 1VICA 3PKQA 1ZI5A 2V0KA 4B2XA 3OH0A 4FRDA 2W0WA 3OH4A 1FR9A 1YP3A 1H7LA 2V0LA 3K8DA 2FFUA 3SX5A 4HG6A 3ZLKA 2RJ8A 1ON6A 3SX7A 4ECMA 3DK5A 5C1HA 1INIA 1H5RA 1LL3A 1H7GA 1JYLA 5FU8A 2JCLA 1MC3A 4YS8A 1R81A 1H3MA 2Q4JA 1TW5A 2QGIA 2WEEA 2JCJA 1LL0A 3I0HA 1OQMB 1PZTA 3DUVA 3CGXA 4KNRA 4ASYA 4D0TA 4E1KA 4Y7GA 2BO4A 1G97A 1H5SC 2QH5A 2AECA 1H7FA 1HM9A 2OI5A 3T7NA 2CU2A 2O1FA 3V0NA 2ZU7A 1SS9A 5L6SA 4HO4A 5FU0A 2VS3A 2P73A 1H5TA 4FQWA 1PZYB 2GGOA 3V0OA 4KC2A 4EEGA 3SPTA 1FXOA 3RMVA 1JYKA 4ASJA 4KC1A 4EE4A 4AAWA 3V90A 3OKRA 3I0FA 3V0MA 1VM8A 2YQHA 3Q80A 4CJ8A 1VZUA 1ZI4A 1G93A 1JV1A 1S4PA 1VGTA 4G3PA 3CKOA 1ZHJA 1GWVA 4Y7VA 3BRKX 5FUHA 4B42A 2FFVA 2WE9A 1H5SD 1MP3A 2RIXA 1ON8A 3USRA 1FZWA 4M28A 4BQHA 4C2SA 2Z87A 4HO6A 1VZXA 1IINA 1H7QA 4ZDQA 1WVCA 1ZCUA 5FTVA 2D7RA 1VPAA 3R3IA 3U2UA 4EE5A 1H5SB 2VFZA 1H4CA 4HO5A 4FRPA 5EJZA 2VXMA 5CMGX 2RJ1A 4Y7UA 5C3BA 3TZTA 1W77A 4KC4A 2A8UA 4EEAA 4JISA 1LVWA 1E5KA 2WVMA 5FTSA 2YQSA 1S4NA 1ZJOA 2BO6A 5C3DA 2YQJA 3F1CA 1FO8A 2RIZA 2V0IA 1I52A 4Y7FA 4M2AA 4EVWA 3SXCA 3D5NA 4IRQA 2FYDB 1HJJA 1XHBA 3V91A 2D0JA 2OI6A 5DDTA 4L41C 2Y4MA 5CQLX 2WAWA 1GQCA 1LZ7A 5CQOA 4B4GA 4Y9XA 3USQA 3SX8A 1QGSA 1YP2A 2A8WA 1O23B 1YROB 1H5SA 2O1HA 3I0JA 5CQNX 1H4DA 1VGUA 3R2WA 3IOHA 1MP5A 2FYAA 4FCUA 3DJ4A 4HO8A 1H7EA 1R7TA 3E25A
chains in the Genus database with same CATH superfamily
1LL2A 1NMMB 2X5ZA 2V0JA 3T7MA 1QGQA 1LZIA 2FY7A 2XMHA 2E8BA 3KIAA 3PNNA 4Y64A 1G23A 3D98A 3V8YA 1S4OA 4FREA 4MYBA 5L6VA 3IOJA 1HM8A 4DE7A 1TVYA 5C47A 4HO9A 2J0BA 2Y4LA 3U2XA 3T7OA 1JVDA 4FIXA 4CVHA 2X5SA 3V0PA 1MP4A 5C36A 1OMZA 2X60A 3HL3A 4FCEA 1VGZA 4UEGA 4AYLA 4EEOA 1FXJA 1LZ0A 4FRMA 4EE3A 4HO3A 1IIMA 1H7HA 2AM5A 2ICYA 1WT1A 1ZJ3A 3I0KA 1NHEB 1O7QA 5AJOA 1HM0A 3BCVA 5C4BA 2RJ7A 2RIYA 2VS4A 2AH9A 3JUJA 3K8EA 2RJ4A 5C4EA 2AESA 3ZF8A 2VD4A 2DPWA 2AM3A 2PA4A 2BO8A 1ZIZA 3E26A 4G3QA 1TW1A 4Y7TA 1ZJ2A 4R7PA 1NQIB 5C1GA 5C49A 3CU0A 4J18A 2FYCB 3GUEA 5EJ1A 1OMXA 2YCMA 3I0CA 3O3PA 1R7YA 4HCQA 1QG8A 2MZBA 4KPZA 4HO2A 1TZFA 4KT7A 2WVKA 1ZDFA 2P72A 4BMAA 3U2WA 1V82A 1ZI1A 3Q4SA 1LZJA 1QWJA 2Y6PA 3JTJA 1GA8A 2RITA 4Y62A 3SX3A 4DECA 4B2WA 4JD0A 5D92A 3LW6A 1G1LA 2X65A 1FRWA 2P6WA 4FROA 1GQ9A 3NGWA 2J0AA 2VSHA 4KPXA 4AYJA 3ST8A 3I0EA 5IDSA 3OH3A 1JV3A 5C38A 5C1LA 5DDVA 1GX0A 3FOQA 2WVLA 3CKVA 5C4DA 4LW3A 1VZTA 1V84A 3RMWA 3ZLLA 1FOAA 3OH1A 1NWGB 1KWSA 2JCOA 2VSIA 2YC3A 2XWMA 4D11C 5BXCA 1EYRA 4NAKA 3V8ZA 1H4EA 2ZU8A 4CJCA 2I7BA 5AJPA 5C3AA 1VH1A 1K4VA 2FYBA 3ZGGA 1ZCTA 5AJNA 2I5KA 2RJ5A 1ZCVA 2ICXA 4B4BA 1NF5B 1VH3A 4NANA 4Y63A 2E3DA 4P00A 3V0QA 1WT3A 4IRPA 1FG5N 3I0DA 1FO9A 4NAIA 3Q7UA 4G87A 4Q7CA 1W57A 4B5BA 4ARWA 2Y4KA 5C4CA 1G8OA 1W55A 2XWNA 3V0LA 2PX7A 2PGYA 2AGDA 1R80A 2YESA 4NALA 2Y4JA 2AM4A 1HV9A 3TQDA 1WSZA 2ZU9A 3ZGFA 3I0GA 1ZJPA 1ZJ0A 3U2TA 1O0RA 2OEGA 3EE5A 3SXAA 3OH2A 4FRLA 4D0ZA 5C4FA 2I5EA 2O1GA 2QKXA 2RJ9A 1GX4A 1WT0A 3IOIA 2W0VA 1ZI3A 1GWWA 3CKQA 2JCKA 3OGZA 2Z86A 3I0IX 4MNDA 4FRQA 2D7IA 2XWLA 1G3LA 3CKNA 5CMIA 1ZJ1A 5CMFX 5IFYA 4KXOA 5C8RA 4KQLA 5IDTA 4B3UA 3SXDA 5CMHA 1G9RA 1WT2A 5CQPA 5HS2A 2XMEA 4KNXA 1FR8A 1G0RA 1HJLA 2RJ0A 2RJ6A 1INJA 3SXBA 3FWWA 1EZIA 4HOCA 2NXVA 3D8VA 3RSBA 2OI7A 1ZDGA 4K6RA 4G3SA 1V83A 1G2VA 1R7VA 2Y7AA 4M2BA 1XZ6A 3SXEA 1NKHB 4LW6A 2YC5A 1R7UA 2UX8A 1G95A 4M4KA 3PKPA 3U2VA 5EIYA 3F1YA 1FGXA 3U0XA 5CQMX 3POLA 3JUKA 1R82A 4D11A 3U0YA 4Y6UA 2V0HA 4FRAA 4MIXA 2BO7A 4EEMA 5FYEA 5FV9A 1Z90A 5J49A 1H5RB 3SXGA 4GBPA 4KRVA 4B4MA 5CMJA 5I1FA 5C48A 1ZCYA 2APCA 2YQCA 1R7XA 2AE7A 2OEFA 1JVGA 2VS5A 4CJBA 4D48A 4Y6NA 1YP4A 3OAMA 2VXLA 4HO0A 3OC9A 1FWYA 1O7OA 4XWIA 2WGZA 4DDZA 1FGGA 3N9WA 4FRBA 3CKJA 4FRHA 4AC3A 5JQQA 3QVBA 2GGQA 4P02A 3I0LA 1H5TB 1VGWA 1H7TA 2PGVA 1VICA 3PKQA 1ZI5A 2V0KA 4B2XA 3OH0A 4FRDA 2W0WA 3OH4A 1FR9A 1YP3A 1H7LA 2V0LA 3K8DA 2FFUA 3SX5A 4HG6A 3ZLKA 2RJ8A 1ON6A 3SX7A 4ECMA 3DK5A 5C1HA 1INIA 1H5RA 1LL3A 1H7GA 1JYLA 5FU8A 2JCLA 1MC3A 4YS8A 1R81A 1H3MA 2Q4JA 1TW5A 2QGIA 2WEEA 2JCJA 1LL0A 3I0HA 1OQMB 1PZTA 3DUVA 3CGXA 4KNRA 4ASYA 4D0TA 4E1KA 4Y7GA 2BO4A 1G97A 1H5SC 2QH5A 2AECA 1H7FA 1HM9A 2OI5A 3T7NA 2CU2A 2O1FA 3V0NA 2ZU7A 1SS9A 5L6SA 4HO4A 5FU0A 2VS3A 2P73A 1H5TA 4FQWA 1PZYB 2GGOA 3V0OA 4KC2A 4EEGA 3SPTA 1FXOA 3RMVA 1JYKA 4ASJA 4KC1A 4EE4A 4AAWA 3V90A 3OKRA 3I0FA 3V0MA 1VM8A 2YQHA 3Q80A 4CJ8A 1VZUA 1ZI4A 1G93A 1JV1A 1S4PA 1VGTA 4G3PA 3CKOA 1ZHJA 1GWVA 4Y7VA 3BRKX 5FUHA 4B42A 2FFVA 2WE9A 1H5SD 1MP3A 2RIXA 1ON8A 3USRA 1FZWA 4M28A 4BQHA 4C2SA 2Z87A 4HO6A 1VZXA 1IINA 1H7QA 4ZDQA 1WVCA 1ZCUA 5FTVA 2D7RA 1VPAA 3R3IA 3U2UA 4EE5A 1H5SB 2VFZA 1H4CA 4O6NA 4HO5A 4FRPA 5EJZA 2VK9A 2VXMA 5CMGX 2RJ1A 4Y7UA 5C3BA 3TZTA 1W77A 4KC4A 2A8UA 4EEAA 4JISA 1LVWA 1E5KA 2WVMA 5FTSA 2YQSA 1S4NA 1ZJOA 2BO6A 5C3DA 2YQJA 3F1CA 1FO8A 2RIZA 2V0IA 4FIYA 1I52A 4Y7FA 4M2AA 4EVWA 3SXCA 3D5NA 4IRQA 2FYDB 1HJJA 1XHBA 3V91A 2D0JA 2C0NA 2OI6A 5DDTA 4L41C 2Y4MA 5CQLX 2WAWA 1GQCA 1LZ7A 5CQOA 4O6MA 4B4GA 4Y9XA 3USQA 3SX8A 1QGSA 1YP2A 2A8WA 1O23B 1YROB 1H5SA 2O1HA 3I0JA 5CQNX 1H4DA 1VGUA 3R2WA 3IOHA 5D91A 1MP5A 2FYAA 4FCUA 3DJ4A 4HO8A 1H7EA 1R7TA 3E25A
chains in the Genus database with same CATH topology
1LL2A 1NMMB 2X5ZA 2V0JA 3T7MA 1QGQA 1LZIA 2FY7A 2XMHA 2E8BA 3KIAA 3PNNA 4Y64A 1G23A 3D98A 3V8YA 1S4OA 4FREA 4MYBA 5L6VA 3IOJA 1HM8A 4DE7A 1TVYA 5C47A 4HO9A 2J0BA 2Y4LA 3U2XA 3T7OA 1JVDA 4FIXA 4CVHA 2X5SA 3V0PA 1MP4A 5C36A 1OMZA 2X60A 3HL3A 4FCEA 1VGZA 4UEGA 4AYLA 4EEOA 1FXJA 1LZ0A 4FRMA 4EE3A 4HO3A 1IIMA 1H7HA 2AM5A 2ICYA 1WT1A 1ZJ3A 3I0KA 1NHEB 1O7QA 5AJOA 1HM0A 3BCVA 5C4BA 2RJ7A 2RIYA 2VS4A 2AH9A 3JUJA 3K8EA 2RJ4A 5C4EA 2AESA 3ZF8A 2VD4A 2DPWA 2AM3A 2PA4A 2BO8A 1ZIZA 3E26A 4G3QA 1TW1A 4Y7TA 1ZJ2A 4R7PA 1NQIB 5C1GA 5C49A 3CU0A 4J18A 2FYCB 3GUEA 5EJ1A 1OMXA 2YCMA 3I0CA 3O3PA 1R7YA 4HCQA 1QG8A 2MZBA 4KPZA 4HO2A 1TZFA 4KT7A 2WVKA 1ZDFA 2P72A 4BMAA 3U2WA 1V82A 1ZI1A 3Q4SA 1LZJA 1QWJA 2Y6PA 3JTJA 1GA8A 2RITA 4Y62A 3SX3A 4DECA 4B2WA 4JD0A 5D92A 3LW6A 1G1LA 2X65A 1FRWA 2P6WA 4FROA 1GQ9A 3NGWA 2J0AA 2VSHA 4KPXA 4AYJA 3ST8A 3I0EA 5IDSA 3OH3A 1JV3A 5C38A 5C1LA 5DDVA 1GX0A 3FOQA 2WVLA 3CKVA 5C4DA 4LW3A 1VZTA 1V84A 3RMWA 3ZLLA 1FOAA 3OH1A 1NWGB 1KWSA 2JCOA 2VSIA 2YC3A 2XWMA 4D11C 5BXCA 1EYRA 4NAKA 3V8ZA 1H4EA 2ZU8A 4CJCA 2I7BA 5AJPA 5C3AA 1VH1A 1K4VA 2FYBA 3ZGGA 1ZCTA 5AJNA 2I5KA 2RJ5A 1ZCVA 2ICXA 4B4BA 1NF5B 1VH3A 4NANA 4Y63A 2E3DA 4P00A 3V0QA 1WT3A 4IRPA 1FG5N 3I0DA 1FO9A 4NAIA 3Q7UA 4G87A 4Q7CA 1W57A 4B5BA 4ARWA 2Y4KA 5C4CA 1G8OA 1W55A 2XWNA 3V0LA 2PX7A 2PGYA 2AGDA 1R80A 2YESA 4NALA 2Y4JA 2AM4A 1HV9A 3TQDA 1WSZA 2ZU9A 3ZGFA 3I0GA 1ZJPA 1ZJ0A 3U2TA 1O0RA 2OEGA 3EE5A 3SXAA 3OH2A 4FRLA 4D0ZA 5C4FA 2I5EA 2O1GA 2QKXA 2RJ9A 1GX4A 1WT0A 3IOIA 2W0VA 1ZI3A 1GWWA 3CKQA 2JCKA 3OGZA 2Z86A 3I0IX 4MNDA 4FRQA 2D7IA 2XWLA 1G3LA 3CKNA 5CMIA 1ZJ1A 5CMFX 5IFYA 4KXOA 5C8RA 4KQLA 5IDTA 4B3UA 3SXDA 5CMHA 1G9RA 1WT2A 5CQPA 5HS2A 2XMEA 4KNXA 1FR8A 1G0RA 1HJLA 2RJ0A 2RJ6A 1INJA 3SXBA 3FWWA 1EZIA 4HOCA 2NXVA 3D8VA 3RSBA 2OI7A 1ZDGA 4K6RA 4G3SA 1V83A 1G2VA 1R7VA 2Y7AA 4M2BA 1XZ6A 3SXEA 1NKHB 4LW6A 2YC5A 1R7UA 2UX8A 1G95A 4M4KA 3PKPA 3U2VA 5EIYA 3F1YA 1FGXA 3U0XA 5CQMX 3POLA 3JUKA 1R82A 4D11A 3U0YA 4Y6UA 2V0HA 4FRAA 4MIXA 2BO7A 4EEMA 5FYEA 5FV9A 1Z90A 5J49A 1H5RB 3SXGA 4GBPA 4KRVA 4B4MA 5CMJA 5I1FA 5C48A 1ZCYA 2APCA 2YQCA 1R7XA 2AE7A 2OEFA 1JVGA 2VS5A 4CJBA 4D48A 4Y6NA 1YP4A 3OAMA 2VXLA 4HO0A 3OC9A 1FWYA 1O7OA 4XWIA 2WGZA 4DDZA 1FGGA 3N9WA 4FRBA 3CKJA 4FRHA 4AC3A 5JQQA 3QVBA 2GGQA 4P02A 3I0LA 1H5TB 1VGWA 1H7TA 2PGVA 1VICA 3PKQA 1ZI5A 2V0KA 4B2XA 3OH0A 4FRDA 2W0WA 3OH4A 1FR9A 1YP3A 1H7LA 2V0LA 3K8DA 2FFUA 3SX5A 4HG6A 3ZLKA 2RJ8A 1ON6A 3SX7A 4ECMA 3DK5A 5C1HA 1INIA 1H5RA 1LL3A 1H7GA 1JYLA 5FU8A 2JCLA 1MC3A 4YS8A 1R81A 1H3MA 2Q4JA 1TW5A 2QGIA 2WEEA 2JCJA 1LL0A 3I0HA 1OQMB 1PZTA 3DUVA 3CGXA 4KNRA 4ASYA 4D0TA 4E1KA 4Y7GA 2BO4A 1G97A 1H5SC 2QH5A 2AECA 1H7FA 1HM9A 2OI5A 3T7NA 2CU2A 2O1FA 3V0NA 2ZU7A 1SS9A 5L6SA 4HO4A 5FU0A 2VS3A 2P73A 1H5TA 4FQWA 1PZYB 2GGOA 3V0OA 4KC2A 4EEGA 3SPTA 1FXOA 3RMVA 1JYKA 4ASJA 4KC1A 4EE4A 4AAWA 3V90A 3OKRA 3I0FA 3V0MA 1VM8A 2YQHA 3Q80A 4CJ8A 1VZUA 1ZI4A 1G93A 1JV1A 1S4PA 1VGTA 4G3PA 3CKOA 1ZHJA 1GWVA 4Y7VA 3BRKX 5FUHA 4B42A 2FFVA 2WE9A 1H5SD 1MP3A 2RIXA 1ON8A 3USRA 1FZWA 4M28A 4BQHA 4C2SA 2Z87A 4HO6A 1VZXA 1IINA 1H7QA 4ZDQA 1WVCA 1ZCUA 5FTVA 2D7RA 1VPAA 3R3IA 3U2UA 4EE5A 1H5SB 2VFZA 1H4CA 4O6NA 4HO5A 4FRPA 5EJZA 2VK9A 2VXMA 5CMGX 2RJ1A 4Y7UA 5C3BA 3TZTA 1W77A 4KC4A 2A8UA 4EEAA 4JISA 1LVWA 1E5KA 2WVMA 5FTSA 2YQSA 1S4NA 1ZJOA 2BO6A 5C3DA 2YQJA 3F1CA 1FO8A 2RIZA 2V0IA 4FIYA 1I52A 4Y7FA 4M2AA 4EVWA 3SXCA 3D5NA 4IRQA 2FYDB 1HJJA 1XHBA 3V91A 2D0JA 2C0NA 2OI6A 5DDTA 4L41C 2Y4MA 5CQLX 2WAWA 1GQCA 1LZ7A 5CQOA 4O6MA 4B4GA 4Y9XA 3USQA 3SX8A 1QGSA 1YP2A 2A8WA 1O23B 1YROB 1H5SA 2O1HA 3I0JA 5CQNX 1H4DA 1VGUA 3R2WA 3IOHA 5D91A 1MP5A 2FYAA 4FCUA 3DJ4A 4HO8A 1H7EA 1R7TA 3E25A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1LL2 A;  1NMM B;  2X5Z A;  2V0J A;  3T7M A;  1QGQ A;  1LZI A;  2FY7 A;  2XMH A;  2E8B A;  3KIA A;  3PNN A;  4Y64 A;  1G23 A;  3D98 A;  3V8Y A;  1S4O A;  4FRE A;  4MYB A;  5L6V A;  3IOJ A;  1HM8 A;  4DE7 A;  1TVY A;  5C47 A;  4HO9 A;  2Y4L A;  3U2X A;  3T7O A;  1JVD A;  4CVH A;  2X5S A;  3V0P A;  1MP4 A;  5C36 A;  1OMZ A;  2X60 A;  3HL3 A;  4FCE A;  1VGZ A;  4UEG A;  4AYL A;  4EEO A;  1FXJ A;  1LZ0 A;  4FRM A;  4EE3 A;  4HO3 A;  1IIM A;  1H7H A;  2AM5 A;  2ICY A;  1WT1 A;  1ZJ3 A;  3I0K A;  1NHE B;  1O7Q A;  5AJO A;  1HM0 A;  3BCV A;  5C4B A;  2RJ7 A;  2RIY A;  2VS4 A;  2AH9 A;  3JUJ A;  3K8E A;  2RJ4 A;  5C4E A;  2AES A;  3ZF8 A;  2VD4 A;  2DPW A;  2AM3 A;  2PA4 A;  2BO8 A;  1ZIZ A;  3E26 A;  4G3Q A;  1TW1 A;  4Y7T A;  1ZJ2 A;  4R7P A;  1NQI B;  5C1G A;  5C49 A;  3CU0 A;  4J18 A;  2FYC B;  3GUE A;  5EJ1 A;  1OMX A;  2YCM A;  3I0C A;  3O3P A;  1R7Y A;  4HCQ A;  1QG8 A;  2MZB A;  4KPZ A;  4HO2 A;  1TZF A;  4KT7 A;  2WVK A;  1ZDF A;  2P72 A;  4BMA A;  3U2W A;  1V82 A;  1ZI1 A;  3Q4S A;  1LZJ A;  1QWJ A;  2Y6P A;  3JTJ A;  1GA8 A;  2RIT A;  4Y62 A;  3SX3 A;  4DEC A;  4B2W A;  4JD0 A;  3LW6 A;  1G1L A;  2X65 A;  1FRW A;  2P6W A;  4FRO A;  1GQ9 A;  3NGW A;  2VSH A;  4KPX A;  4AYJ A;  3ST8 A;  3I0E A;  5IDS A;  3OH3 A;  1JV3 A;  5C38 A;  5C1L A;  5DDV A;  1GX0 A;  3FOQ A;  2WVL A;  3CKV A;  5C4D A;  4LW3 A;  1VZT A;  1V84 A;  3RMW A;  3ZLL A;  1FOA A;  3OH1 A;  1NWG B;  1KWS A;  2JCO A;  2VSI A;  2YC3 A;  2XWM A;  4D11 C;  5BXC A;  1EYR A;  4NAK A;  3V8Z A;  1H4E A;  2ZU8 A;  4CJC A;  2I7B A;  5AJP A;  5C3A A;  1VH1 A;  1K4V A;  2FYB A;  3ZGG A;  1ZCT A;  5AJN A;  2I5K A;  2RJ5 A;  1ZCV A;  2ICX A;  4B4B A;  1NF5 B;  1VH3 A;  4NAN A;  4Y63 A;  2E3D A;  4P00 A;  3V0Q A;  1WT3 A;  4IRP A;  1FG5 N;  3I0D A;  1FO9 A;  4NAI A;  3Q7U A;  4G87 A;  1W57 A;  4B5B A;  4ARW A;  2Y4K A;  5C4C A;  1G8O A;  1W55 A;  2XWN A;  3V0L A;  2PX7 A;  2PGY A;  2AGD A;  1R80 A;  2YES A;  4NAL A;  2Y4J A;  2AM4 A;  1HV9 A;  3TQD A;  1WSZ A;  2ZU9 A;  3ZGF A;  3I0G A;  1ZJP A;  1ZJ0 A;  3U2T A;  1O0R A;  2OEG A;  3EE5 A;  3SXA A;  3OH2 A;  4FRL A;  4D0Z A;  5C4F A;  2I5E A;  2O1G A;  2QKX A;  2RJ9 A;  1GX4 A;  1WT0 A;  3IOI A;  2W0V A;  1ZI3 A;  1GWW A;  3CKQ A;  2JCK A;  3OGZ A;  2Z86 A;  3I0I X;  4MND A;  4FRQ A;  2D7I A;  2XWL A;  1G3L A;  3CKN A;  5CMI A;  1ZJ1 A;  5CMF X;  5IFY A;  4KXO A;  5C8R A;  4KQL A;  5IDT A;  4B3U A;  3SXD A;  5CMH A;  1G9R A;  1WT2 A;  5CQP A;  5HS2 A;  2XME A;  4KNX A;  1FR8 A;  1G0R A;  1HJL A;  2RJ0 A;  2RJ6 A;  1INJ A;  3SXB A;  3FWW A;  1EZI A;  4HOC A;  2NXV A;  3D8V A;  3RSB A;  2OI7 A;  1ZDG A;  4K6R A;  4G3S A;  1V83 A;  1G2V A;  1R7V A;  2Y7A A;  4M2B A;  1XZ6 A;  3SXE A;  1NKH B;  4LW6 A;  2YC5 A;  1R7U A;  2UX8 A;  1G95 A;  4M4K A;  3PKP A;  3U2V A;  5EIY A;  3F1Y A;  1FGX A;  3U0X A;  5CQM X;  3POL A;  3JUK A;  1R82 A;  4D11 A;  3U0Y A;  4Y6U A;  2V0H A;  4FRA A;  2BO7 A;  4EEM A;  5FYE A;  5FV9 A;  1Z90 A;  5J49 A;  1H5R B;  3SXG A;  4GBP A;  4KRV A;  4B4M A;  5CMJ A;  5I1F A;  5C48 A;  1ZCY A;  2APC A;  2YQC A;  1R7X A;  2AE7 A;  2OEF A;  1JVG A;  2VS5 A;  4CJB A;  4D48 A;  4Y6N A;  1YP4 A;  3OAM A;  2VXL A;  4HO0 A;  3OC9 A;  1FWY A;  1O7O A;  4XWI A;  2WGZ A;  4DDZ A;  1FGG A;  3N9W A;  4FRB A;  3CKJ A;  4FRH A;  4AC3 A;  5JQQ A;  3QVB A;  2GGQ A;  4P02 A;  3I0L A;  1H5T B;  1VGW A;  1H7T A;  2PGV A;  1VIC A;  3PKQ A;  1ZI5 A;  2V0K A;  4B2X A;  3OH0 A;  4FRD A;  2W0W A;  3OH4 A;  1FR9 A;  1YP3 A;  1H7L A;  2V0L A;  3K8D A;  2FFU A;  3SX5 A;  4HG6 A;  3ZLK A;  2RJ8 A;  1ON6 A;  3SX7 A;  4ECM A;  3DK5 A;  5C1H A;  1INI A;  1H5R A;  1LL3 A;  1H7G A;  1JYL A;  5FU8 A;  2JCL A;  1MC3 A;  4YS8 A;  1R81 A;  1H3M A;  2Q4J A;  1TW5 A;  2QGI A;  2WEE A;  2JCJ A;  1LL0 A;  3I0H A;  1OQM B;  1PZT A;  3DUV A;  3CGX A;  4KNR A;  4ASY A;  4D0T A;  4E1K A;  4Y7G A;  2BO4 A;  1G97 A;  1H5S C;  2QH5 A;  2AEC A;  1H7F A;  1HM9 A;  2OI5 A;  3T7N A;  2CU2 A;  2O1F A;  3V0N A;  2ZU7 A;  1SS9 A;  5L6S A;  4HO4 A;  5FU0 A;  2VS3 A;  2P73 A;  1H5T A;  4FQW A;  1PZY B;  2GGO A;  3V0O A;  4KC2 A;  4EEG A;  3SPT A;  1FXO A;  3RMV A;  1JYK A;  4ASJ A;  4KC1 A;  4EE4 A;  4AAW A;  3V90 A;  3OKR A;  3I0F A;  3V0M A;  1VM8 A;  2YQH A;  3Q80 A;  4CJ8 A;  1VZU A;  1ZI4 A;  1G93 A;  1JV1 A;  1S4P A;  1VGT A;  4G3P A;  3CKO A;  1ZHJ A;  1GWV A;  4Y7V A;  3BRK X;  5FUH A;  4B42 A;  2FFV A;  2WE9 A;  1H5S D;  1MP3 A;  2RIX A;  1ON8 A;  3USR A;  1FZW A;  4M28 A;  4BQH A;  4C2S A;  2Z87 A;  4HO6 A;  1VZX A;  1IIN A;  1H7Q A;  4ZDQ A;  1WVC A;  1ZCU A;  5FTV A;  2D7R A;  1VPA A;  3R3I A;  3U2U A;  4EE5 A;  1H5S B;  2VFZ A;  1H4C A;  4HO5 A;  4FRP A;  5EJZ A;  2VXM A;  5CMG X;  2RJ1 A;  4Y7U A;  5C3B A;  3TZT A;  1W77 A;  4KC4 A;  2A8U A;  4EEA A;  4JIS A;  1LVW A;  1E5K A;  2WVM A;  5FTS A;  2YQS A;  1S4N A;  1ZJO A;  2BO6 A;  5C3D A;  2YQJ A;  3F1C A;  1FO8 A;  2RIZ A;  2V0I A;  1I52 A;  4Y7F A;  4M2A A;  4EVW A;  3SXC A;  3D5N A;  4IRQ A;  2FYD B;  1HJJ A;  1XHB A;  3V91 A;  2D0J A;  2OI6 A;  5DDT A;  4L41 C;  2Y4M A;  5CQL X;  2WAW A;  1GQC A;  1LZ7 A;  5CQO A;  4B4G A;  4Y9X A;  3USQ A;  3SX8 A;  1QGS A;  1YP2 A;  2A8W A;  1O23 B;  1YRO B;  1H5S A;  2O1H A;  3I0J A;  5CQN X;  1H4D A;  1VGU A;  3R2W A;  3IOH A;  1MP5 A;  2FYA A;  4FCU A;  3DJ4 A;  4HO8 A;  1H7E A;  1R7T A;  3E25 A; 
#chains in the Genus database with same CATH topology
 1LL2 A;  1NMM B;  2X5Z A;  2V0J A;  3T7M A;  1QGQ A;  1LZI A;  2FY7 A;  2XMH A;  2E8B A;  3KIA A;  3PNN A;  4Y64 A;  1G23 A;  3D98 A;  3V8Y A;  1S4O A;  4FRE A;  4MYB A;  5L6V A;  3IOJ A;  1HM8 A;  4DE7 A;  1TVY A;  5C47 A;  4HO9 A;  2J0B A;  2Y4L A;  3U2X A;  3T7O A;  1JVD A;  4FIX A;  4CVH A;  2X5S A;  3V0P A;  1MP4 A;  5C36 A;  1OMZ A;  2X60 A;  3HL3 A;  4FCE A;  1VGZ A;  4UEG A;  4AYL A;  4EEO A;  1FXJ A;  1LZ0 A;  4FRM A;  4EE3 A;  4HO3 A;  1IIM A;  1H7H A;  2AM5 A;  2ICY A;  1WT1 A;  1ZJ3 A;  3I0K A;  1NHE B;  1O7Q A;  5AJO A;  1HM0 A;  3BCV A;  5C4B A;  2RJ7 A;  2RIY A;  2VS4 A;  2AH9 A;  3JUJ A;  3K8E A;  2RJ4 A;  5C4E A;  2AES A;  3ZF8 A;  2VD4 A;  2DPW A;  2AM3 A;  2PA4 A;  2BO8 A;  1ZIZ A;  3E26 A;  4G3Q A;  1TW1 A;  4Y7T A;  1ZJ2 A;  4R7P A;  1NQI B;  5C1G A;  5C49 A;  3CU0 A;  4J18 A;  2FYC B;  3GUE A;  5EJ1 A;  1OMX A;  2YCM A;  3I0C A;  3O3P A;  1R7Y A;  4HCQ A;  1QG8 A;  2MZB A;  4KPZ A;  4HO2 A;  1TZF A;  4KT7 A;  2WVK A;  1ZDF A;  2P72 A;  4BMA A;  3U2W A;  1V82 A;  1ZI1 A;  3Q4S A;  1LZJ A;  1QWJ A;  2Y6P A;  3JTJ A;  1GA8 A;  2RIT A;  4Y62 A;  3SX3 A;  4DEC A;  4B2W A;  4JD0 A;  5D92 A;  3LW6 A;  1G1L A;  2X65 A;  1FRW A;  2P6W A;  4FRO A;  1GQ9 A;  3NGW A;  2J0A A;  2VSH A;  4KPX A;  4AYJ A;  3ST8 A;  3I0E A;  5IDS A;  3OH3 A;  1JV3 A;  5C38 A;  5C1L A;  5DDV A;  1GX0 A;  3FOQ A;  2WVL A;  3CKV A;  5C4D A;  4LW3 A;  1VZT A;  1V84 A;  3RMW A;  3ZLL A;  1FOA A;  3OH1 A;  1NWG B;  1KWS A;  2JCO A;  2VSI A;  2YC3 A;  2XWM A;  4D11 C;  5BXC A;  1EYR A;  4NAK A;  3V8Z A;  1H4E A;  2ZU8 A;  4CJC A;  2I7B A;  5AJP A;  5C3A A;  1VH1 A;  1K4V A;  2FYB A;  3ZGG A;  1ZCT A;  5AJN A;  2I5K A;  2RJ5 A;  1ZCV A;  2ICX A;  4B4B A;  1NF5 B;  1VH3 A;  4NAN A;  4Y63 A;  2E3D A;  4P00 A;  3V0Q A;  1WT3 A;  4IRP A;  1FG5 N;  3I0D A;  1FO9 A;  4NAI A;  3Q7U A;  4G87 A;  4Q7C A;  1W57 A;  4B5B A;  4ARW A;  2Y4K A;  5C4C A;  1G8O A;  1W55 A;  2XWN A;  3V0L A;  2PX7 A;  2PGY A;  2AGD A;  1R80 A;  2YES A;  4NAL A;  2Y4J A;  2AM4 A;  1HV9 A;  3TQD A;  1WSZ A;  2ZU9 A;  3ZGF A;  3I0G A;  1ZJP A;  1ZJ0 A;  3U2T A;  1O0R A;  2OEG A;  3EE5 A;  3SXA A;  3OH2 A;  4FRL A;  4D0Z A;  5C4F A;  2I5E A;  2O1G A;  2QKX A;  2RJ9 A;  1GX4 A;  1WT0 A;  3IOI A;  2W0V A;  1ZI3 A;  1GWW A;  3CKQ A;  2JCK A;  3OGZ A;  2Z86 A;  3I0I X;  4MND A;  4FRQ A;  2D7I A;  2XWL A;  1G3L A;  3CKN A;  5CMI A;  1ZJ1 A;  5CMF X;  5IFY A;  4KXO A;  5C8R A;  4KQL A;  5IDT A;  4B3U A;  3SXD A;  5CMH A;  1G9R A;  1WT2 A;  5CQP A;  5HS2 A;  2XME A;  4KNX A;  1FR8 A;  1G0R A;  1HJL A;  2RJ0 A;  2RJ6 A;  1INJ A;  3SXB A;  3FWW A;  1EZI A;  4HOC A;  2NXV A;  3D8V A;  3RSB A;  2OI7 A;  1ZDG A;  4K6R A;  4G3S A;  1V83 A;  1G2V A;  1R7V A;  2Y7A A;  4M2B A;  1XZ6 A;  3SXE A;  1NKH B;  4LW6 A;  2YC5 A;  1R7U A;  2UX8 A;  1G95 A;  4M4K A;  3PKP A;  3U2V A;  5EIY A;  3F1Y A;  1FGX A;  3U0X A;  5CQM X;  3POL A;  3JUK A;  1R82 A;  4D11 A;  3U0Y A;  4Y6U A;  2V0H A;  4FRA A;  4MIX A;  2BO7 A;  4EEM A;  5FYE A;  5FV9 A;  1Z90 A;  5J49 A;  1H5R B;  3SXG A;  4GBP A;  4KRV A;  4B4M A;  5CMJ A;  5I1F A;  5C48 A;  1ZCY A;  2APC A;  2YQC A;  1R7X A;  2AE7 A;  2OEF A;  1JVG A;  2VS5 A;  4CJB A;  4D48 A;  4Y6N A;  1YP4 A;  3OAM A;  2VXL A;  4HO0 A;  3OC9 A;  1FWY A;  1O7O A;  4XWI A;  2WGZ A;  4DDZ A;  1FGG A;  3N9W A;  4FRB A;  3CKJ A;  4FRH A;  4AC3 A;  5JQQ A;  3QVB A;  2GGQ A;  4P02 A;  3I0L A;  1H5T B;  1VGW A;  1H7T A;  2PGV A;  1VIC A;  3PKQ A;  1ZI5 A;  2V0K A;  4B2X A;  3OH0 A;  4FRD A;  2W0W A;  3OH4 A;  1FR9 A;  1YP3 A;  1H7L A;  2V0L A;  3K8D A;  2FFU A;  3SX5 A;  4HG6 A;  3ZLK A;  2RJ8 A;  1ON6 A;  3SX7 A;  4ECM A;  3DK5 A;  5C1H A;  1INI A;  1H5R A;  1LL3 A;  1H7G A;  1JYL A;  5FU8 A;  2JCL A;  1MC3 A;  4YS8 A;  1R81 A;  1H3M A;  2Q4J A;  1TW5 A;  2QGI A;  2WEE A;  2JCJ A;  1LL0 A;  3I0H A;  1OQM B;  1PZT A;  3DUV A;  3CGX A;  4KNR A;  4ASY A;  4D0T A;  4E1K A;  4Y7G A;  2BO4 A;  1G97 A;  1H5S C;  2QH5 A;  2AEC A;  1H7F A;  1HM9 A;  2OI5 A;  3T7N A;  2CU2 A;  2O1F A;  3V0N A;  2ZU7 A;  1SS9 A;  5L6S A;  4HO4 A;  5FU0 A;  2VS3 A;  2P73 A;  1H5T A;  4FQW A;  1PZY B;  2GGO A;  3V0O A;  4KC2 A;  4EEG A;  3SPT A;  1FXO A;  3RMV A;  1JYK A;  4ASJ A;  4KC1 A;  4EE4 A;  4AAW A;  3V90 A;  3OKR A;  3I0F A;  3V0M A;  1VM8 A;  2YQH A;  3Q80 A;  4CJ8 A;  1VZU A;  1ZI4 A;  1G93 A;  1JV1 A;  1S4P A;  1VGT A;  4G3P A;  3CKO A;  1ZHJ A;  1GWV A;  4Y7V A;  3BRK X;  5FUH A;  4B42 A;  2FFV A;  2WE9 A;  1H5S D;  1MP3 A;  2RIX A;  1ON8 A;  3USR A;  1FZW A;  4M28 A;  4BQH A;  4C2S A;  2Z87 A;  4HO6 A;  1VZX A;  1IIN A;  1H7Q A;  4ZDQ A;  1WVC A;  1ZCU A;  5FTV A;  2D7R A;  1VPA A;  3R3I A;  3U2U A;  4EE5 A;  1H5S B;  2VFZ A;  1H4C A;  4O6N A;  4HO5 A;  4FRP A;  5EJZ A;  2VK9 A;  2VXM A;  5CMG X;  2RJ1 A;  4Y7U A;  5C3B A;  3TZT A;  1W77 A;  4KC4 A;  2A8U A;  4EEA A;  4JIS A;  1LVW A;  1E5K A;  2WVM A;  5FTS A;  2YQS A;  1S4N A;  1ZJO A;  2BO6 A;  5C3D A;  2YQJ A;  3F1C A;  1FO8 A;  2RIZ A;  2V0I A;  4FIY A;  1I52 A;  4Y7F A;  4M2A A;  4EVW A;  3SXC A;  3D5N A;  4IRQ A;  2FYD B;  1HJJ A;  1XHB A;  3V91 A;  2D0J A;  2C0N A;  2OI6 A;  5DDT A;  4L41 C;  2Y4M A;  5CQL X;  2WAW A;  1GQC A;  1LZ7 A;  5CQO A;  4O6M A;  4B4G A;  4Y9X A;  3USQ A;  3SX8 A;  1QGS A;  1YP2 A;  2A8W A;  1O23 B;  1YRO B;  1H5S A;  2O1H A;  3I0J A;  5CQN X;  1H4D A;  1VGU A;  3R2W A;  3IOH A;  5D91 A;  1MP5 A;  2FYA A;  4FCU A;  3DJ4 A;  4HO8 A;  1H7E A;  1R7T A;  3E25 A; 
#chains in the Genus database with same CATH homology
 1LL2 A;  1NMM B;  2X5Z A;  2V0J A;  3T7M A;  1QGQ A;  1LZI A;  2FY7 A;  2XMH A;  2E8B A;  3KIA A;  3PNN A;  4Y64 A;  1G23 A;  3D98 A;  3V8Y A;  1S4O A;  4FRE A;  4MYB A;  5L6V A;  3IOJ A;  1HM8 A;  4DE7 A;  1TVY A;  5C47 A;  4HO9 A;  2J0B A;  2Y4L A;  3U2X A;  3T7O A;  1JVD A;  4FIX A;  4CVH A;  2X5S A;  3V0P A;  1MP4 A;  5C36 A;  1OMZ A;  2X60 A;  3HL3 A;  4FCE A;  1VGZ A;  4UEG A;  4AYL A;  4EEO A;  1FXJ A;  1LZ0 A;  4FRM A;  4EE3 A;  4HO3 A;  1IIM A;  1H7H A;  2AM5 A;  2ICY A;  1WT1 A;  1ZJ3 A;  3I0K A;  1NHE B;  1O7Q A;  5AJO A;  1HM0 A;  3BCV A;  5C4B A;  2RJ7 A;  2RIY A;  2VS4 A;  2AH9 A;  3JUJ A;  3K8E A;  2RJ4 A;  5C4E A;  2AES A;  3ZF8 A;  2VD4 A;  2DPW A;  2AM3 A;  2PA4 A;  2BO8 A;  1ZIZ A;  3E26 A;  4G3Q A;  1TW1 A;  4Y7T A;  1ZJ2 A;  4R7P A;  1NQI B;  5C1G A;  5C49 A;  3CU0 A;  4J18 A;  2FYC B;  3GUE A;  5EJ1 A;  1OMX A;  2YCM A;  3I0C A;  3O3P A;  1R7Y A;  4HCQ A;  1QG8 A;  2MZB A;  4KPZ A;  4HO2 A;  1TZF A;  4KT7 A;  2WVK A;  1ZDF A;  2P72 A;  4BMA A;  3U2W A;  1V82 A;  1ZI1 A;  3Q4S A;  1LZJ A;  1QWJ A;  2Y6P A;  3JTJ A;  1GA8 A;  2RIT A;  4Y62 A;  3SX3 A;  4DEC A;  4B2W A;  4JD0 A;  5D92 A;  3LW6 A;  1G1L A;  2X65 A;  1FRW A;  2P6W A;  4FRO A;  1GQ9 A;  3NGW A;  2J0A A;  2VSH A;  4KPX A;  4AYJ A;  3ST8 A;  3I0E A;  5IDS A;  3OH3 A;  1JV3 A;  5C38 A;  5C1L A;  5DDV A;  1GX0 A;  3FOQ A;  2WVL A;  3CKV A;  5C4D A;  4LW3 A;  1VZT A;  1V84 A;  3RMW A;  3ZLL A;  1FOA A;  3OH1 A;  1NWG B;  1KWS A;  2JCO A;  2VSI A;  2YC3 A;  2XWM A;  4D11 C;  5BXC A;  1EYR A;  4NAK A;  3V8Z A;  1H4E A;  2ZU8 A;  4CJC A;  2I7B A;  5AJP A;  5C3A A;  1VH1 A;  1K4V A;  2FYB A;  3ZGG A;  1ZCT A;  5AJN A;  2I5K A;  2RJ5 A;  1ZCV A;  2ICX A;  4B4B A;  1NF5 B;  1VH3 A;  4NAN A;  4Y63 A;  2E3D A;  4P00 A;  3V0Q A;  1WT3 A;  4IRP A;  1FG5 N;  3I0D A;  1FO9 A;  4NAI A;  3Q7U A;  4G87 A;  4Q7C A;  1W57 A;  4B5B A;  4ARW A;  2Y4K A;  5C4C A;  1G8O A;  1W55 A;  2XWN A;  3V0L A;  2PX7 A;  2PGY A;  2AGD A;  1R80 A;  2YES A;  4NAL A;  2Y4J A;  2AM4 A;  1HV9 A;  3TQD A;  1WSZ A;  2ZU9 A;  3ZGF A;  3I0G A;  1ZJP A;  1ZJ0 A;  3U2T A;  1O0R A;  2OEG A;  3EE5 A;  3SXA A;  3OH2 A;  4FRL A;  4D0Z A;  5C4F A;  2I5E A;  2O1G A;  2QKX A;  2RJ9 A;  1GX4 A;  1WT0 A;  3IOI A;  2W0V A;  1ZI3 A;  1GWW A;  3CKQ A;  2JCK A;  3OGZ A;  2Z86 A;  3I0I X;  4MND A;  4FRQ A;  2D7I A;  2XWL A;  1G3L A;  3CKN A;  5CMI A;  1ZJ1 A;  5CMF X;  5IFY A;  4KXO A;  5C8R A;  4KQL A;  5IDT A;  4B3U A;  3SXD A;  5CMH A;  1G9R A;  1WT2 A;  5CQP A;  5HS2 A;  2XME A;  4KNX A;  1FR8 A;  1G0R A;  1HJL A;  2RJ0 A;  2RJ6 A;  1INJ A;  3SXB A;  3FWW A;  1EZI A;  4HOC A;  2NXV A;  3D8V A;  3RSB A;  2OI7 A;  1ZDG A;  4K6R A;  4G3S A;  1V83 A;  1G2V A;  1R7V A;  2Y7A A;  4M2B A;  1XZ6 A;  3SXE A;  1NKH B;  4LW6 A;  2YC5 A;  1R7U A;  2UX8 A;  1G95 A;  4M4K A;  3PKP A;  3U2V A;  5EIY A;  3F1Y A;  1FGX A;  3U0X A;  5CQM X;  3POL A;  3JUK A;  1R82 A;  4D11 A;  3U0Y A;  4Y6U A;  2V0H A;  4FRA A;  4MIX A;  2BO7 A;  4EEM A;  5FYE A;  5FV9 A;  1Z90 A;  5J49 A;  1H5R B;  3SXG A;  4GBP A;  4KRV A;  4B4M A;  5CMJ A;  5I1F A;  5C48 A;  1ZCY A;  2APC A;  2YQC A;  1R7X A;  2AE7 A;  2OEF A;  1JVG A;  2VS5 A;  4CJB A;  4D48 A;  4Y6N A;  1YP4 A;  3OAM A;  2VXL A;  4HO0 A;  3OC9 A;  1FWY A;  1O7O A;  4XWI A;  2WGZ A;  4DDZ A;  1FGG A;  3N9W A;  4FRB A;  3CKJ A;  4FRH A;  4AC3 A;  5JQQ A;  3QVB A;  2GGQ A;  4P02 A;  3I0L A;  1H5T B;  1VGW A;  1H7T A;  2PGV A;  1VIC A;  3PKQ A;  1ZI5 A;  2V0K A;  4B2X A;  3OH0 A;  4FRD A;  2W0W A;  3OH4 A;  1FR9 A;  1YP3 A;  1H7L A;  2V0L A;  3K8D A;  2FFU A;  3SX5 A;  4HG6 A;  3ZLK A;  2RJ8 A;  1ON6 A;  3SX7 A;  4ECM A;  3DK5 A;  5C1H A;  1INI A;  1H5R A;  1LL3 A;  1H7G A;  1JYL A;  5FU8 A;  2JCL A;  1MC3 A;  4YS8 A;  1R81 A;  1H3M A;  2Q4J A;  1TW5 A;  2QGI A;  2WEE A;  2JCJ A;  1LL0 A;  3I0H A;  1OQM B;  1PZT A;  3DUV A;  3CGX A;  4KNR A;  4ASY A;  4D0T A;  4E1K A;  4Y7G A;  2BO4 A;  1G97 A;  1H5S C;  2QH5 A;  2AEC A;  1H7F A;  1HM9 A;  2OI5 A;  3T7N A;  2CU2 A;  2O1F A;  3V0N A;  2ZU7 A;  1SS9 A;  5L6S A;  4HO4 A;  5FU0 A;  2VS3 A;  2P73 A;  1H5T A;  4FQW A;  1PZY B;  2GGO A;  3V0O A;  4KC2 A;  4EEG A;  3SPT A;  1FXO A;  3RMV A;  1JYK A;  4ASJ A;  4KC1 A;  4EE4 A;  4AAW A;  3V90 A;  3OKR A;  3I0F A;  3V0M A;  1VM8 A;  2YQH A;  3Q80 A;  4CJ8 A;  1VZU A;  1ZI4 A;  1G93 A;  1JV1 A;  1S4P A;  1VGT A;  4G3P A;  3CKO A;  1ZHJ A;  1GWV A;  4Y7V A;  3BRK X;  5FUH A;  4B42 A;  2FFV A;  2WE9 A;  1H5S D;  1MP3 A;  2RIX A;  1ON8 A;  3USR A;  1FZW A;  4M28 A;  4BQH A;  4C2S A;  2Z87 A;  4HO6 A;  1VZX A;  1IIN A;  1H7Q A;  4ZDQ A;  1WVC A;  1ZCU A;  5FTV A;  2D7R A;  1VPA A;  3R3I A;  3U2U A;  4EE5 A;  1H5S B;  2VFZ A;  1H4C A;  4O6N A;  4HO5 A;  4FRP A;  5EJZ A;  2VK9 A;  2VXM A;  5CMG X;  2RJ1 A;  4Y7U A;  5C3B A;  3TZT A;  1W77 A;  4KC4 A;  2A8U A;  4EEA A;  4JIS A;  1LVW A;  1E5K A;  2WVM A;  5FTS A;  2YQS A;  1S4N A;  1ZJO A;  2BO6 A;  5C3D A;  2YQJ A;  3F1C A;  1FO8 A;  2RIZ A;  2V0I A;  4FIY A;  1I52 A;  4Y7F A;  4M2A A;  4EVW A;  3SXC A;  3D5N A;  4IRQ A;  2FYD B;  1HJJ A;  1XHB A;  3V91 A;  2D0J A;  2C0N A;  2OI6 A;  5DDT A;  4L41 C;  2Y4M A;  5CQL X;  2WAW A;  1GQC A;  1LZ7 A;  5CQO A;  4O6M A;  4B4G A;  4Y9X A;  3USQ A;  3SX8 A;  1QGS A;  1YP2 A;  2A8W A;  1O23 B;  1YRO B;  1H5S A;  2O1H A;  3I0J A;  5CQN X;  1H4D A;  1VGU A;  3R2W A;  3IOH A;  5D91 A;  1MP5 A;  2FYA A;  4FCU A;  3DJ4 A;  4HO8 A;  1H7E A;  1R7T A;  3E25 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...