1OQMB

A 1:1 complex between alpha-lactalbumin and beta1,4-galactosyltransferase in the presence of udp-n-acetyl-galactosamine
Total Genus 93
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
93
sequence length
272
structure length
272
Chain Sequence
LTACPEESPLLVGPMLIEFNIPVDLKLVEQQNPKVKLGGRYTPMDCISPHKVAIIIPFRNRQEHLKYWLYYLHPILQRQQLDYGIYVINQAGESMFNRAKLLNVGFKEALKDYDYNCFVFSDVDLIPMNDHNTYRCFSQPRHISVAMDKFGFSLPYVQYFGGVSALSKQQFLSINGFPNNYWGWGGEDDDIYNRLAFRGMSVSRPNAVIGKCRMIRHSRDKKNEPNPQRFDRIAHTKETMLSDGLNSLTYMVLEVQRYPLYTKITVDIGTPS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Alpha-lactalbumin
publication title Structure-based design of beta 1,4-galactosyltransferase I (beta 4Gal-T1) with equally efficient N-acetylgalactosaminyltransferase activity: point mutation broadens beta 4Gal-T1 donor specificity.
pubmed doi rcsb
source organism Mus musculus
molecule tags Transferase, biosynthetic protein
total genus 93
structure length 272
sequence length 272
chains with identical sequence D
ec nomenclature ec 2.4.1.22: Lactose synthase.
pdb deposition date 2003-03-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF02709 Glyco_transf_7C N-terminal domain of galactosyltransferase
B PF13733 Glyco_transf_7N N-terminal region of glycosyl transferase group 7
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.550.10 Alpha Beta Alpha-Beta Complex Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A 1oqmB00
2VXMA 1NQIB 3OC9A 1TVYA 5CQLX 2D7IA 2ZU9A 5EIYA 1K4VA 4NAIA 5FTSA 5CQPA 1JYKA 4AYLA 1VZUA 1MC3A 5CMHA 3JUJA 3V0MA 1HM0A 4D0TA 1OMXA 3USQA 2OI6A 4FRHA 5FUHA 5L6VA 3I0LA 2GGQA 2VSIA 3U2VA 3F1CA 4DECA 1NHEB 3V0NA 1NKHB 1FXJA 3DUVA 3U2WA 2VS5A 2PGVA 4IRPA 5I1FA 4EE5A 5C4EA 2BO8A 3SXCA 2JCJA 2P72A 3V0QA 3QVBA 1VM8A 4KC2A 4KPZA 4YS8A 5CMJA 1H3MA 3T7OA 5C1GA 2YCMA 4B5BA 3JUKA 2RIYA 3SXDA 1FO8A 2AECA 2AE7A 1NF5B 1SS9A 2WVLA 3HL3A 2O1GA 2OI5A 1S4PA 4FREA 2D7RA 3GUEA 4HO3A 4EE3A 2YC3A 3ZGFA 1ZCTA 2VFZA 3SPTA 5C1LA 4MNDA 4Y9XA 3O3PA 3OKRA 3PKQA 2FFUA 3KIAA 1O23B 3U2UA 2RJ8A 1ZDGA 1O7OA 1VH3A 1PZYB 2CU2A 1ZJ3A 1I52A 2ICXA 1GWVA 2APCA 1G95A 4G3QA 1ZCUA 3R3IA 4FQWA 5CQMX 2YESA 3K8EA 2PGYA 1TZFA 2BO6A 2E3DA 2VSHA 1QG8A 3I0IX 2QKXA 2O1HA 3IOHA 4FRAA 2DPWA 2XWNA 3V90A 3I0EA 1WT2A 2BO7A 1MP5A 5IFYA 2V0LA 1H7GA 1LVWA 3SXGA 2YQCA 1FRWA 2AH9A 1FOAA 4D11C 3SXBA 1WVCA 5C47A 4D48A 4HO0A 2Y7AA 2V0HA 1HM9A 4FRMA 2XMEA 2JCOA 4NAKA 2RIXA 3CU0A 1G1LA 1W77A 4BMAA 2VS3A 2VS4A 2Y4MA 1H5SA 1GQCA 2I5EA 3PNNA 5C4CA 3I0HA 4KRVA 2VXLA 1JVGA 1LL3A 2X5ZA 4CJBA 1R7YA 1LL0A 1KWSA 4D0ZA 1R7VA 1MP3A 1H5SD 1WT1A 1ZCYA 4AC3A 2UX8A 2RJ7A 2Y4KA 3CGXA 1G97A 1R80A 2FYBA 2ZU8A 1GWWA 1ON6A 1W57A 4HO8A 1ON8A 4CJ8A 1NMMB 2Y4LA 1QGSA 4XWIA 2JCKA 1MP4A 1H7EA 4HO5A 3CKJA 3V8ZA 1VGWA 4MYBA 1G0RA 5C8RA 2FYAA 2XWMA 1H7FA 5C1HA 2Y6PA 1HJJA 5C48A 3V91A 1VPAA 1O0RA 3OAMA 3U0YA 3E25A 3ZLLA 2QGIA 2P6WA 4BQHA 4G3PA 2AESA 2WVKA 4Y63A 5AJNA 3V0OA 1FWYA 3ZGGA 2OEFA 2FYDB 1GQ9A 1OMZA 2AM4A 2WEEA 4FRLA 1HV9A 1INJA 3USRA 1INIA 4B4GA 1R7TA 4CVHA 1O7QA 2X65A 2Q4JA 4EEOA 1ZI1A 1ZI5A 4C2SA 2D0JA 5DDVA 2WGZA 1H7TA 1LZ7A 3I0KA 4HG6A 4Y7FA 4AYJA 2Y4JA 1YP4A 3OH1A 1HM8A 1ZJ2A 1JV1A 3CKOA 4ZDQA 4HO9A 3RSBA 1H5TA 5FTVA 3LW6A 3SX7A 5C3DA 3OGZA 1TW1A 4LW3A 3ZLKA 1GA8A 1H7HA 5CQOA 2X5SA 1V83A 1JYLA 2Z87A 4GBPA 4EE4A 5C4DA 5C49A 3NGWA 2WAWA 1H5SB 4KXOA 2P73A 1PZTA 3D5NA 3ZF8A 4FRDA 3CKVA 1OQMB 3IOIA 1FGGA 4FCEA 1G3LA 2A8UA 4KNXA 3FWWA 1JVDA 4HCQA 5FU8A 1G93A 2V0KA 5CMIA 4M28A 4JISA 1H7LA 1VGZA 1R82A 4NALA 3ST8A 4EVWA 3D98A 2A8WA 3N9WA 4FCUA 5L6SA 4KNRA 4M4KA 1ZCVA 3U2TA 4ASYA 1VGUA 1H5RA 4Y62A 1VGTA 1GX4A 2YQHA 1VICA 1ZDFA 5C4BA 1G8OA 4HOCA 2X60A 4B4BA 1ZJPA 5C4FA 4M2BA 1VH1A 1Z90A 1XHBA 1ZHJA 4P00A 5BXCA 1H4DA 3OH0A 5HS2A 3Q4SA 4CJCA 1ZI3A 2PX7A 1YP3A 5DDTA 3JTJA 4Y7TA 5IDTA 1FO9A 5AJPA 2RJ0A 2AGDA 2FYCB 1R81A 3SXEA 1NWGB 1LL2A 3PKPA 2FY7A 4NANA 2V0JA 3I0CA 5JQQA 2RJ9A 4Y64A 3E26A 4ECMA 1H4CA 1VZXA 1LZ0A 2RJ1A 2XMHA 5CMFX 4IRQA 5J49A 4K6RA 2NXVA 3U2XA 1ZJ0A 4AAWA 1H5TB 5IDSA 4FRBA 3TZTA 3I0FA 1WT0A 1FR8A 2WE9A 4LW6A 1EYRA 4JD0A 3RMWA 1FZWA 3SX3A 3BRKX 1G2VA 4EEAA 4M2AA 2MZBA 2Z86A 4G87A 3RMVA 3F1YA 3U0XA 1FGXA 1G23A 1R7UA 3EE5A 4FRQA 1H7QA 2YQJA 1S4OA 1HJLA 4Y7GA 3Q7UA 1ZJOA 2RITA 1ZJ1A 4Y7UA 2GGOA 5EJ1A 1IIMA 3I0DA 2RJ5A 2PA4A 2I7BA 4HO6A 2I5KA 1EZIA 3Q80A 3CKQA 3DK5A 1H5RB 4J18A 3SX8A 1JV3A 4DDZA 3DJ4A 2W0WA 1S4NA 1R7XA 2FFVA 3POLA 2RJ6A 3OH4A 4Y7VA 3T7MA 1H4EA 3BCVA 3FOQA 3T7NA 3R2WA 1WT3A 3I0JA 1FXOA 4L41C 3V8YA 1ZI4A 4DE7A 2QH5A 5C36A 4B2WA 4KT7A 5CMGX 2YC5A 3D8VA 1WSZA 1W55A 2XWLA 4HO2A 4Y6NA 4ASJA 5CQNX 4EEMA 4HO4A 2AM3A 1V82A 4B2XA 1H5SC 5C3AA 2WVMA 2RIZA 2E8BA 4EEGA 1YP2A 4KPXA 5C38A 3V0PA 5EJZA 2ZU7A 4KC1A 4R7PA 3OH3A 4E1KA 1VZTA 1E5KA 1G9RA 2ICYA 1ZIZA 5FYEA 1XZ6A 1IINA 1TW5A 3SXAA 4FROA 1YROB 4KQLA 5C3BA 2V0IA 4FRPA 1FG5N 1QGQA 5FV9A 3IOJA 2BO4A 3TQDA 1GX0A 4Y6UA 4B4MA 1FR9A 2O1FA 5AJOA 2VD4A 2AM5A 4G3SA 2W0VA 2OI7A 1V84A 3V0LA 2RJ4A 4KC4A 2JCLA 4D11A 4P02A 4UEGA 2OEGA 1LZIA 4B3UA 3K8DA 5FU0A 4B42A 3SX5A 2YQSA 3I0GA 1LZJA 3CKNA 4ARWA 3OH2A 1QWJA
chains in the Genus database with same CATH superfamily
2VXMA 1NQIB 3OC9A 1TVYA 5CQLX 2D7IA 2ZU9A 5EIYA 1K4VA 4NAIA 5FTSA 5CQPA 1JYKA 4AYLA 1VZUA 1MC3A 5CMHA 3JUJA 3V0MA 1HM0A 4D0TA 1OMXA 3USQA 2OI6A 4FRHA 5FUHA 5L6VA 3I0LA 2GGQA 2VSIA 3U2VA 3F1CA 4DECA 1NHEB 3V0NA 1NKHB 1FXJA 3DUVA 3U2WA 2VS5A 2PGVA 4IRPA 5I1FA 4EE5A 5C4EA 2BO8A 3SXCA 2JCJA 2P72A 3V0QA 3QVBA 1VM8A 4KC2A 4KPZA 4YS8A 5CMJA 1H3MA 3T7OA 5C1GA 2YCMA 4B5BA 3JUKA 2RIYA 3SXDA 1FO8A 2AECA 2AE7A 1NF5B 1SS9A 2WVLA 3HL3A 2O1GA 2OI5A 1S4PA 4FREA 2D7RA 3GUEA 4HO3A 4EE3A 2YC3A 3ZGFA 1ZCTA 2VFZA 3SPTA 5C1LA 4MNDA 4Y9XA 3O3PA 3OKRA 3PKQA 2FFUA 3KIAA 1O23B 3U2UA 2RJ8A 1ZDGA 1O7OA 1VH3A 1PZYB 2CU2A 1ZJ3A 1I52A 2ICXA 1GWVA 2APCA 1G95A 4G3QA 1ZCUA 3R3IA 4FQWA 5CQMX 2YESA 3K8EA 2PGYA 1TZFA 2BO6A 2E3DA 2VSHA 1QG8A 3I0IX 2QKXA 4FIYA 2O1HA 3IOHA 4FRAA 2DPWA 2XWNA 3V90A 3I0EA 1WT2A 2BO7A 1MP5A 5IFYA 2V0LA 1H7GA 1LVWA 3SXGA 2YQCA 1FRWA 2AH9A 1FOAA 4D11C 3SXBA 1WVCA 5C47A 4D48A 4HO0A 5D91A 2Y7AA 2V0HA 1HM9A 4FRMA 2XMEA 2JCOA 4NAKA 2RIXA 3CU0A 1G1LA 1W77A 4BMAA 2VS3A 2VS4A 2Y4MA 1H5SA 1GQCA 2I5EA 3PNNA 5C4CA 3I0HA 4KRVA 2VXLA 1JVGA 1LL3A 2X5ZA 4CJBA 1R7YA 1LL0A 1KWSA 4D0ZA 1R7VA 1MP3A 1H5SD 1WT1A 1ZCYA 4AC3A 2UX8A 2RJ7A 2Y4KA 3CGXA 1G97A 1R80A 2FYBA 2ZU8A 1GWWA 1ON6A 1W57A 4HO8A 1ON8A 4CJ8A 1NMMB 2Y4LA 1QGSA 4XWIA 2JCKA 1MP4A 1H7EA 4HO5A 3CKJA 3V8ZA 1VGWA 4MYBA 1G0RA 5C8RA 2FYAA 2XWMA 1H7FA 5C1HA 2Y6PA 1HJJA 5C48A 3V91A 1VPAA 1O0RA 3OAMA 3U0YA 3E25A 3ZLLA 2QGIA 2P6WA 4BQHA 4G3PA 2AESA 2WVKA 4Y63A 5AJNA 3V0OA 1FWYA 3ZGGA 2OEFA 2FYDB 1GQ9A 1OMZA 2AM4A 2WEEA 4FRLA 1HV9A 1INJA 3USRA 1INIA 4B4GA 1R7TA 4O6NA 4CVHA 1O7QA 2X65A 2Q4JA 4EEOA 1ZI1A 1ZI5A 4C2SA 2D0JA 5DDVA 2WGZA 1H7TA 1LZ7A 3I0KA 4HG6A 4Y7FA 4AYJA 2Y4JA 1YP4A 3OH1A 1HM8A 1ZJ2A 1JV1A 3CKOA 4ZDQA 2J0BA 4HO9A 3RSBA 1H5TA 5FTVA 3LW6A 3SX7A 5C3DA 3OGZA 1TW1A 4LW3A 3ZLKA 1GA8A 1H7HA 5CQOA 2X5SA 1V83A 1JYLA 2Z87A 4GBPA 4EE4A 5C4DA 5C49A 3NGWA 2WAWA 1H5SB 4KXOA 2P73A 1PZTA 3D5NA 3ZF8A 4FRDA 3CKVA 1OQMB 4Q7CA 3IOIA 1FGGA 4FCEA 1G3LA 2A8UA 4KNXA 3FWWA 1JVDA 4HCQA 5FU8A 1G93A 2V0KA 5CMIA 4M28A 4JISA 1H7LA 2J0AA 1VGZA 1R82A 4NALA 3ST8A 4EVWA 4O6MA 3D98A 2A8WA 3N9WA 4FCUA 5L6SA 4KNRA 4M4KA 1ZCVA 3U2TA 4ASYA 1VGUA 1H5RA 4Y62A 1VGTA 1GX4A 2YQHA 1VICA 1ZDFA 5C4BA 1G8OA 4HOCA 2X60A 4B4BA 1ZJPA 5C4FA 4M2BA 1VH1A 1Z90A 1XHBA 1ZHJA 4P00A 5BXCA 1H4DA 3OH0A 5HS2A 3Q4SA 4CJCA 1ZI3A 2PX7A 1YP3A 5DDTA 3JTJA 4Y7TA 5IDTA 1FO9A 5AJPA 2RJ0A 2AGDA 2FYCB 1R81A 3SXEA 1NWGB 1LL2A 3PKPA 2FY7A 4NANA 2V0JA 3I0CA 5JQQA 2C0NA 2RJ9A 4Y64A 3E26A 4ECMA 1H4CA 1VZXA 1LZ0A 2RJ1A 2XMHA 5CMFX 4IRQA 5J49A 4K6RA 2NXVA 3U2XA 1ZJ0A 4AAWA 1H5TB 5IDSA 4FRBA 3TZTA 3I0FA 1WT0A 1FR8A 2WE9A 4LW6A 1EYRA 4JD0A 3RMWA 1FZWA 3SX3A 3BRKX 1G2VA 4EEAA 4M2AA 2MZBA 2Z86A 4G87A 3RMVA 3F1YA 3U0XA 1FGXA 1G23A 1R7UA 3EE5A 4FRQA 1H7QA 2YQJA 1S4OA 1HJLA 4Y7GA 3Q7UA 1ZJOA 2RITA 1ZJ1A 4Y7UA 2GGOA 5EJ1A 1IIMA 3I0DA 2RJ5A 2PA4A 2I7BA 4HO6A 2I5KA 1EZIA 3Q80A 3CKQA 3DK5A 1H5RB 4FIXA 4J18A 3SX8A 1JV3A 2VK9A 4DDZA 3DJ4A 2W0WA 1S4NA 1R7XA 2FFVA 3POLA 2RJ6A 3OH4A 4Y7VA 3T7MA 1H4EA 3BCVA 3FOQA 3T7NA 3R2WA 1WT3A 3I0JA 1FXOA 4L41C 3V8YA 1ZI4A 4DE7A 2QH5A 5C36A 4B2WA 4KT7A 5CMGX 2YC5A 3D8VA 1WSZA 1W55A 2XWLA 4HO2A 4Y6NA 4ASJA 5CQNX 4EEMA 5D92A 4HO4A 2AM3A 1V82A 4B2XA 1H5SC 5C3AA 2WVMA 2RIZA 2E8BA 4EEGA 1YP2A 4KPXA 5C38A 3V0PA 5EJZA 2ZU7A 4KC1A 4R7PA 3OH3A 4E1KA 1VZTA 1E5KA 1G9RA 2ICYA 1ZIZA 5FYEA 1XZ6A 1IINA 1TW5A 3SXAA 4FROA 1YROB 4KQLA 5C3BA 2V0IA 4FRPA 1FG5N 1QGQA 5FV9A 3IOJA 2BO4A 3TQDA 1GX0A 4Y6UA 4B4MA 1FR9A 2O1FA 5AJOA 2VD4A 2AM5A 4G3SA 2W0VA 2OI7A 1V84A 3V0LA 2RJ4A 4KC4A 2JCLA 4D11A 4P02A 4UEGA 2OEGA 1LZIA 4B3UA 3K8DA 5FU0A 4B42A 3SX5A 2YQSA 3I0GA 1LZJA 3CKNA 4ARWA 4MIXA 3OH2A 1QWJA
chains in the Genus database with same CATH topology
2VXMA 1NQIB 3OC9A 1TVYA 5CQLX 2D7IA 2ZU9A 5EIYA 1K4VA 4NAIA 5FTSA 5CQPA 1JYKA 4AYLA 1VZUA 1MC3A 5CMHA 3JUJA 3V0MA 1HM0A 4D0TA 1OMXA 3USQA 2OI6A 4FRHA 5FUHA 5L6VA 3I0LA 2GGQA 2VSIA 3U2VA 3F1CA 4DECA 1NHEB 3V0NA 1NKHB 1FXJA 3DUVA 3U2WA 2VS5A 2PGVA 4IRPA 5I1FA 4EE5A 5C4EA 2BO8A 3SXCA 2JCJA 2P72A 3V0QA 3QVBA 1VM8A 4KC2A 4KPZA 4YS8A 5CMJA 1H3MA 3T7OA 5C1GA 2YCMA 4B5BA 3JUKA 2RIYA 3SXDA 1FO8A 2AECA 2AE7A 1NF5B 1SS9A 2WVLA 3HL3A 2O1GA 2OI5A 1S4PA 4FREA 2D7RA 3GUEA 4HO3A 4EE3A 2YC3A 3ZGFA 1ZCTA 2VFZA 3SPTA 5C1LA 4MNDA 4Y9XA 3O3PA 3OKRA 3PKQA 2FFUA 3KIAA 1O23B 3U2UA 2RJ8A 1ZDGA 1O7OA 1VH3A 1PZYB 2CU2A 1ZJ3A 1I52A 2ICXA 1GWVA 2APCA 1G95A 4G3QA 1ZCUA 3R3IA 4FQWA 5CQMX 2YESA 3K8EA 2PGYA 1TZFA 2BO6A 2E3DA 2VSHA 1QG8A 3I0IX 2QKXA 4FIYA 2O1HA 3IOHA 4FRAA 2DPWA 2XWNA 3V90A 3I0EA 1WT2A 2BO7A 1MP5A 5IFYA 2V0LA 1H7GA 1LVWA 3SXGA 2YQCA 1FRWA 2AH9A 1FOAA 4D11C 3SXBA 1WVCA 5C47A 4D48A 4HO0A 5D91A 2Y7AA 2V0HA 1HM9A 4FRMA 2XMEA 2JCOA 4NAKA 2RIXA 3CU0A 1G1LA 1W77A 4BMAA 2VS3A 2VS4A 2Y4MA 1H5SA 1GQCA 2I5EA 3PNNA 5C4CA 3I0HA 4KRVA 2VXLA 1JVGA 1LL3A 2X5ZA 4CJBA 1R7YA 1LL0A 1KWSA 4D0ZA 1R7VA 1MP3A 1H5SD 1WT1A 1ZCYA 4AC3A 2UX8A 2RJ7A 2Y4KA 3CGXA 1G97A 1R80A 2FYBA 2ZU8A 1GWWA 1ON6A 1W57A 4HO8A 1ON8A 4CJ8A 1NMMB 2Y4LA 1QGSA 4XWIA 2JCKA 1MP4A 1H7EA 4HO5A 3CKJA 3V8ZA 1VGWA 4MYBA 1G0RA 5C8RA 2FYAA 2XWMA 1H7FA 5C1HA 2Y6PA 1HJJA 5C48A 3V91A 1VPAA 1O0RA 3OAMA 3U0YA 3E25A 3ZLLA 2QGIA 2P6WA 4BQHA 4G3PA 2AESA 2WVKA 4Y63A 5AJNA 3V0OA 1FWYA 3ZGGA 2OEFA 2FYDB 1GQ9A 1OMZA 2AM4A 2WEEA 4FRLA 1HV9A 1INJA 3USRA 1INIA 4B4GA 1R7TA 4O6NA 4CVHA 1O7QA 2X65A 2Q4JA 4EEOA 1ZI1A 1ZI5A 4C2SA 2D0JA 5DDVA 2WGZA 1H7TA 1LZ7A 3I0KA 4HG6A 4Y7FA 4AYJA 2Y4JA 1YP4A 3OH1A 1HM8A 1ZJ2A 1JV1A 3CKOA 4ZDQA 2J0BA 4HO9A 3RSBA 1H5TA 5FTVA 3LW6A 3SX7A 5C3DA 3OGZA 1TW1A 4LW3A 3ZLKA 1GA8A 1H7HA 5CQOA 2X5SA 1V83A 1JYLA 2Z87A 4GBPA 4EE4A 5C4DA 5C49A 3NGWA 2WAWA 1H5SB 4KXOA 2P73A 1PZTA 3D5NA 3ZF8A 4FRDA 3CKVA 1OQMB 4Q7CA 3IOIA 1FGGA 4FCEA 1G3LA 2A8UA 4KNXA 3FWWA 1JVDA 4HCQA 5FU8A 1G93A 2V0KA 5CMIA 4M28A 4JISA 1H7LA 2J0AA 1VGZA 1R82A 4NALA 3ST8A 4EVWA 4O6MA 3D98A 2A8WA 3N9WA 4FCUA 5L6SA 4KNRA 4M4KA 1ZCVA 3U2TA 4ASYA 1VGUA 1H5RA 4Y62A 1VGTA 1GX4A 2YQHA 1VICA 1ZDFA 5C4BA 1G8OA 4HOCA 2X60A 4B4BA 1ZJPA 5C4FA 4M2BA 1VH1A 1Z90A 1XHBA 1ZHJA 4P00A 5BXCA 1H4DA 3OH0A 5HS2A 3Q4SA 4CJCA 1ZI3A 2PX7A 1YP3A 5DDTA 3JTJA 4Y7TA 5IDTA 1FO9A 5AJPA 2RJ0A 2AGDA 2FYCB 1R81A 3SXEA 1NWGB 1LL2A 3PKPA 2FY7A 4NANA 2V0JA 3I0CA 5JQQA 2C0NA 2RJ9A 4Y64A 3E26A 4ECMA 1H4CA 1VZXA 1LZ0A 2RJ1A 2XMHA 5CMFX 4IRQA 5J49A 4K6RA 2NXVA 3U2XA 1ZJ0A 4AAWA 1H5TB 5IDSA 4FRBA 3TZTA 3I0FA 1WT0A 1FR8A 2WE9A 4LW6A 1EYRA 4JD0A 3RMWA 1FZWA 3SX3A 3BRKX 1G2VA 4EEAA 4M2AA 2MZBA 2Z86A 4G87A 3RMVA 3F1YA 3U0XA 1FGXA 1G23A 1R7UA 3EE5A 4FRQA 1H7QA 2YQJA 1S4OA 1HJLA 4Y7GA 3Q7UA 1ZJOA 2RITA 1ZJ1A 4Y7UA 2GGOA 5EJ1A 1IIMA 3I0DA 2RJ5A 2PA4A 2I7BA 4HO6A 2I5KA 1EZIA 3Q80A 3CKQA 3DK5A 1H5RB 4FIXA 4J18A 3SX8A 1JV3A 2VK9A 4DDZA 3DJ4A 2W0WA 1S4NA 1R7XA 2FFVA 3POLA 2RJ6A 3OH4A 4Y7VA 3T7MA 1H4EA 3BCVA 3FOQA 3T7NA 3R2WA 1WT3A 3I0JA 1FXOA 4L41C 3V8YA 1ZI4A 4DE7A 2QH5A 5C36A 4B2WA 4KT7A 5CMGX 2YC5A 3D8VA 1WSZA 1W55A 2XWLA 4HO2A 4Y6NA 4ASJA 5CQNX 4EEMA 5D92A 4HO4A 2AM3A 1V82A 4B2XA 1H5SC 5C3AA 2WVMA 2RIZA 2E8BA 4EEGA 1YP2A 4KPXA 5C38A 3V0PA 5EJZA 2ZU7A 4KC1A 4R7PA 3OH3A 4E1KA 1VZTA 1E5KA 1G9RA 2ICYA 1ZIZA 5FYEA 1XZ6A 1IINA 1TW5A 3SXAA 4FROA 1YROB 4KQLA 5C3BA 2V0IA 4FRPA 1FG5N 1QGQA 5FV9A 3IOJA 2BO4A 3TQDA 1GX0A 4Y6UA 4B4MA 1FR9A 2O1FA 5AJOA 2VD4A 2AM5A 4G3SA 2W0VA 2OI7A 1V84A 3V0LA 2RJ4A 4KC4A 2JCLA 4D11A 4P02A 4UEGA 2OEGA 1LZIA 4B3UA 3K8DA 5FU0A 4B42A 3SX5A 2YQSA 3I0GA 1LZJA 3CKNA 4ARWA 4MIXA 3OH2A 1QWJA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2VXM A;  1NQI B;  3OC9 A;  1TVY A;  5CQL X;  2D7I A;  2ZU9 A;  5EIY A;  1K4V A;  4NAI A;  5FTS A;  5CQP A;  1JYK A;  4AYL A;  1VZU A;  1MC3 A;  5CMH A;  3JUJ A;  3V0M A;  1HM0 A;  4D0T A;  1OMX A;  3USQ A;  2OI6 A;  4FRH A;  5FUH A;  5L6V A;  3I0L A;  2GGQ A;  2VSI A;  3U2V A;  3F1C A;  4DEC A;  1NHE B;  3V0N A;  1NKH B;  1FXJ A;  3DUV A;  3U2W A;  2VS5 A;  2PGV A;  4IRP A;  5I1F A;  4EE5 A;  5C4E A;  2BO8 A;  3SXC A;  2JCJ A;  2P72 A;  3V0Q A;  3QVB A;  1VM8 A;  4KC2 A;  4KPZ A;  4YS8 A;  5CMJ A;  1H3M A;  3T7O A;  5C1G A;  2YCM A;  4B5B A;  3JUK A;  2RIY A;  3SXD A;  1FO8 A;  2AEC A;  2AE7 A;  1NF5 B;  1SS9 A;  2WVL A;  3HL3 A;  2O1G A;  2OI5 A;  1S4P A;  4FRE A;  2D7R A;  3GUE A;  4HO3 A;  4EE3 A;  2YC3 A;  3ZGF A;  1ZCT A;  2VFZ A;  3SPT A;  5C1L A;  4MND A;  4Y9X A;  3O3P A;  3OKR A;  3PKQ A;  2FFU A;  3KIA A;  1O23 B;  3U2U A;  2RJ8 A;  1ZDG A;  1O7O A;  1VH3 A;  1PZY B;  2CU2 A;  1ZJ3 A;  1I52 A;  2ICX A;  1GWV A;  2APC A;  1G95 A;  4G3Q A;  1ZCU A;  3R3I A;  4FQW A;  5CQM X;  2YES A;  3K8E A;  2PGY A;  1TZF A;  2BO6 A;  2E3D A;  2VSH A;  1QG8 A;  3I0I X;  2QKX A;  2O1H A;  3IOH A;  4FRA A;  2DPW A;  2XWN A;  3V90 A;  3I0E A;  1WT2 A;  2BO7 A;  1MP5 A;  5IFY A;  2V0L A;  1H7G A;  1LVW A;  3SXG A;  2YQC A;  1FRW A;  2AH9 A;  1FOA A;  4D11 C;  3SXB A;  1WVC A;  5C47 A;  4D48 A;  4HO0 A;  2Y7A A;  2V0H A;  1HM9 A;  4FRM A;  2XME A;  2JCO A;  4NAK A;  2RIX A;  3CU0 A;  1G1L A;  1W77 A;  4BMA A;  2VS3 A;  2VS4 A;  2Y4M A;  1H5S A;  1GQC A;  2I5E A;  3PNN A;  5C4C A;  3I0H A;  4KRV A;  2VXL A;  1JVG A;  1LL3 A;  2X5Z A;  4CJB A;  1R7Y A;  1LL0 A;  1KWS A;  4D0Z A;  1R7V A;  1MP3 A;  1H5S D;  1WT1 A;  1ZCY A;  4AC3 A;  2UX8 A;  2RJ7 A;  2Y4K A;  3CGX A;  1G97 A;  1R80 A;  2FYB A;  2ZU8 A;  1GWW A;  1ON6 A;  1W57 A;  4HO8 A;  1ON8 A;  4CJ8 A;  1NMM B;  2Y4L A;  1QGS A;  4XWI A;  2JCK A;  1MP4 A;  1H7E A;  4HO5 A;  3CKJ A;  3V8Z A;  1VGW A;  4MYB A;  1G0R A;  5C8R A;  2FYA A;  2XWM A;  1H7F A;  5C1H A;  2Y6P A;  1HJJ A;  5C48 A;  3V91 A;  1VPA A;  1O0R A;  3OAM A;  3U0Y A;  3E25 A;  3ZLL A;  2QGI A;  2P6W A;  4BQH A;  4G3P A;  2AES A;  2WVK A;  4Y63 A;  5AJN A;  3V0O A;  1FWY A;  3ZGG A;  2OEF A;  2FYD B;  1GQ9 A;  1OMZ A;  2AM4 A;  2WEE A;  4FRL A;  1HV9 A;  1INJ A;  3USR A;  1INI A;  4B4G A;  1R7T A;  4CVH A;  1O7Q A;  2X65 A;  2Q4J A;  4EEO A;  1ZI1 A;  1ZI5 A;  4C2S A;  2D0J A;  5DDV A;  2WGZ A;  1H7T A;  1LZ7 A;  3I0K A;  4HG6 A;  4Y7F A;  4AYJ A;  2Y4J A;  1YP4 A;  3OH1 A;  1HM8 A;  1ZJ2 A;  1JV1 A;  3CKO A;  4ZDQ A;  4HO9 A;  3RSB A;  1H5T A;  5FTV A;  3LW6 A;  3SX7 A;  5C3D A;  3OGZ A;  1TW1 A;  4LW3 A;  3ZLK A;  1GA8 A;  1H7H A;  5CQO A;  2X5S A;  1V83 A;  1JYL A;  2Z87 A;  4GBP A;  4EE4 A;  5C4D A;  5C49 A;  3NGW A;  2WAW A;  1H5S B;  4KXO A;  2P73 A;  1PZT A;  3D5N A;  3ZF8 A;  4FRD A;  3CKV A;  1OQM B;  3IOI A;  1FGG A;  4FCE A;  1G3L A;  2A8U A;  4KNX A;  3FWW A;  1JVD A;  4HCQ A;  5FU8 A;  1G93 A;  2V0K A;  5CMI A;  4M28 A;  4JIS A;  1H7L A;  1VGZ A;  1R82 A;  4NAL A;  3ST8 A;  4EVW A;  3D98 A;  2A8W A;  3N9W A;  4FCU A;  5L6S A;  4KNR A;  4M4K A;  1ZCV A;  3U2T A;  4ASY A;  1VGU A;  1H5R A;  4Y62 A;  1VGT A;  1GX4 A;  2YQH A;  1VIC A;  1ZDF A;  5C4B A;  1G8O A;  4HOC A;  2X60 A;  4B4B A;  1ZJP A;  5C4F A;  4M2B A;  1VH1 A;  1Z90 A;  1XHB A;  1ZHJ A;  4P00 A;  5BXC A;  1H4D A;  3OH0 A;  5HS2 A;  3Q4S A;  4CJC A;  1ZI3 A;  2PX7 A;  1YP3 A;  5DDT A;  3JTJ A;  4Y7T A;  5IDT A;  1FO9 A;  5AJP A;  2RJ0 A;  2AGD A;  2FYC B;  1R81 A;  3SXE A;  1NWG B;  1LL2 A;  3PKP A;  2FY7 A;  4NAN A;  2V0J A;  3I0C A;  5JQQ A;  2RJ9 A;  4Y64 A;  3E26 A;  4ECM A;  1H4C A;  1VZX A;  1LZ0 A;  2RJ1 A;  2XMH A;  5CMF X;  4IRQ A;  5J49 A;  4K6R A;  2NXV A;  3U2X A;  1ZJ0 A;  4AAW A;  1H5T B;  5IDS A;  4FRB A;  3TZT A;  3I0F A;  1WT0 A;  1FR8 A;  2WE9 A;  4LW6 A;  1EYR A;  4JD0 A;  3RMW A;  1FZW A;  3SX3 A;  3BRK X;  1G2V A;  4EEA A;  4M2A A;  2MZB A;  2Z86 A;  4G87 A;  3RMV A;  3F1Y A;  3U0X A;  1FGX A;  1G23 A;  1R7U A;  3EE5 A;  4FRQ A;  1H7Q A;  2YQJ A;  1S4O A;  1HJL A;  4Y7G A;  3Q7U A;  1ZJO A;  2RIT A;  1ZJ1 A;  4Y7U A;  2GGO A;  5EJ1 A;  1IIM A;  3I0D A;  2RJ5 A;  2PA4 A;  2I7B A;  4HO6 A;  2I5K A;  1EZI A;  3Q80 A;  3CKQ A;  3DK5 A;  1H5R B;  4J18 A;  3SX8 A;  1JV3 A;  4DDZ A;  3DJ4 A;  2W0W A;  1S4N A;  1R7X A;  2FFV A;  3POL A;  2RJ6 A;  3OH4 A;  4Y7V A;  3T7M A;  1H4E A;  3BCV A;  3FOQ A;  3T7N A;  3R2W A;  1WT3 A;  3I0J A;  1FXO A;  4L41 C;  3V8Y A;  1ZI4 A;  4DE7 A;  2QH5 A;  5C36 A;  4B2W A;  4KT7 A;  5CMG X;  2YC5 A;  3D8V A;  1WSZ A;  1W55 A;  2XWL A;  4HO2 A;  4Y6N A;  4ASJ A;  5CQN X;  4EEM A;  4HO4 A;  2AM3 A;  1V82 A;  4B2X A;  1H5S C;  5C3A A;  2WVM A;  2RIZ A;  2E8B A;  4EEG A;  1YP2 A;  4KPX A;  5C38 A;  3V0P A;  5EJZ A;  2ZU7 A;  4KC1 A;  4R7P A;  3OH3 A;  4E1K A;  1VZT A;  1E5K A;  1G9R A;  2ICY A;  1ZIZ A;  5FYE A;  1XZ6 A;  1IIN A;  1TW5 A;  3SXA A;  4FRO A;  1YRO B;  4KQL A;  5C3B A;  2V0I A;  4FRP A;  1FG5 N;  1QGQ A;  5FV9 A;  3IOJ A;  2BO4 A;  3TQD A;  1GX0 A;  4Y6U A;  4B4M A;  1FR9 A;  2O1F A;  5AJO A;  2VD4 A;  2AM5 A;  4G3S A;  2W0V A;  2OI7 A;  1V84 A;  3V0L A;  2RJ4 A;  4KC4 A;  2JCL A;  4D11 A;  4P02 A;  4UEG A;  2OEG A;  1LZI A;  4B3U A;  3K8D A;  5FU0 A;  4B42 A;  3SX5 A;  2YQS A;  3I0G A;  1LZJ A;  3CKN A;  4ARW A;  3OH2 A;  1QWJ A; 
#chains in the Genus database with same CATH topology
 2VXM A;  1NQI B;  3OC9 A;  1TVY A;  5CQL X;  2D7I A;  2ZU9 A;  5EIY A;  1K4V A;  4NAI A;  5FTS A;  5CQP A;  1JYK A;  4AYL A;  1VZU A;  1MC3 A;  5CMH A;  3JUJ A;  3V0M A;  1HM0 A;  4D0T A;  1OMX A;  3USQ A;  2OI6 A;  4FRH A;  5FUH A;  5L6V A;  3I0L A;  2GGQ A;  2VSI A;  3U2V A;  3F1C A;  4DEC A;  1NHE B;  3V0N A;  1NKH B;  1FXJ A;  3DUV A;  3U2W A;  2VS5 A;  2PGV A;  4IRP A;  5I1F A;  4EE5 A;  5C4E A;  2BO8 A;  3SXC A;  2JCJ A;  2P72 A;  3V0Q A;  3QVB A;  1VM8 A;  4KC2 A;  4KPZ A;  4YS8 A;  5CMJ A;  1H3M A;  3T7O A;  5C1G A;  2YCM A;  4B5B A;  3JUK A;  2RIY A;  3SXD A;  1FO8 A;  2AEC A;  2AE7 A;  1NF5 B;  1SS9 A;  2WVL A;  3HL3 A;  2O1G A;  2OI5 A;  1S4P A;  4FRE A;  2D7R A;  3GUE A;  4HO3 A;  4EE3 A;  2YC3 A;  3ZGF A;  1ZCT A;  2VFZ A;  3SPT A;  5C1L A;  4MND A;  4Y9X A;  3O3P A;  3OKR A;  3PKQ A;  2FFU A;  3KIA A;  1O23 B;  3U2U A;  2RJ8 A;  1ZDG A;  1O7O A;  1VH3 A;  1PZY B;  2CU2 A;  1ZJ3 A;  1I52 A;  2ICX A;  1GWV A;  2APC A;  1G95 A;  4G3Q A;  1ZCU A;  3R3I A;  4FQW A;  5CQM X;  2YES A;  3K8E A;  2PGY A;  1TZF A;  2BO6 A;  2E3D A;  2VSH A;  1QG8 A;  3I0I X;  2QKX A;  4FIY A;  2O1H A;  3IOH A;  4FRA A;  2DPW A;  2XWN A;  3V90 A;  3I0E A;  1WT2 A;  2BO7 A;  1MP5 A;  5IFY A;  2V0L A;  1H7G A;  1LVW A;  3SXG A;  2YQC A;  1FRW A;  2AH9 A;  1FOA A;  4D11 C;  3SXB A;  1WVC A;  5C47 A;  4D48 A;  4HO0 A;  5D91 A;  2Y7A A;  2V0H A;  1HM9 A;  4FRM A;  2XME A;  2JCO A;  4NAK A;  2RIX A;  3CU0 A;  1G1L A;  1W77 A;  4BMA A;  2VS3 A;  2VS4 A;  2Y4M A;  1H5S A;  1GQC A;  2I5E A;  3PNN A;  5C4C A;  3I0H A;  4KRV A;  2VXL A;  1JVG A;  1LL3 A;  2X5Z A;  4CJB A;  1R7Y A;  1LL0 A;  1KWS A;  4D0Z A;  1R7V A;  1MP3 A;  1H5S D;  1WT1 A;  1ZCY A;  4AC3 A;  2UX8 A;  2RJ7 A;  2Y4K A;  3CGX A;  1G97 A;  1R80 A;  2FYB A;  2ZU8 A;  1GWW A;  1ON6 A;  1W57 A;  4HO8 A;  1ON8 A;  4CJ8 A;  1NMM B;  2Y4L A;  1QGS A;  4XWI A;  2JCK A;  1MP4 A;  1H7E A;  4HO5 A;  3CKJ A;  3V8Z A;  1VGW A;  4MYB A;  1G0R A;  5C8R A;  2FYA A;  2XWM A;  1H7F A;  5C1H A;  2Y6P A;  1HJJ A;  5C48 A;  3V91 A;  1VPA A;  1O0R A;  3OAM A;  3U0Y A;  3E25 A;  3ZLL A;  2QGI A;  2P6W A;  4BQH A;  4G3P A;  2AES A;  2WVK A;  4Y63 A;  5AJN A;  3V0O A;  1FWY A;  3ZGG A;  2OEF A;  2FYD B;  1GQ9 A;  1OMZ A;  2AM4 A;  2WEE A;  4FRL A;  1HV9 A;  1INJ A;  3USR A;  1INI A;  4B4G A;  1R7T A;  4O6N A;  4CVH A;  1O7Q A;  2X65 A;  2Q4J A;  4EEO A;  1ZI1 A;  1ZI5 A;  4C2S A;  2D0J A;  5DDV A;  2WGZ A;  1H7T A;  1LZ7 A;  3I0K A;  4HG6 A;  4Y7F A;  4AYJ A;  2Y4J A;  1YP4 A;  3OH1 A;  1HM8 A;  1ZJ2 A;  1JV1 A;  3CKO A;  4ZDQ A;  2J0B A;  4HO9 A;  3RSB A;  1H5T A;  5FTV A;  3LW6 A;  3SX7 A;  5C3D A;  3OGZ A;  1TW1 A;  4LW3 A;  3ZLK A;  1GA8 A;  1H7H A;  5CQO A;  2X5S A;  1V83 A;  1JYL A;  2Z87 A;  4GBP A;  4EE4 A;  5C4D A;  5C49 A;  3NGW A;  2WAW A;  1H5S B;  4KXO A;  2P73 A;  1PZT A;  3D5N A;  3ZF8 A;  4FRD A;  3CKV A;  1OQM B;  4Q7C A;  3IOI A;  1FGG A;  4FCE A;  1G3L A;  2A8U A;  4KNX A;  3FWW A;  1JVD A;  4HCQ A;  5FU8 A;  1G93 A;  2V0K A;  5CMI A;  4M28 A;  4JIS A;  1H7L A;  2J0A A;  1VGZ A;  1R82 A;  4NAL A;  3ST8 A;  4EVW A;  4O6M A;  3D98 A;  2A8W A;  3N9W A;  4FCU A;  5L6S A;  4KNR A;  4M4K A;  1ZCV A;  3U2T A;  4ASY A;  1VGU A;  1H5R A;  4Y62 A;  1VGT A;  1GX4 A;  2YQH A;  1VIC A;  1ZDF A;  5C4B A;  1G8O A;  4HOC A;  2X60 A;  4B4B A;  1ZJP A;  5C4F A;  4M2B A;  1VH1 A;  1Z90 A;  1XHB A;  1ZHJ A;  4P00 A;  5BXC A;  1H4D A;  3OH0 A;  5HS2 A;  3Q4S A;  4CJC A;  1ZI3 A;  2PX7 A;  1YP3 A;  5DDT A;  3JTJ A;  4Y7T A;  5IDT A;  1FO9 A;  5AJP A;  2RJ0 A;  2AGD A;  2FYC B;  1R81 A;  3SXE A;  1NWG B;  1LL2 A;  3PKP A;  2FY7 A;  4NAN A;  2V0J A;  3I0C A;  5JQQ A;  2C0N A;  2RJ9 A;  4Y64 A;  3E26 A;  4ECM A;  1H4C A;  1VZX A;  1LZ0 A;  2RJ1 A;  2XMH A;  5CMF X;  4IRQ A;  5J49 A;  4K6R A;  2NXV A;  3U2X A;  1ZJ0 A;  4AAW A;  1H5T B;  5IDS A;  4FRB A;  3TZT A;  3I0F A;  1WT0 A;  1FR8 A;  2WE9 A;  4LW6 A;  1EYR A;  4JD0 A;  3RMW A;  1FZW A;  3SX3 A;  3BRK X;  1G2V A;  4EEA A;  4M2A A;  2MZB A;  2Z86 A;  4G87 A;  3RMV A;  3F1Y A;  3U0X A;  1FGX A;  1G23 A;  1R7U A;  3EE5 A;  4FRQ A;  1H7Q A;  2YQJ A;  1S4O A;  1HJL A;  4Y7G A;  3Q7U A;  1ZJO A;  2RIT A;  1ZJ1 A;  4Y7U A;  2GGO A;  5EJ1 A;  1IIM A;  3I0D A;  2RJ5 A;  2PA4 A;  2I7B A;  4HO6 A;  2I5K A;  1EZI A;  3Q80 A;  3CKQ A;  3DK5 A;  1H5R B;  4FIX A;  4J18 A;  3SX8 A;  1JV3 A;  2VK9 A;  4DDZ A;  3DJ4 A;  2W0W A;  1S4N A;  1R7X A;  2FFV A;  3POL A;  2RJ6 A;  3OH4 A;  4Y7V A;  3T7M A;  1H4E A;  3BCV A;  3FOQ A;  3T7N A;  3R2W A;  1WT3 A;  3I0J A;  1FXO A;  4L41 C;  3V8Y A;  1ZI4 A;  4DE7 A;  2QH5 A;  5C36 A;  4B2W A;  4KT7 A;  5CMG X;  2YC5 A;  3D8V A;  1WSZ A;  1W55 A;  2XWL A;  4HO2 A;  4Y6N A;  4ASJ A;  5CQN X;  4EEM A;  5D92 A;  4HO4 A;  2AM3 A;  1V82 A;  4B2X A;  1H5S C;  5C3A A;  2WVM A;  2RIZ A;  2E8B A;  4EEG A;  1YP2 A;  4KPX A;  5C38 A;  3V0P A;  5EJZ A;  2ZU7 A;  4KC1 A;  4R7P A;  3OH3 A;  4E1K A;  1VZT A;  1E5K A;  1G9R A;  2ICY A;  1ZIZ A;  5FYE A;  1XZ6 A;  1IIN A;  1TW5 A;  3SXA A;  4FRO A;  1YRO B;  4KQL A;  5C3B A;  2V0I A;  4FRP A;  1FG5 N;  1QGQ A;  5FV9 A;  3IOJ A;  2BO4 A;  3TQD A;  1GX0 A;  4Y6U A;  4B4M A;  1FR9 A;  2O1F A;  5AJO A;  2VD4 A;  2AM5 A;  4G3S A;  2W0V A;  2OI7 A;  1V84 A;  3V0L A;  2RJ4 A;  4KC4 A;  2JCL A;  4D11 A;  4P02 A;  4UEG A;  2OEG A;  1LZI A;  4B3U A;  3K8D A;  5FU0 A;  4B42 A;  3SX5 A;  2YQS A;  3I0G A;  1LZJ A;  3CKN A;  4ARW A;  4MIX A;  3OH2 A;  1QWJ A; 
#chains in the Genus database with same CATH homology
 2VXM A;  1NQI B;  3OC9 A;  1TVY A;  5CQL X;  2D7I A;  2ZU9 A;  5EIY A;  1K4V A;  4NAI A;  5FTS A;  5CQP A;  1JYK A;  4AYL A;  1VZU A;  1MC3 A;  5CMH A;  3JUJ A;  3V0M A;  1HM0 A;  4D0T A;  1OMX A;  3USQ A;  2OI6 A;  4FRH A;  5FUH A;  5L6V A;  3I0L A;  2GGQ A;  2VSI A;  3U2V A;  3F1C A;  4DEC A;  1NHE B;  3V0N A;  1NKH B;  1FXJ A;  3DUV A;  3U2W A;  2VS5 A;  2PGV A;  4IRP A;  5I1F A;  4EE5 A;  5C4E A;  2BO8 A;  3SXC A;  2JCJ A;  2P72 A;  3V0Q A;  3QVB A;  1VM8 A;  4KC2 A;  4KPZ A;  4YS8 A;  5CMJ A;  1H3M A;  3T7O A;  5C1G A;  2YCM A;  4B5B A;  3JUK A;  2RIY A;  3SXD A;  1FO8 A;  2AEC A;  2AE7 A;  1NF5 B;  1SS9 A;  2WVL A;  3HL3 A;  2O1G A;  2OI5 A;  1S4P A;  4FRE A;  2D7R A;  3GUE A;  4HO3 A;  4EE3 A;  2YC3 A;  3ZGF A;  1ZCT A;  2VFZ A;  3SPT A;  5C1L A;  4MND A;  4Y9X A;  3O3P A;  3OKR A;  3PKQ A;  2FFU A;  3KIA A;  1O23 B;  3U2U A;  2RJ8 A;  1ZDG A;  1O7O A;  1VH3 A;  1PZY B;  2CU2 A;  1ZJ3 A;  1I52 A;  2ICX A;  1GWV A;  2APC A;  1G95 A;  4G3Q A;  1ZCU A;  3R3I A;  4FQW A;  5CQM X;  2YES A;  3K8E A;  2PGY A;  1TZF A;  2BO6 A;  2E3D A;  2VSH A;  1QG8 A;  3I0I X;  2QKX A;  4FIY A;  2O1H A;  3IOH A;  4FRA A;  2DPW A;  2XWN A;  3V90 A;  3I0E A;  1WT2 A;  2BO7 A;  1MP5 A;  5IFY A;  2V0L A;  1H7G A;  1LVW A;  3SXG A;  2YQC A;  1FRW A;  2AH9 A;  1FOA A;  4D11 C;  3SXB A;  1WVC A;  5C47 A;  4D48 A;  4HO0 A;  5D91 A;  2Y7A A;  2V0H A;  1HM9 A;  4FRM A;  2XME A;  2JCO A;  4NAK A;  2RIX A;  3CU0 A;  1G1L A;  1W77 A;  4BMA A;  2VS3 A;  2VS4 A;  2Y4M A;  1H5S A;  1GQC A;  2I5E A;  3PNN A;  5C4C A;  3I0H A;  4KRV A;  2VXL A;  1JVG A;  1LL3 A;  2X5Z A;  4CJB A;  1R7Y A;  1LL0 A;  1KWS A;  4D0Z A;  1R7V A;  1MP3 A;  1H5S D;  1WT1 A;  1ZCY A;  4AC3 A;  2UX8 A;  2RJ7 A;  2Y4K A;  3CGX A;  1G97 A;  1R80 A;  2FYB A;  2ZU8 A;  1GWW A;  1ON6 A;  1W57 A;  4HO8 A;  1ON8 A;  4CJ8 A;  1NMM B;  2Y4L A;  1QGS A;  4XWI A;  2JCK A;  1MP4 A;  1H7E A;  4HO5 A;  3CKJ A;  3V8Z A;  1VGW A;  4MYB A;  1G0R A;  5C8R A;  2FYA A;  2XWM A;  1H7F A;  5C1H A;  2Y6P A;  1HJJ A;  5C48 A;  3V91 A;  1VPA A;  1O0R A;  3OAM A;  3U0Y A;  3E25 A;  3ZLL A;  2QGI A;  2P6W A;  4BQH A;  4G3P A;  2AES A;  2WVK A;  4Y63 A;  5AJN A;  3V0O A;  1FWY A;  3ZGG A;  2OEF A;  2FYD B;  1GQ9 A;  1OMZ A;  2AM4 A;  2WEE A;  4FRL A;  1HV9 A;  1INJ A;  3USR A;  1INI A;  4B4G A;  1R7T A;  4O6N A;  4CVH A;  1O7Q A;  2X65 A;  2Q4J A;  4EEO A;  1ZI1 A;  1ZI5 A;  4C2S A;  2D0J A;  5DDV A;  2WGZ A;  1H7T A;  1LZ7 A;  3I0K A;  4HG6 A;  4Y7F A;  4AYJ A;  2Y4J A;  1YP4 A;  3OH1 A;  1HM8 A;  1ZJ2 A;  1JV1 A;  3CKO A;  4ZDQ A;  2J0B A;  4HO9 A;  3RSB A;  1H5T A;  5FTV A;  3LW6 A;  3SX7 A;  5C3D A;  3OGZ A;  1TW1 A;  4LW3 A;  3ZLK A;  1GA8 A;  1H7H A;  5CQO A;  2X5S A;  1V83 A;  1JYL A;  2Z87 A;  4GBP A;  4EE4 A;  5C4D A;  5C49 A;  3NGW A;  2WAW A;  1H5S B;  4KXO A;  2P73 A;  1PZT A;  3D5N A;  3ZF8 A;  4FRD A;  3CKV A;  1OQM B;  4Q7C A;  3IOI A;  1FGG A;  4FCE A;  1G3L A;  2A8U A;  4KNX A;  3FWW A;  1JVD A;  4HCQ A;  5FU8 A;  1G93 A;  2V0K A;  5CMI A;  4M28 A;  4JIS A;  1H7L A;  2J0A A;  1VGZ A;  1R82 A;  4NAL A;  3ST8 A;  4EVW A;  4O6M A;  3D98 A;  2A8W A;  3N9W A;  4FCU A;  5L6S A;  4KNR A;  4M4K A;  1ZCV A;  3U2T A;  4ASY A;  1VGU A;  1H5R A;  4Y62 A;  1VGT A;  1GX4 A;  2YQH A;  1VIC A;  1ZDF A;  5C4B A;  1G8O A;  4HOC A;  2X60 A;  4B4B A;  1ZJP A;  5C4F A;  4M2B A;  1VH1 A;  1Z90 A;  1XHB A;  1ZHJ A;  4P00 A;  5BXC A;  1H4D A;  3OH0 A;  5HS2 A;  3Q4S A;  4CJC A;  1ZI3 A;  2PX7 A;  1YP3 A;  5DDT A;  3JTJ A;  4Y7T A;  5IDT A;  1FO9 A;  5AJP A;  2RJ0 A;  2AGD A;  2FYC B;  1R81 A;  3SXE A;  1NWG B;  1LL2 A;  3PKP A;  2FY7 A;  4NAN A;  2V0J A;  3I0C A;  5JQQ A;  2C0N A;  2RJ9 A;  4Y64 A;  3E26 A;  4ECM A;  1H4C A;  1VZX A;  1LZ0 A;  2RJ1 A;  2XMH A;  5CMF X;  4IRQ A;  5J49 A;  4K6R A;  2NXV A;  3U2X A;  1ZJ0 A;  4AAW A;  1H5T B;  5IDS A;  4FRB A;  3TZT A;  3I0F A;  1WT0 A;  1FR8 A;  2WE9 A;  4LW6 A;  1EYR A;  4JD0 A;  3RMW A;  1FZW A;  3SX3 A;  3BRK X;  1G2V A;  4EEA A;  4M2A A;  2MZB A;  2Z86 A;  4G87 A;  3RMV A;  3F1Y A;  3U0X A;  1FGX A;  1G23 A;  1R7U A;  3EE5 A;  4FRQ A;  1H7Q A;  2YQJ A;  1S4O A;  1HJL A;  4Y7G A;  3Q7U A;  1ZJO A;  2RIT A;  1ZJ1 A;  4Y7U A;  2GGO A;  5EJ1 A;  1IIM A;  3I0D A;  2RJ5 A;  2PA4 A;  2I7B A;  4HO6 A;  2I5K A;  1EZI A;  3Q80 A;  3CKQ A;  3DK5 A;  1H5R B;  4FIX A;  4J18 A;  3SX8 A;  1JV3 A;  2VK9 A;  4DDZ A;  3DJ4 A;  2W0W A;  1S4N A;  1R7X A;  2FFV A;  3POL A;  2RJ6 A;  3OH4 A;  4Y7V A;  3T7M A;  1H4E A;  3BCV A;  3FOQ A;  3T7N A;  3R2W A;  1WT3 A;  3I0J A;  1FXO A;  4L41 C;  3V8Y A;  1ZI4 A;  4DE7 A;  2QH5 A;  5C36 A;  4B2W A;  4KT7 A;  5CMG X;  2YC5 A;  3D8V A;  1WSZ A;  1W55 A;  2XWL A;  4HO2 A;  4Y6N A;  4ASJ A;  5CQN X;  4EEM A;  5D92 A;  4HO4 A;  2AM3 A;  1V82 A;  4B2X A;  1H5S C;  5C3A A;  2WVM A;  2RIZ A;  2E8B A;  4EEG A;  1YP2 A;  4KPX A;  5C38 A;  3V0P A;  5EJZ A;  2ZU7 A;  4KC1 A;  4R7P A;  3OH3 A;  4E1K A;  1VZT A;  1E5K A;  1G9R A;  2ICY A;  1ZIZ A;  5FYE A;  1XZ6 A;  1IIN A;  1TW5 A;  3SXA A;  4FRO A;  1YRO B;  4KQL A;  5C3B A;  2V0I A;  4FRP A;  1FG5 N;  1QGQ A;  5FV9 A;  3IOJ A;  2BO4 A;  3TQD A;  1GX0 A;  4Y6U A;  4B4M A;  1FR9 A;  2O1F A;  5AJO A;  2VD4 A;  2AM5 A;  4G3S A;  2W0V A;  2OI7 A;  1V84 A;  3V0L A;  2RJ4 A;  4KC4 A;  2JCL A;  4D11 A;  4P02 A;  4UEG A;  2OEG A;  1LZI A;  4B3U A;  3K8D A;  5FU0 A;  4B42 A;  3SX5 A;  2YQS A;  3I0G A;  1LZJ A;  3CKN A;  4ARW A;  4MIX A;  3OH2 A;  1QWJ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...