1YROB

Crystal structure of beta14,-galactosyltransferase mutant arg228lys in complex with alpha-lactalbumin in the presence of udp-galactose and mn
Total Genus 92
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
92
sequence length
272
structure length
272
Chain Sequence
LTACPEESPLLVGPMLIEFNIPVDLKLVEQQNPKVKLGGRYTPMDCISPHKVAIIIPFRNRQEHLKYWLYYLHPILQRQQLDYGIYVINQAGESMFNKAKLLNVGFKEALKDYDYNCFVFSDVDLIPMNDHNTYRCFSQPRHISVAMDKFGFSLPYVQYFGGVSALSKQQFLSINGFPNNYWGWGGEDDDIYNRLAFRGMSVSRPNAVIGKTRMIRHSRDKKNEPNPQRFDRIAHTKETMLSDGLNSLTYMVLEVQRYPLYTKITVDIGTPS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ALPHA-LACTALBUMIN
publication title Mutation of Arginine 228 to Lysine Enhances the Glucosyltransferase Activity of Bovine beta-1,4-Galactosyltransferase I
pubmed doi rcsb
source organism Mus musculus
molecule tags Transferase activator/transferase
total genus 92
structure length 272
sequence length 272
chains with identical sequence D
ec nomenclature ec 2.4.1.22: Lactose synthase.
pdb deposition date 2005-02-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF02709 Glyco_transf_7C N-terminal domain of galactosyltransferase
B PF13733 Glyco_transf_7N N-terminal region of glycosyl transferase group 7
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.550.10 Alpha Beta Alpha-Beta Complex Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A 1yroB00
2FYCB 2FYBA 4AC3A 2OI6A 2Y4KA 1IIMA 2VS5A 5CMHA 4EEAA 4CJBA 1FOAA 1G3LA 2VXLA 4M28A 5J49A 3E25A 4MYBA 5EJZA 2P6WA 2WE9A 4HO3A 4IRQA 1O7OA 1O7QA 1FRWA 2A8WA 3F1CA 1S4NA 2AM5A 1LZIA 1G97A 1HM9A 2JCLA 1VGWA 4BMAA 5CQNX 1WT3A 1FGXA 1GQ9A 4G3PA 1HJLA 1FZWA 3U2WA 1FR8A 1ZCTA 4DE7A 4Y63A 5CQPA 3DJ4A 3I0IX 1ZCUA 1O0RA 3SXDA 4Y9XA 1LL3A 3V0LA 4ARWA 4B4GA 4KC1A 1PZYB 1ZJPA 3SX3A 4HO2A 2RJ0A 5DDTA 2FFUA 2VSHA 1R81A 1LZJA 2E3DA 1ZI1A 5HS2A 3HL3A 2QH5A 1H5SD 2I5EA 1W57A 2RJ1A 1ZJ3A 4FRLA 1V82A 3U2XA 5FUHA 4B2WA 4LW6A 3OH1A 1NMMB 1IINA 5C1HA 2FYDB 1H5SC 3V91A 5C4EA 2YC3A 1E5KA 4EE5A 3USRA 3JUJA 4EEMA 3OAMA 1OMXA 3I0HA 3POLA 1R7VA 5CMIA 5CMJA 2I7BA 5C4BA 2AE7A 1INIA 1JV1A 1G23A 3DUVA 4Y7TA 1GX0A 3U0YA 4Y7UA 5AJNA 2X65A 2Q4JA 1LZ7A 3ZGFA 4L41C 4Y6UA 1VZTA 2YQHA 3V0PA 4B2XA 1INJA 4NALA 1ZJ0A 2FFVA 3U2VA 4G3SA 1O23B 1G0RA 4FRHA 2AM4A 1G1LA 3I0JA 3NGWA 5C36A 4KPZA 3FOQA 1R7UA 2BO4A 2W0WA 1H4DA 2RIXA 1QWJA 5L6SA 1H7FA 5C8RA 2ICXA 5JQQA 3IOHA 2X5SA 3U0XA 3ZGGA 2O1HA 1H7HA 4KXOA 2XMEA 1G95A 4M2BA 3OH0A 5C4FA 1GA8A 1YP4A 3RSBA 1NWGB 2YQSA 1EYRA 2A8UA 3V8YA 1WT1A 4FQWA 1VM8A 4IRPA 5EJ1A 3SPTA 1HM0A 5C4DA 5FV9A 4B4BA 3Q4SA 4HO0A 2XMHA 4DECA 1S4PA 2V0LA 2YC5A 3TQDA 2V0JA 2VSIA 2APCA 2P73A 1NF5B 4AYJA 3Q7UA 3CKNA 2PGYA 3DK5A 2RIYA 3K8DA 4FCEA 3V8ZA 2RJ7A 3N9WA 3V0OA 3CU0A 3FWWA 4ECMA 2FY7A 4G3QA 2CU2A 2RIZA 1JYLA 3U2TA 4HO5A 2W0VA 1QGQA 1ZDFA 1VICA 1TVYA 3E26A 4FREA 1SS9A 4LW3A 2DPWA 2PGVA 5AJOA 4KNRA 2YCMA 3I0DA 1QG8A 1TW5A 2V0IA 4AYLA 3V0MA 5C4CA 1R82A 5CQMX 4EVWA 5FYEA 2ZU8A 1H3MA 1ZJ1A 3I0CA 2Y4LA 2RJ4A 5CQOA 4KPXA 1H4CA 3T7OA 1YP2A 2AM3A 2X60A 2AH9A 1JV3A 1LL2A 4FRQA 2O1FA 4JISA 2WVLA 2OEGA 5IFYA 3I0GA 2GGOA 4FRMA 5C3AA 1YROB 4HO6A 3ZF8A 3GUEA 5IDTA 3SXCA 2X5ZA 4P00A 4Y7FA 3OGZA 2RJ6A 1FGGA 2O1GA 3CKJA 5C1LA 2OI5A 1TW1A 1QGSA 3I0EA 4NAIA 3ZLKA 4KT7A 5C49A 1S4OA 5CMFX 2WVKA 2NXVA 5L6VA 5FU0A 4ZDQA 1GWWA 2UX8A 1H4EA 4KNXA 2XWMA 4CJCA 2D7IA 1K4VA 3CGXA 1VPAA 3SX5A 5AJPA 1H7EA 3BCVA 3BRKX 4ASJA 3SX8A 2ZU9A 1ZDGA 2BO8A 2AGDA 1JVDA 3Q80A 5FU8A 1LVWA 2FYAA 3IOJA 1EZIA 3V0QA 4CVHA 3SXAA 3D5NA 3TZTA 4HO9A 5I1FA 1WVCA 1GX4A 2OI7A 2QGIA 1Z90A 3I0KA 4NAKA 5C3BA 2WGZA 2RJ5A 4EEGA 4EE4A 4NANA 2XWNA 4HG6A 2MZBA 1ZI4A 3V0NA 5EIYA 1W77A 3RMVA 1V83A 2QKXA 1H5RA 1V84A 3EE5A 4FRDA 4FCUA 3USQA 5C38A 3F1YA 1ZJOA 2XWLA 3PKPA 1H5TA 3JUKA 4B3UA 2WVMA 4D11A 2WAWA 1NQIB 4KQLA 1H7QA 1ZHJA 2YESA 3T7MA 3OH4A 5C47A 1YP3A 4DDZA 1LL0A 3SXEA 3IOIA 2VFZA 3R3IA 1G2VA 2Y4MA 2D0JA 2ICYA 2VS3A 3QVBA 1HV9A 1VH3A 2GGQA 3ZLLA 1R7YA 4D0ZA 4XWIA 1H5RB 1VGZA 4FRBA 1FO8A 4J18A 3CKVA 1H7TA 4HOCA 3CKOA 5C3DA 4FRPA 2ZU7A 1H5TB 2Y4JA 1MP5A 4Y6NA 1GQCA 2AECA 1WSZA 3OH2A 4KRVA 1H7LA 1G9RA 4Y7VA 1FWYA 3SX7A 5IDSA 1NHEB 4D48A 1WT0A 1H7GA 1MP4A 1W55A 2YQJA 3SXBA 1FXOA 2I5KA 2E8BA 1VZUA 4UEGA 1ZIZA 5C48A 3R2WA 2RITA 1ZCVA 2JCJA 3O3PA 4C2SA 1VGUA 3U2UA 1LZ0A 1KWSA 1ZI5A 1R7TA 3PKQA 4Y62A 3I0FA 1TZFA 1FO9A 4FROA 4EE3A 4M4KA 1VH1A 1PZTA 3OKRA 1ZCYA 4G87A 4MNDA 2V0KA 4Y7GA 4B4MA 4E1KA 4GBPA 5CMGX 2WEEA 1HM8A 1VGTA 4B42A 4B5BA 2Z87A 2JCKA 5BXCA 3OC9A 1XHBA 4CJ8A 1JYKA 3I0LA 1OMZA 2PA4A 4KC4A 2JCOA 3PNNA 1VZXA 3RMWA 3SXGA 3V90A 2RJ9A 1OQMB 4BQHA 4YS8A 3T7NA 3JTJA 2Y6PA 2VS4A 4M2AA 3ST8A 4R7PA 2OEFA 4Y64A 1H5SA 1G8OA 1JVGA 1GWVA 1FXJA 2PX7A 1ZI3A 1XZ6A 4HO4A 2Z86A 5CQLX 4ASYA 5C1GA 3D98A 4KC2A 2D7RA 2YQCA 1I52A 2BO7A 4AAWA 4HO8A 1ON6A 1R80A 1R7XA 4D11C 1FR9A 5FTVA 1MC3A 2VXMA 1ON8A 2VD4A 3D8VA 1FG5N 2P72A 4HCQA 2Y7AA 1ZJ2A 4D0TA 4JD0A 1WT2A 4P02A 2V0HA 1NKHB 1H5SB 1HJJA 3K8EA 5FTSA 1G93A 3LW6A 4EEOA 2AESA 3KIAA 4FRAA 4K6RA 2BO6A 3OH3A 1MP3A 5DDVA 2RJ8A 3CKQA
chains in the Genus database with same CATH superfamily
4FIXA 2FYCB 2FYBA 4AC3A 2OI6A 2Y4KA 1IIMA 2VS5A 5CMHA 4EEAA 4CJBA 1FOAA 1G3LA 2VXLA 4M28A 5J49A 3E25A 4MYBA 5EJZA 2P6WA 2WE9A 4HO3A 4IRQA 1O7OA 1O7QA 1FRWA 2A8WA 3F1CA 1S4NA 2AM5A 1LZIA 1G97A 1HM9A 2JCLA 1VGWA 4BMAA 5CQNX 1WT3A 1FGXA 1GQ9A 4G3PA 1HJLA 1FZWA 3U2WA 1FR8A 1ZCTA 4DE7A 4Y63A 5CQPA 3DJ4A 3I0IX 1ZCUA 1O0RA 3SXDA 4Y9XA 1LL3A 3V0LA 4ARWA 4B4GA 4KC1A 1PZYB 1ZJPA 2C0NA 3SX3A 4HO2A 2RJ0A 5DDTA 2FFUA 2VSHA 1R81A 1LZJA 2E3DA 1ZI1A 5HS2A 3HL3A 2QH5A 1H5SD 2I5EA 1W57A 2RJ1A 1ZJ3A 4FRLA 1V82A 3U2XA 5FUHA 4B2WA 4LW6A 3OH1A 1NMMB 1IINA 5C1HA 2FYDB 1H5SC 3V91A 5C4EA 2YC3A 1E5KA 4EE5A 3USRA 3JUJA 4EEMA 3OAMA 1OMXA 3I0HA 3POLA 1R7VA 5CMIA 5CMJA 2I7BA 5C4BA 2AE7A 1INIA 1JV1A 1G23A 3DUVA 4Y7TA 1GX0A 3U0YA 4Y7UA 5AJNA 2X65A 2Q4JA 1LZ7A 3ZGFA 4L41C 4Y6UA 1VZTA 2YQHA 3V0PA 4B2XA 1INJA 4NALA 1ZJ0A 2FFVA 3U2VA 4G3SA 1O23B 1G0RA 4FRHA 2AM4A 1G1LA 3I0JA 3NGWA 5C36A 4KPZA 3FOQA 1R7UA 2VK9A 2BO4A 2W0WA 1H4DA 2RIXA 1QWJA 5L6SA 1H7FA 5C8RA 2ICXA 5JQQA 3IOHA 2X5SA 3U0XA 3ZGGA 2O1HA 1H7HA 4KXOA 2XMEA 1G95A 4M2BA 3OH0A 5C4FA 1GA8A 1YP4A 3RSBA 1NWGB 2YQSA 1EYRA 2A8UA 3V8YA 1WT1A 4FQWA 1VM8A 4IRPA 5EJ1A 3SPTA 1HM0A 5C4DA 5FV9A 4B4BA 3Q4SA 4HO0A 2XMHA 4DECA 1S4PA 2V0LA 2YC5A 3TQDA 2V0JA 2VSIA 2APCA 2P73A 1NF5B 4AYJA 3Q7UA 3CKNA 2PGYA 3DK5A 2RIYA 3K8DA 4FCEA 3V8ZA 2RJ7A 5D91A 3N9WA 3V0OA 3CU0A 3FWWA 4ECMA 2FY7A 4G3QA 2CU2A 2RIZA 1JYLA 3U2TA 4HO5A 2W0VA 1QGQA 1ZDFA 1VICA 1TVYA 3E26A 4FREA 1SS9A 4LW3A 2DPWA 2PGVA 5AJOA 4KNRA 2YCMA 3I0DA 1QG8A 1TW5A 2V0IA 4AYLA 3V0MA 5C4CA 1R82A 5CQMX 4EVWA 5FYEA 2ZU8A 1H3MA 1ZJ1A 3I0CA 2Y4LA 2RJ4A 5CQOA 4KPXA 1H4CA 3T7OA 1YP2A 2AM3A 2X60A 2AH9A 1JV3A 1LL2A 4FRQA 2O1FA 4JISA 2WVLA 2OEGA 5IFYA 3I0GA 2GGOA 4FRMA 5C3AA 1YROB 4HO6A 3ZF8A 3GUEA 5IDTA 3SXCA 2X5ZA 4P00A 4Y7FA 3OGZA 2RJ6A 1FGGA 2O1GA 3CKJA 5C1LA 2OI5A 1TW1A 1QGSA 3I0EA 4NAIA 3ZLKA 4KT7A 5C49A 2J0BA 1S4OA 5CMFX 2WVKA 2NXVA 5L6VA 5FU0A 4ZDQA 1GWWA 2UX8A 1H4EA 4KNXA 2XWMA 4CJCA 2D7IA 1K4VA 3CGXA 1VPAA 3SX5A 5AJPA 1H7EA 3BCVA 3BRKX 4ASJA 3SX8A 2ZU9A 1ZDGA 2BO8A 2AGDA 1JVDA 3Q80A 5FU8A 1LVWA 2FYAA 3IOJA 1EZIA 4Q7CA 3V0QA 4CVHA 3SXAA 3D5NA 3TZTA 4HO9A 5I1FA 1WVCA 1GX4A 2OI7A 2QGIA 1Z90A 3I0KA 4NAKA 5C3BA 2WGZA 2RJ5A 4EEGA 4EE4A 2J0AA 4NANA 2XWNA 4HG6A 2MZBA 1ZI4A 3V0NA 5EIYA 1W77A 3RMVA 1V83A 2QKXA 1H5RA 1V84A 3EE5A 4FRDA 4FCUA 3USQA 5C38A 3F1YA 1ZJOA 2XWLA 3PKPA 1H5TA 3JUKA 4B3UA 2WVMA 4D11A 2WAWA 1NQIB 4KQLA 1H7QA 1ZHJA 2YESA 3T7MA 3OH4A 5C47A 1YP3A 4DDZA 1LL0A 3SXEA 3IOIA 2VFZA 4O6MA 3R3IA 1G2VA 5D92A 2Y4MA 2D0JA 2ICYA 2VS3A 3QVBA 1HV9A 1VH3A 2GGQA 3ZLLA 1R7YA 4D0ZA 4XWIA 1H5RB 1VGZA 4FRBA 1FO8A 4J18A 3CKVA 1H7TA 4HOCA 3CKOA 5C3DA 4FRPA 2ZU7A 1H5TB 2Y4JA 1MP5A 4Y6NA 1GQCA 2AECA 1WSZA 3OH2A 4KRVA 1H7LA 1G9RA 4Y7VA 1FWYA 3SX7A 5IDSA 1NHEB 4D48A 1WT0A 1H7GA 1MP4A 1W55A 2YQJA 3SXBA 1FXOA 2I5KA 2E8BA 1VZUA 4UEGA 1ZIZA 5C48A 3R2WA 2RITA 1ZCVA 2JCJA 3O3PA 4C2SA 1VGUA 3U2UA 1LZ0A 1KWSA 1ZI5A 1R7TA 3PKQA 4Y62A 3I0FA 4MIXA 1TZFA 1FO9A 4FROA 4EE3A 4M4KA 1VH1A 1PZTA 3OKRA 1ZCYA 4G87A 4MNDA 2V0KA 4Y7GA 4B4MA 4E1KA 4GBPA 5CMGX 2WEEA 1HM8A 1VGTA 4B42A 4B5BA 2Z87A 2JCKA 5BXCA 3OC9A 1XHBA 4CJ8A 1JYKA 3I0LA 1OMZA 2PA4A 4KC4A 2JCOA 3PNNA 1VZXA 3RMWA 3SXGA 3V90A 2RJ9A 1OQMB 4BQHA 4YS8A 3T7NA 3JTJA 2Y6PA 2VS4A 4M2AA 3ST8A 4R7PA 2OEFA 4Y64A 1H5SA 1G8OA 1JVGA 1GWVA 1FXJA 2PX7A 1ZI3A 1XZ6A 4HO4A 2Z86A 5CQLX 4ASYA 5C1GA 3D98A 4KC2A 2D7RA 2YQCA 1I52A 2BO7A 4AAWA 4HO8A 1ON6A 1R80A 1R7XA 4D11C 1FR9A 5FTVA 1MC3A 2VXMA 1ON8A 2VD4A 3D8VA 1FG5N 2P72A 4HCQA 2Y7AA 1ZJ2A 4O6NA 4D0TA 4FIYA 4JD0A 1WT2A 4P02A 2V0HA 1NKHB 1H5SB 1HJJA 3K8EA 5FTSA 1G93A 3LW6A 4EEOA 2AESA 3KIAA 4FRAA 4K6RA 2BO6A 3OH3A 1MP3A 5DDVA 2RJ8A 3CKQA
chains in the Genus database with same CATH topology
4FIXA 2FYCB 2FYBA 4AC3A 2OI6A 2Y4KA 1IIMA 2VS5A 5CMHA 4EEAA 4CJBA 1FOAA 1G3LA 2VXLA 4M28A 5J49A 3E25A 4MYBA 5EJZA 2P6WA 2WE9A 4HO3A 4IRQA 1O7OA 1O7QA 1FRWA 2A8WA 3F1CA 1S4NA 2AM5A 1LZIA 1G97A 1HM9A 2JCLA 1VGWA 4BMAA 5CQNX 1WT3A 1FGXA 1GQ9A 4G3PA 1HJLA 1FZWA 3U2WA 1FR8A 1ZCTA 4DE7A 4Y63A 5CQPA 3DJ4A 3I0IX 1ZCUA 1O0RA 3SXDA 4Y9XA 1LL3A 3V0LA 4ARWA 4B4GA 4KC1A 1PZYB 1ZJPA 2C0NA 3SX3A 4HO2A 2RJ0A 5DDTA 2FFUA 2VSHA 1R81A 1LZJA 2E3DA 1ZI1A 5HS2A 3HL3A 2QH5A 1H5SD 2I5EA 1W57A 2RJ1A 1ZJ3A 4FRLA 1V82A 3U2XA 5FUHA 4B2WA 4LW6A 3OH1A 1NMMB 1IINA 5C1HA 2FYDB 1H5SC 3V91A 5C4EA 2YC3A 1E5KA 4EE5A 3USRA 3JUJA 4EEMA 3OAMA 1OMXA 3I0HA 3POLA 1R7VA 5CMIA 5CMJA 2I7BA 5C4BA 2AE7A 1INIA 1JV1A 1G23A 3DUVA 4Y7TA 1GX0A 3U0YA 4Y7UA 5AJNA 2X65A 2Q4JA 1LZ7A 3ZGFA 4L41C 4Y6UA 1VZTA 2YQHA 3V0PA 4B2XA 1INJA 4NALA 1ZJ0A 2FFVA 3U2VA 4G3SA 1O23B 1G0RA 4FRHA 2AM4A 1G1LA 3I0JA 3NGWA 5C36A 4KPZA 3FOQA 1R7UA 2VK9A 2BO4A 2W0WA 1H4DA 2RIXA 1QWJA 5L6SA 1H7FA 5C8RA 2ICXA 5JQQA 3IOHA 2X5SA 3U0XA 3ZGGA 2O1HA 1H7HA 4KXOA 2XMEA 1G95A 4M2BA 3OH0A 5C4FA 1GA8A 1YP4A 3RSBA 1NWGB 2YQSA 1EYRA 2A8UA 3V8YA 1WT1A 4FQWA 1VM8A 4IRPA 5EJ1A 3SPTA 1HM0A 5C4DA 5FV9A 4B4BA 3Q4SA 4HO0A 2XMHA 4DECA 1S4PA 2V0LA 2YC5A 3TQDA 2V0JA 2VSIA 2APCA 2P73A 1NF5B 4AYJA 3Q7UA 3CKNA 2PGYA 3DK5A 2RIYA 3K8DA 4FCEA 3V8ZA 2RJ7A 5D91A 3N9WA 3V0OA 3CU0A 3FWWA 4ECMA 2FY7A 4G3QA 2CU2A 2RIZA 1JYLA 3U2TA 4HO5A 2W0VA 1QGQA 1ZDFA 1VICA 1TVYA 3E26A 4FREA 1SS9A 4LW3A 2DPWA 2PGVA 5AJOA 4KNRA 2YCMA 3I0DA 1QG8A 1TW5A 2V0IA 4AYLA 3V0MA 5C4CA 1R82A 5CQMX 4EVWA 5FYEA 2ZU8A 1H3MA 1ZJ1A 3I0CA 2Y4LA 2RJ4A 5CQOA 4KPXA 1H4CA 3T7OA 1YP2A 2AM3A 2X60A 2AH9A 1JV3A 1LL2A 4FRQA 2O1FA 4JISA 2WVLA 2OEGA 5IFYA 3I0GA 2GGOA 4FRMA 5C3AA 1YROB 4HO6A 3ZF8A 3GUEA 5IDTA 3SXCA 2X5ZA 4P00A 4Y7FA 3OGZA 2RJ6A 1FGGA 2O1GA 3CKJA 5C1LA 2OI5A 1TW1A 1QGSA 3I0EA 4NAIA 3ZLKA 4KT7A 5C49A 2J0BA 1S4OA 5CMFX 2WVKA 2NXVA 5L6VA 5FU0A 4ZDQA 1GWWA 2UX8A 1H4EA 4KNXA 2XWMA 4CJCA 2D7IA 1K4VA 3CGXA 1VPAA 3SX5A 5AJPA 1H7EA 3BCVA 3BRKX 4ASJA 3SX8A 2ZU9A 1ZDGA 2BO8A 2AGDA 1JVDA 3Q80A 5FU8A 1LVWA 2FYAA 3IOJA 1EZIA 4Q7CA 3V0QA 4CVHA 3SXAA 3D5NA 3TZTA 4HO9A 5I1FA 1WVCA 1GX4A 2OI7A 2QGIA 1Z90A 3I0KA 4NAKA 5C3BA 2WGZA 2RJ5A 4EEGA 4EE4A 2J0AA 4NANA 2XWNA 4HG6A 2MZBA 1ZI4A 3V0NA 5EIYA 1W77A 3RMVA 1V83A 2QKXA 1H5RA 1V84A 3EE5A 4FRDA 4FCUA 3USQA 5C38A 3F1YA 1ZJOA 2XWLA 3PKPA 1H5TA 3JUKA 4B3UA 2WVMA 4D11A 2WAWA 1NQIB 4KQLA 1H7QA 1ZHJA 2YESA 3T7MA 3OH4A 5C47A 1YP3A 4DDZA 1LL0A 3SXEA 3IOIA 2VFZA 4O6MA 3R3IA 1G2VA 5D92A 2Y4MA 2D0JA 2ICYA 2VS3A 3QVBA 1HV9A 1VH3A 2GGQA 3ZLLA 1R7YA 4D0ZA 4XWIA 1H5RB 1VGZA 4FRBA 1FO8A 4J18A 3CKVA 1H7TA 4HOCA 3CKOA 5C3DA 4FRPA 2ZU7A 1H5TB 2Y4JA 1MP5A 4Y6NA 1GQCA 2AECA 1WSZA 3OH2A 4KRVA 1H7LA 1G9RA 4Y7VA 1FWYA 3SX7A 5IDSA 1NHEB 4D48A 1WT0A 1H7GA 1MP4A 1W55A 2YQJA 3SXBA 1FXOA 2I5KA 2E8BA 1VZUA 4UEGA 1ZIZA 5C48A 3R2WA 2RITA 1ZCVA 2JCJA 3O3PA 4C2SA 1VGUA 3U2UA 1LZ0A 1KWSA 1ZI5A 1R7TA 3PKQA 4Y62A 3I0FA 4MIXA 1TZFA 1FO9A 4FROA 4EE3A 4M4KA 1VH1A 1PZTA 3OKRA 1ZCYA 4G87A 4MNDA 2V0KA 4Y7GA 4B4MA 4E1KA 4GBPA 5CMGX 2WEEA 1HM8A 1VGTA 4B42A 4B5BA 2Z87A 2JCKA 5BXCA 3OC9A 1XHBA 4CJ8A 1JYKA 3I0LA 1OMZA 2PA4A 4KC4A 2JCOA 3PNNA 1VZXA 3RMWA 3SXGA 3V90A 2RJ9A 1OQMB 4BQHA 4YS8A 3T7NA 3JTJA 2Y6PA 2VS4A 4M2AA 3ST8A 4R7PA 2OEFA 4Y64A 1H5SA 1G8OA 1JVGA 1GWVA 1FXJA 2PX7A 1ZI3A 1XZ6A 4HO4A 2Z86A 5CQLX 4ASYA 5C1GA 3D98A 4KC2A 2D7RA 2YQCA 1I52A 2BO7A 4AAWA 4HO8A 1ON6A 1R80A 1R7XA 4D11C 1FR9A 5FTVA 1MC3A 2VXMA 1ON8A 2VD4A 3D8VA 1FG5N 2P72A 4HCQA 2Y7AA 1ZJ2A 4O6NA 4D0TA 4FIYA 4JD0A 1WT2A 4P02A 2V0HA 1NKHB 1H5SB 1HJJA 3K8EA 5FTSA 1G93A 3LW6A 4EEOA 2AESA 3KIAA 4FRAA 4K6RA 2BO6A 3OH3A 1MP3A 5DDVA 2RJ8A 3CKQA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2FYC B;  2FYB A;  4AC3 A;  2OI6 A;  2Y4K A;  1IIM A;  2VS5 A;  5CMH A;  4EEA A;  4CJB A;  1FOA A;  1G3L A;  2VXL A;  4M28 A;  5J49 A;  3E25 A;  4MYB A;  5EJZ A;  2P6W A;  2WE9 A;  4HO3 A;  4IRQ A;  1O7O A;  1O7Q A;  1FRW A;  2A8W A;  3F1C A;  1S4N A;  2AM5 A;  1LZI A;  1G97 A;  1HM9 A;  2JCL A;  1VGW A;  4BMA A;  5CQN X;  1WT3 A;  1FGX A;  1GQ9 A;  4G3P A;  1HJL A;  1FZW A;  3U2W A;  1FR8 A;  1ZCT A;  4DE7 A;  4Y63 A;  5CQP A;  3DJ4 A;  3I0I X;  1ZCU A;  1O0R A;  3SXD A;  4Y9X A;  1LL3 A;  3V0L A;  4ARW A;  4B4G A;  4KC1 A;  1PZY B;  1ZJP A;  3SX3 A;  4HO2 A;  2RJ0 A;  5DDT A;  2FFU A;  2VSH A;  1R81 A;  1LZJ A;  2E3D A;  1ZI1 A;  5HS2 A;  3HL3 A;  2QH5 A;  1H5S D;  2I5E A;  1W57 A;  2RJ1 A;  1ZJ3 A;  4FRL A;  1V82 A;  3U2X A;  5FUH A;  4B2W A;  4LW6 A;  3OH1 A;  1NMM B;  1IIN A;  5C1H A;  2FYD B;  1H5S C;  3V91 A;  5C4E A;  2YC3 A;  1E5K A;  4EE5 A;  3USR A;  3JUJ A;  4EEM A;  3OAM A;  1OMX A;  3I0H A;  3POL A;  1R7V A;  5CMI A;  5CMJ A;  2I7B A;  5C4B A;  2AE7 A;  1INI A;  1JV1 A;  1G23 A;  3DUV A;  4Y7T A;  1GX0 A;  3U0Y A;  4Y7U A;  5AJN A;  2X65 A;  2Q4J A;  1LZ7 A;  3ZGF A;  4L41 C;  4Y6U A;  1VZT A;  2YQH A;  3V0P A;  4B2X A;  1INJ A;  4NAL A;  1ZJ0 A;  2FFV A;  3U2V A;  4G3S A;  1O23 B;  1G0R A;  4FRH A;  2AM4 A;  1G1L A;  3I0J A;  3NGW A;  5C36 A;  4KPZ A;  3FOQ A;  1R7U A;  2BO4 A;  2W0W A;  1H4D A;  2RIX A;  1QWJ A;  5L6S A;  1H7F A;  5C8R A;  2ICX A;  5JQQ A;  3IOH A;  2X5S A;  3U0X A;  3ZGG A;  2O1H A;  1H7H A;  4KXO A;  2XME A;  1G95 A;  4M2B A;  3OH0 A;  5C4F A;  1GA8 A;  1YP4 A;  3RSB A;  1NWG B;  2YQS A;  1EYR A;  2A8U A;  3V8Y A;  1WT1 A;  4FQW A;  1VM8 A;  4IRP A;  5EJ1 A;  3SPT A;  1HM0 A;  5C4D A;  5FV9 A;  4B4B A;  3Q4S A;  4HO0 A;  2XMH A;  4DEC A;  1S4P A;  2V0L A;  2YC5 A;  3TQD A;  2V0J A;  2VSI A;  2APC A;  2P73 A;  1NF5 B;  4AYJ A;  3Q7U A;  3CKN A;  2PGY A;  3DK5 A;  2RIY A;  3K8D A;  4FCE A;  3V8Z A;  2RJ7 A;  3N9W A;  3V0O A;  3CU0 A;  3FWW A;  4ECM A;  2FY7 A;  4G3Q A;  2CU2 A;  2RIZ A;  1JYL A;  3U2T A;  4HO5 A;  2W0V A;  1QGQ A;  1ZDF A;  1VIC A;  1TVY A;  3E26 A;  4FRE A;  1SS9 A;  4LW3 A;  2DPW A;  2PGV A;  5AJO A;  4KNR A;  2YCM A;  3I0D A;  1QG8 A;  1TW5 A;  2V0I A;  4AYL A;  3V0M A;  5C4C A;  1R82 A;  5CQM X;  4EVW A;  5FYE A;  2ZU8 A;  1H3M A;  1ZJ1 A;  3I0C A;  2Y4L A;  2RJ4 A;  5CQO A;  4KPX A;  1H4C A;  3T7O A;  1YP2 A;  2AM3 A;  2X60 A;  2AH9 A;  1JV3 A;  1LL2 A;  4FRQ A;  2O1F A;  4JIS A;  2WVL A;  2OEG A;  5IFY A;  3I0G A;  2GGO A;  4FRM A;  5C3A A;  1YRO B;  4HO6 A;  3ZF8 A;  3GUE A;  5IDT A;  3SXC A;  2X5Z A;  4P00 A;  4Y7F A;  3OGZ A;  2RJ6 A;  1FGG A;  2O1G A;  3CKJ A;  5C1L A;  2OI5 A;  1TW1 A;  1QGS A;  3I0E A;  4NAI A;  3ZLK A;  4KT7 A;  5C49 A;  1S4O A;  5CMF X;  2WVK A;  2NXV A;  5L6V A;  5FU0 A;  4ZDQ A;  1GWW A;  2UX8 A;  1H4E A;  4KNX A;  2XWM A;  4CJC A;  2D7I A;  1K4V A;  3CGX A;  1VPA A;  3SX5 A;  5AJP A;  1H7E A;  3BCV A;  3BRK X;  4ASJ A;  3SX8 A;  2ZU9 A;  1ZDG A;  2BO8 A;  2AGD A;  1JVD A;  3Q80 A;  5FU8 A;  1LVW A;  2FYA A;  3IOJ A;  1EZI A;  3V0Q A;  4CVH A;  3SXA A;  3D5N A;  3TZT A;  4HO9 A;  5I1F A;  1WVC A;  1GX4 A;  2OI7 A;  2QGI A;  1Z90 A;  3I0K A;  4NAK A;  5C3B A;  2WGZ A;  2RJ5 A;  4EEG A;  4EE4 A;  4NAN A;  2XWN A;  4HG6 A;  2MZB A;  1ZI4 A;  3V0N A;  5EIY A;  1W77 A;  3RMV A;  1V83 A;  2QKX A;  1H5R A;  1V84 A;  3EE5 A;  4FRD A;  4FCU A;  3USQ A;  5C38 A;  3F1Y A;  1ZJO A;  2XWL A;  3PKP A;  1H5T A;  3JUK A;  4B3U A;  2WVM A;  4D11 A;  2WAW A;  1NQI B;  4KQL A;  1H7Q A;  1ZHJ A;  2YES A;  3T7M A;  3OH4 A;  5C47 A;  1YP3 A;  4DDZ A;  1LL0 A;  3SXE A;  3IOI A;  2VFZ A;  3R3I A;  1G2V A;  2Y4M A;  2D0J A;  2ICY A;  2VS3 A;  3QVB A;  1HV9 A;  1VH3 A;  2GGQ A;  3ZLL A;  1R7Y A;  4D0Z A;  4XWI A;  1H5R B;  1VGZ A;  4FRB A;  1FO8 A;  4J18 A;  3CKV A;  1H7T A;  4HOC A;  3CKO A;  5C3D A;  4FRP A;  2ZU7 A;  1H5T B;  2Y4J A;  1MP5 A;  4Y6N A;  1GQC A;  2AEC A;  1WSZ A;  3OH2 A;  4KRV A;  1H7L A;  1G9R A;  4Y7V A;  1FWY A;  3SX7 A;  5IDS A;  1NHE B;  4D48 A;  1WT0 A;  1H7G A;  1MP4 A;  1W55 A;  2YQJ A;  3SXB A;  1FXO A;  2I5K A;  2E8B A;  1VZU A;  4UEG A;  1ZIZ A;  5C48 A;  3R2W A;  2RIT A;  1ZCV A;  2JCJ A;  3O3P A;  4C2S A;  1VGU A;  3U2U A;  1LZ0 A;  1KWS A;  1ZI5 A;  1R7T A;  3PKQ A;  4Y62 A;  3I0F A;  1TZF A;  1FO9 A;  4FRO A;  4EE3 A;  4M4K A;  1VH1 A;  1PZT A;  3OKR A;  1ZCY A;  4G87 A;  4MND A;  2V0K A;  4Y7G A;  4B4M A;  4E1K A;  4GBP A;  5CMG X;  2WEE A;  1HM8 A;  1VGT A;  4B42 A;  4B5B A;  2Z87 A;  2JCK A;  5BXC A;  3OC9 A;  1XHB A;  4CJ8 A;  1JYK A;  3I0L A;  1OMZ A;  2PA4 A;  4KC4 A;  2JCO A;  3PNN A;  1VZX A;  3RMW A;  3SXG A;  3V90 A;  2RJ9 A;  1OQM B;  4BQH A;  4YS8 A;  3T7N A;  3JTJ A;  2Y6P A;  2VS4 A;  4M2A A;  3ST8 A;  4R7P A;  2OEF A;  4Y64 A;  1H5S A;  1G8O A;  1JVG A;  1GWV A;  1FXJ A;  2PX7 A;  1ZI3 A;  1XZ6 A;  4HO4 A;  2Z86 A;  5CQL X;  4ASY A;  5C1G A;  3D98 A;  4KC2 A;  2D7R A;  2YQC A;  1I52 A;  2BO7 A;  4AAW A;  4HO8 A;  1ON6 A;  1R80 A;  1R7X A;  4D11 C;  1FR9 A;  5FTV A;  1MC3 A;  2VXM A;  1ON8 A;  2VD4 A;  3D8V A;  1FG5 N;  2P72 A;  4HCQ A;  2Y7A A;  1ZJ2 A;  4D0T A;  4JD0 A;  1WT2 A;  4P02 A;  2V0H A;  1NKH B;  1H5S B;  1HJJ A;  3K8E A;  5FTS A;  1G93 A;  3LW6 A;  4EEO A;  2AES A;  3KIA A;  4FRA A;  4K6R A;  2BO6 A;  3OH3 A;  1MP3 A;  5DDV A;  2RJ8 A;  3CKQ A; 
#chains in the Genus database with same CATH topology
 4FIX A;  2FYC B;  2FYB A;  4AC3 A;  2OI6 A;  2Y4K A;  1IIM A;  2VS5 A;  5CMH A;  4EEA A;  4CJB A;  1FOA A;  1G3L A;  2VXL A;  4M28 A;  5J49 A;  3E25 A;  4MYB A;  5EJZ A;  2P6W A;  2WE9 A;  4HO3 A;  4IRQ A;  1O7O A;  1O7Q A;  1FRW A;  2A8W A;  3F1C A;  1S4N A;  2AM5 A;  1LZI A;  1G97 A;  1HM9 A;  2JCL A;  1VGW A;  4BMA A;  5CQN X;  1WT3 A;  1FGX A;  1GQ9 A;  4G3P A;  1HJL A;  1FZW A;  3U2W A;  1FR8 A;  1ZCT A;  4DE7 A;  4Y63 A;  5CQP A;  3DJ4 A;  3I0I X;  1ZCU A;  1O0R A;  3SXD A;  4Y9X A;  1LL3 A;  3V0L A;  4ARW A;  4B4G A;  4KC1 A;  1PZY B;  1ZJP A;  2C0N A;  3SX3 A;  4HO2 A;  2RJ0 A;  5DDT A;  2FFU A;  2VSH A;  1R81 A;  1LZJ A;  2E3D A;  1ZI1 A;  5HS2 A;  3HL3 A;  2QH5 A;  1H5S D;  2I5E A;  1W57 A;  2RJ1 A;  1ZJ3 A;  4FRL A;  1V82 A;  3U2X A;  5FUH A;  4B2W A;  4LW6 A;  3OH1 A;  1NMM B;  1IIN A;  5C1H A;  2FYD B;  1H5S C;  3V91 A;  5C4E A;  2YC3 A;  1E5K A;  4EE5 A;  3USR A;  3JUJ A;  4EEM A;  3OAM A;  1OMX A;  3I0H A;  3POL A;  1R7V A;  5CMI A;  5CMJ A;  2I7B A;  5C4B A;  2AE7 A;  1INI A;  1JV1 A;  1G23 A;  3DUV A;  4Y7T A;  1GX0 A;  3U0Y A;  4Y7U A;  5AJN A;  2X65 A;  2Q4J A;  1LZ7 A;  3ZGF A;  4L41 C;  4Y6U A;  1VZT A;  2YQH A;  3V0P A;  4B2X A;  1INJ A;  4NAL A;  1ZJ0 A;  2FFV A;  3U2V A;  4G3S A;  1O23 B;  1G0R A;  4FRH A;  2AM4 A;  1G1L A;  3I0J A;  3NGW A;  5C36 A;  4KPZ A;  3FOQ A;  1R7U A;  2VK9 A;  2BO4 A;  2W0W A;  1H4D A;  2RIX A;  1QWJ A;  5L6S A;  1H7F A;  5C8R A;  2ICX A;  5JQQ A;  3IOH A;  2X5S A;  3U0X A;  3ZGG A;  2O1H A;  1H7H A;  4KXO A;  2XME A;  1G95 A;  4M2B A;  3OH0 A;  5C4F A;  1GA8 A;  1YP4 A;  3RSB A;  1NWG B;  2YQS A;  1EYR A;  2A8U A;  3V8Y A;  1WT1 A;  4FQW A;  1VM8 A;  4IRP A;  5EJ1 A;  3SPT A;  1HM0 A;  5C4D A;  5FV9 A;  4B4B A;  3Q4S A;  4HO0 A;  2XMH A;  4DEC A;  1S4P A;  2V0L A;  2YC5 A;  3TQD A;  2V0J A;  2VSI A;  2APC A;  2P73 A;  1NF5 B;  4AYJ A;  3Q7U A;  3CKN A;  2PGY A;  3DK5 A;  2RIY A;  3K8D A;  4FCE A;  3V8Z A;  2RJ7 A;  5D91 A;  3N9W A;  3V0O A;  3CU0 A;  3FWW A;  4ECM A;  2FY7 A;  4G3Q A;  2CU2 A;  2RIZ A;  1JYL A;  3U2T A;  4HO5 A;  2W0V A;  1QGQ A;  1ZDF A;  1VIC A;  1TVY A;  3E26 A;  4FRE A;  1SS9 A;  4LW3 A;  2DPW A;  2PGV A;  5AJO A;  4KNR A;  2YCM A;  3I0D A;  1QG8 A;  1TW5 A;  2V0I A;  4AYL A;  3V0M A;  5C4C A;  1R82 A;  5CQM X;  4EVW A;  5FYE A;  2ZU8 A;  1H3M A;  1ZJ1 A;  3I0C A;  2Y4L A;  2RJ4 A;  5CQO A;  4KPX A;  1H4C A;  3T7O A;  1YP2 A;  2AM3 A;  2X60 A;  2AH9 A;  1JV3 A;  1LL2 A;  4FRQ A;  2O1F A;  4JIS A;  2WVL A;  2OEG A;  5IFY A;  3I0G A;  2GGO A;  4FRM A;  5C3A A;  1YRO B;  4HO6 A;  3ZF8 A;  3GUE A;  5IDT A;  3SXC A;  2X5Z A;  4P00 A;  4Y7F A;  3OGZ A;  2RJ6 A;  1FGG A;  2O1G A;  3CKJ A;  5C1L A;  2OI5 A;  1TW1 A;  1QGS A;  3I0E A;  4NAI A;  3ZLK A;  4KT7 A;  5C49 A;  2J0B A;  1S4O A;  5CMF X;  2WVK A;  2NXV A;  5L6V A;  5FU0 A;  4ZDQ A;  1GWW A;  2UX8 A;  1H4E A;  4KNX A;  2XWM A;  4CJC A;  2D7I A;  1K4V A;  3CGX A;  1VPA A;  3SX5 A;  5AJP A;  1H7E A;  3BCV A;  3BRK X;  4ASJ A;  3SX8 A;  2ZU9 A;  1ZDG A;  2BO8 A;  2AGD A;  1JVD A;  3Q80 A;  5FU8 A;  1LVW A;  2FYA A;  3IOJ A;  1EZI A;  4Q7C A;  3V0Q A;  4CVH A;  3SXA A;  3D5N A;  3TZT A;  4HO9 A;  5I1F A;  1WVC A;  1GX4 A;  2OI7 A;  2QGI A;  1Z90 A;  3I0K A;  4NAK A;  5C3B A;  2WGZ A;  2RJ5 A;  4EEG A;  4EE4 A;  2J0A A;  4NAN A;  2XWN A;  4HG6 A;  2MZB A;  1ZI4 A;  3V0N A;  5EIY A;  1W77 A;  3RMV A;  1V83 A;  2QKX A;  1H5R A;  1V84 A;  3EE5 A;  4FRD A;  4FCU A;  3USQ A;  5C38 A;  3F1Y A;  1ZJO A;  2XWL A;  3PKP A;  1H5T A;  3JUK A;  4B3U A;  2WVM A;  4D11 A;  2WAW A;  1NQI B;  4KQL A;  1H7Q A;  1ZHJ A;  2YES A;  3T7M A;  3OH4 A;  5C47 A;  1YP3 A;  4DDZ A;  1LL0 A;  3SXE A;  3IOI A;  2VFZ A;  4O6M A;  3R3I A;  1G2V A;  5D92 A;  2Y4M A;  2D0J A;  2ICY A;  2VS3 A;  3QVB A;  1HV9 A;  1VH3 A;  2GGQ A;  3ZLL A;  1R7Y A;  4D0Z A;  4XWI A;  1H5R B;  1VGZ A;  4FRB A;  1FO8 A;  4J18 A;  3CKV A;  1H7T A;  4HOC A;  3CKO A;  5C3D A;  4FRP A;  2ZU7 A;  1H5T B;  2Y4J A;  1MP5 A;  4Y6N A;  1GQC A;  2AEC A;  1WSZ A;  3OH2 A;  4KRV A;  1H7L A;  1G9R A;  4Y7V A;  1FWY A;  3SX7 A;  5IDS A;  1NHE B;  4D48 A;  1WT0 A;  1H7G A;  1MP4 A;  1W55 A;  2YQJ A;  3SXB A;  1FXO A;  2I5K A;  2E8B A;  1VZU A;  4UEG A;  1ZIZ A;  5C48 A;  3R2W A;  2RIT A;  1ZCV A;  2JCJ A;  3O3P A;  4C2S A;  1VGU A;  3U2U A;  1LZ0 A;  1KWS A;  1ZI5 A;  1R7T A;  3PKQ A;  4Y62 A;  3I0F A;  4MIX A;  1TZF A;  1FO9 A;  4FRO A;  4EE3 A;  4M4K A;  1VH1 A;  1PZT A;  3OKR A;  1ZCY A;  4G87 A;  4MND A;  2V0K A;  4Y7G A;  4B4M A;  4E1K A;  4GBP A;  5CMG X;  2WEE A;  1HM8 A;  1VGT A;  4B42 A;  4B5B A;  2Z87 A;  2JCK A;  5BXC A;  3OC9 A;  1XHB A;  4CJ8 A;  1JYK A;  3I0L A;  1OMZ A;  2PA4 A;  4KC4 A;  2JCO A;  3PNN A;  1VZX A;  3RMW A;  3SXG A;  3V90 A;  2RJ9 A;  1OQM B;  4BQH A;  4YS8 A;  3T7N A;  3JTJ A;  2Y6P A;  2VS4 A;  4M2A A;  3ST8 A;  4R7P A;  2OEF A;  4Y64 A;  1H5S A;  1G8O A;  1JVG A;  1GWV A;  1FXJ A;  2PX7 A;  1ZI3 A;  1XZ6 A;  4HO4 A;  2Z86 A;  5CQL X;  4ASY A;  5C1G A;  3D98 A;  4KC2 A;  2D7R A;  2YQC A;  1I52 A;  2BO7 A;  4AAW A;  4HO8 A;  1ON6 A;  1R80 A;  1R7X A;  4D11 C;  1FR9 A;  5FTV A;  1MC3 A;  2VXM A;  1ON8 A;  2VD4 A;  3D8V A;  1FG5 N;  2P72 A;  4HCQ A;  2Y7A A;  1ZJ2 A;  4O6N A;  4D0T A;  4FIY A;  4JD0 A;  1WT2 A;  4P02 A;  2V0H A;  1NKH B;  1H5S B;  1HJJ A;  3K8E A;  5FTS A;  1G93 A;  3LW6 A;  4EEO A;  2AES A;  3KIA A;  4FRA A;  4K6R A;  2BO6 A;  3OH3 A;  1MP3 A;  5DDV A;  2RJ8 A;  3CKQ A; 
#chains in the Genus database with same CATH homology
 4FIX A;  2FYC B;  2FYB A;  4AC3 A;  2OI6 A;  2Y4K A;  1IIM A;  2VS5 A;  5CMH A;  4EEA A;  4CJB A;  1FOA A;  1G3L A;  2VXL A;  4M28 A;  5J49 A;  3E25 A;  4MYB A;  5EJZ A;  2P6W A;  2WE9 A;  4HO3 A;  4IRQ A;  1O7O A;  1O7Q A;  1FRW A;  2A8W A;  3F1C A;  1S4N A;  2AM5 A;  1LZI A;  1G97 A;  1HM9 A;  2JCL A;  1VGW A;  4BMA A;  5CQN X;  1WT3 A;  1FGX A;  1GQ9 A;  4G3P A;  1HJL A;  1FZW A;  3U2W A;  1FR8 A;  1ZCT A;  4DE7 A;  4Y63 A;  5CQP A;  3DJ4 A;  3I0I X;  1ZCU A;  1O0R A;  3SXD A;  4Y9X A;  1LL3 A;  3V0L A;  4ARW A;  4B4G A;  4KC1 A;  1PZY B;  1ZJP A;  2C0N A;  3SX3 A;  4HO2 A;  2RJ0 A;  5DDT A;  2FFU A;  2VSH A;  1R81 A;  1LZJ A;  2E3D A;  1ZI1 A;  5HS2 A;  3HL3 A;  2QH5 A;  1H5S D;  2I5E A;  1W57 A;  2RJ1 A;  1ZJ3 A;  4FRL A;  1V82 A;  3U2X A;  5FUH A;  4B2W A;  4LW6 A;  3OH1 A;  1NMM B;  1IIN A;  5C1H A;  2FYD B;  1H5S C;  3V91 A;  5C4E A;  2YC3 A;  1E5K A;  4EE5 A;  3USR A;  3JUJ A;  4EEM A;  3OAM A;  1OMX A;  3I0H A;  3POL A;  1R7V A;  5CMI A;  5CMJ A;  2I7B A;  5C4B A;  2AE7 A;  1INI A;  1JV1 A;  1G23 A;  3DUV A;  4Y7T A;  1GX0 A;  3U0Y A;  4Y7U A;  5AJN A;  2X65 A;  2Q4J A;  1LZ7 A;  3ZGF A;  4L41 C;  4Y6U A;  1VZT A;  2YQH A;  3V0P A;  4B2X A;  1INJ A;  4NAL A;  1ZJ0 A;  2FFV A;  3U2V A;  4G3S A;  1O23 B;  1G0R A;  4FRH A;  2AM4 A;  1G1L A;  3I0J A;  3NGW A;  5C36 A;  4KPZ A;  3FOQ A;  1R7U A;  2VK9 A;  2BO4 A;  2W0W A;  1H4D A;  2RIX A;  1QWJ A;  5L6S A;  1H7F A;  5C8R A;  2ICX A;  5JQQ A;  3IOH A;  2X5S A;  3U0X A;  3ZGG A;  2O1H A;  1H7H A;  4KXO A;  2XME A;  1G95 A;  4M2B A;  3OH0 A;  5C4F A;  1GA8 A;  1YP4 A;  3RSB A;  1NWG B;  2YQS A;  1EYR A;  2A8U A;  3V8Y A;  1WT1 A;  4FQW A;  1VM8 A;  4IRP A;  5EJ1 A;  3SPT A;  1HM0 A;  5C4D A;  5FV9 A;  4B4B A;  3Q4S A;  4HO0 A;  2XMH A;  4DEC A;  1S4P A;  2V0L A;  2YC5 A;  3TQD A;  2V0J A;  2VSI A;  2APC A;  2P73 A;  1NF5 B;  4AYJ A;  3Q7U A;  3CKN A;  2PGY A;  3DK5 A;  2RIY A;  3K8D A;  4FCE A;  3V8Z A;  2RJ7 A;  5D91 A;  3N9W A;  3V0O A;  3CU0 A;  3FWW A;  4ECM A;  2FY7 A;  4G3Q A;  2CU2 A;  2RIZ A;  1JYL A;  3U2T A;  4HO5 A;  2W0V A;  1QGQ A;  1ZDF A;  1VIC A;  1TVY A;  3E26 A;  4FRE A;  1SS9 A;  4LW3 A;  2DPW A;  2PGV A;  5AJO A;  4KNR A;  2YCM A;  3I0D A;  1QG8 A;  1TW5 A;  2V0I A;  4AYL A;  3V0M A;  5C4C A;  1R82 A;  5CQM X;  4EVW A;  5FYE A;  2ZU8 A;  1H3M A;  1ZJ1 A;  3I0C A;  2Y4L A;  2RJ4 A;  5CQO A;  4KPX A;  1H4C A;  3T7O A;  1YP2 A;  2AM3 A;  2X60 A;  2AH9 A;  1JV3 A;  1LL2 A;  4FRQ A;  2O1F A;  4JIS A;  2WVL A;  2OEG A;  5IFY A;  3I0G A;  2GGO A;  4FRM A;  5C3A A;  1YRO B;  4HO6 A;  3ZF8 A;  3GUE A;  5IDT A;  3SXC A;  2X5Z A;  4P00 A;  4Y7F A;  3OGZ A;  2RJ6 A;  1FGG A;  2O1G A;  3CKJ A;  5C1L A;  2OI5 A;  1TW1 A;  1QGS A;  3I0E A;  4NAI A;  3ZLK A;  4KT7 A;  5C49 A;  2J0B A;  1S4O A;  5CMF X;  2WVK A;  2NXV A;  5L6V A;  5FU0 A;  4ZDQ A;  1GWW A;  2UX8 A;  1H4E A;  4KNX A;  2XWM A;  4CJC A;  2D7I A;  1K4V A;  3CGX A;  1VPA A;  3SX5 A;  5AJP A;  1H7E A;  3BCV A;  3BRK X;  4ASJ A;  3SX8 A;  2ZU9 A;  1ZDG A;  2BO8 A;  2AGD A;  1JVD A;  3Q80 A;  5FU8 A;  1LVW A;  2FYA A;  3IOJ A;  1EZI A;  4Q7C A;  3V0Q A;  4CVH A;  3SXA A;  3D5N A;  3TZT A;  4HO9 A;  5I1F A;  1WVC A;  1GX4 A;  2OI7 A;  2QGI A;  1Z90 A;  3I0K A;  4NAK A;  5C3B A;  2WGZ A;  2RJ5 A;  4EEG A;  4EE4 A;  2J0A A;  4NAN A;  2XWN A;  4HG6 A;  2MZB A;  1ZI4 A;  3V0N A;  5EIY A;  1W77 A;  3RMV A;  1V83 A;  2QKX A;  1H5R A;  1V84 A;  3EE5 A;  4FRD A;  4FCU A;  3USQ A;  5C38 A;  3F1Y A;  1ZJO A;  2XWL A;  3PKP A;  1H5T A;  3JUK A;  4B3U A;  2WVM A;  4D11 A;  2WAW A;  1NQI B;  4KQL A;  1H7Q A;  1ZHJ A;  2YES A;  3T7M A;  3OH4 A;  5C47 A;  1YP3 A;  4DDZ A;  1LL0 A;  3SXE A;  3IOI A;  2VFZ A;  4O6M A;  3R3I A;  1G2V A;  5D92 A;  2Y4M A;  2D0J A;  2ICY A;  2VS3 A;  3QVB A;  1HV9 A;  1VH3 A;  2GGQ A;  3ZLL A;  1R7Y A;  4D0Z A;  4XWI A;  1H5R B;  1VGZ A;  4FRB A;  1FO8 A;  4J18 A;  3CKV A;  1H7T A;  4HOC A;  3CKO A;  5C3D A;  4FRP A;  2ZU7 A;  1H5T B;  2Y4J A;  1MP5 A;  4Y6N A;  1GQC A;  2AEC A;  1WSZ A;  3OH2 A;  4KRV A;  1H7L A;  1G9R A;  4Y7V A;  1FWY A;  3SX7 A;  5IDS A;  1NHE B;  4D48 A;  1WT0 A;  1H7G A;  1MP4 A;  1W55 A;  2YQJ A;  3SXB A;  1FXO A;  2I5K A;  2E8B A;  1VZU A;  4UEG A;  1ZIZ A;  5C48 A;  3R2W A;  2RIT A;  1ZCV A;  2JCJ A;  3O3P A;  4C2S A;  1VGU A;  3U2U A;  1LZ0 A;  1KWS A;  1ZI5 A;  1R7T A;  3PKQ A;  4Y62 A;  3I0F A;  4MIX A;  1TZF A;  1FO9 A;  4FRO A;  4EE3 A;  4M4K A;  1VH1 A;  1PZT A;  3OKR A;  1ZCY A;  4G87 A;  4MND A;  2V0K A;  4Y7G A;  4B4M A;  4E1K A;  4GBP A;  5CMG X;  2WEE A;  1HM8 A;  1VGT A;  4B42 A;  4B5B A;  2Z87 A;  2JCK A;  5BXC A;  3OC9 A;  1XHB A;  4CJ8 A;  1JYK A;  3I0L A;  1OMZ A;  2PA4 A;  4KC4 A;  2JCO A;  3PNN A;  1VZX A;  3RMW A;  3SXG A;  3V90 A;  2RJ9 A;  1OQM B;  4BQH A;  4YS8 A;  3T7N A;  3JTJ A;  2Y6P A;  2VS4 A;  4M2A A;  3ST8 A;  4R7P A;  2OEF A;  4Y64 A;  1H5S A;  1G8O A;  1JVG A;  1GWV A;  1FXJ A;  2PX7 A;  1ZI3 A;  1XZ6 A;  4HO4 A;  2Z86 A;  5CQL X;  4ASY A;  5C1G A;  3D98 A;  4KC2 A;  2D7R A;  2YQC A;  1I52 A;  2BO7 A;  4AAW A;  4HO8 A;  1ON6 A;  1R80 A;  1R7X A;  4D11 C;  1FR9 A;  5FTV A;  1MC3 A;  2VXM A;  1ON8 A;  2VD4 A;  3D8V A;  1FG5 N;  2P72 A;  4HCQ A;  2Y7A A;  1ZJ2 A;  4O6N A;  4D0T A;  4FIY A;  4JD0 A;  1WT2 A;  4P02 A;  2V0H A;  1NKH B;  1H5S B;  1HJJ A;  3K8E A;  5FTS A;  1G93 A;  3LW6 A;  4EEO A;  2AES A;  3KIA A;  4FRA A;  4K6R A;  2BO6 A;  3OH3 A;  1MP3 A;  5DDV A;  2RJ8 A;  3CKQ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...