2FYCB

Crystal structure of the catalytic domain of bovine beta1,4-galactosyltransferase-i in complex with alpha-lactalbumin, ca and udp-galactose
Total Genus 90
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
90
sequence length
272
structure length
272
Chain Sequence
LTACPEESPLLVGPMLIEFNIPVDLKLVEQQNPKVKLGGRYTPMDCISPHKVAIIIPFRNRQEHLKYWLYYLHPILQRQQLDYGIYVINQAGESMFNRAKLLNVGFKEALKDYDYNCFVFSDVDLIPMNDHNTYRCFSQPRHISVAMDKFGFSLPYVQYFGGVSALSKQQFLSINGFPNNYWGWGGEDDDIYNRLAFRGMSVSRPNAVIGKTRHIRHSRDKKNEPNPQRFDRIAHTKETMLSDGLNSLTYMVLEVQRYPLYTKITVDIGTPS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords Alpha-lactalbumin
publication title Structural Snapshots of beta-1,4-Galactosyltransferase-I Along the Kinetic Pathway.
pubmed doi rcsb
source organism Mus musculus
total genus 90
structure length 272
sequence length 272
chains with identical sequence D
ec nomenclature ec 2.4.1.22: Lactose synthase.
pdb deposition date 2006-02-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF02709 Glyco_transf_7C N-terminal domain of galactosyltransferase
B PF13733 Glyco_transf_7N N-terminal region of glycosyl transferase group 7
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.550.10 Alpha Beta Alpha-Beta Complex Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A 2fycB00
2V0LA 2VS4A 1H5SD 2I5KA 5CMJA 2Y4MA 2UX8A 4BMAA 3BRKX 1FG5N 1VGWA 4KQLA 1G2VA 3GUEA 2QKXA 4KC4A 1VH1A 5C4FA 1JVDA 5CMFX 1VZUA 1NHEB 1NWGB 2OI6A 2X65A 1YROB 2YQJA 5C1HA 2Y4KA 1NF5B 3JUKA 2O1GA 4HO0A 1WT0A 1H5RA 3SPTA 2W0VA 5HS2A 1Z90A 3ZLKA 2D7RA 4HO2A 4NAIA 4ARWA 3OAMA 2XWLA 2VS3A 4D11C 2FY7A 1VZXA 1KWSA 2P73A 2YQCA 4Y7UA 1H5TB 1ZI4A 2OI5A 1VZTA 5I1FA 1LZIA 4EE4A 1ZHJA 1HJJA 3OH4A 3U2XA 5DDVA 1ZDGA 4EEAA 1ZJ3A 1ZDFA 3T7NA 2V0IA 2VSHA 2VFZA 3D98A 2PX7A 1LL2A 5FUHA 4EEOA 4G3PA 1S4OA 4Y62A 4KXOA 1ZJ0A 4M2AA 1ZI3A 5CMIA 4AYLA 3USRA 1ON6A 3CKNA 4R7PA 3I0KA 1O7OA 5BXCA 1R7UA 1ZJOA 1WSZA 2WVLA 1ZJ2A 5EJ1A 5EJZA 4HO3A 4JD0A 1INJA 1V84A 1O23B 1IIMA 3O3PA 3PKPA 3V0QA 4D48A 3U2TA 5C3DA 4FRMA 4B5BA 3KIAA 2YC5A 4AC3A 1E5KA 2Z87A 1FZWA 4NANA 4Y7GA 2RJ8A 2PGYA 2I5EA 4D0ZA 1IINA 3SXAA 2JCLA 1R80A 3I0LA 4Y63A 1OMZA 3V91A 1R7VA 4Y64A 2XWMA 3V0OA 1MP5A 4IRQA 2X60A 3D8VA 5DDTA 4HCQA 1VGZA 3OKRA 1W55A 3ZGFA 5JQQA 2VXLA 4Y6NA 2FYAA 3V0MA 3QVBA 2ZU9A 4KNXA 4ECMA 1WVCA 2W0WA 4Y9XA 4E1KA 3V0NA 2D0JA 2AM4A 1VGTA 1VGUA 2RJ5A 2X5SA 3SX5A 1H7FA 4J18A 3SXEA 1HJLA 4JISA 1O0RA 1I52A 4EVWA 2E3DA 2FYDB 3F1CA 1FOAA 5C47A 4B3UA 4YS8A 5C4CA 4B4BA 3JTJA 2WVMA 3U2VA 4M2BA 3RMWA 1H7QA 2QGIA 4AAWA 1OQMB 1H5TA 5CQMX 1GQ9A 4Y7TA 1NQIB 4ASYA 3V8ZA 1YP2A 5FTSA 4KRVA 1FO9A 5CQLX 5FV9A 1XZ6A 1GWVA 2RJ4A 1LL0A 4KT7A 4KC1A 1FGXA 3RMVA 3V8YA 2AM3A 3F1YA 4G3QA 2ICXA 1GQCA 1H4DA 2AH9A 2NXVA 4LW3A 1V82A 1OMXA 3Q80A 1H4EA 5C49A 1LZ0A 2RITA 3N9WA 4FRAA 1WT2A 1PZYB 4KPXA 2DPWA 1G3LA 2YQSA 2V0HA 3SXDA 1JV3A 4KNRA 3FWWA 2RJ7A 5AJNA 3OH2A 5FU8A 4K6RA 2I7BA 3Q7UA 2VXMA 2RJ1A 2OI7A 3R2WA 1GWWA 2RJ9A 2ZU8A 4G87A 4D0TA 2CU2A 4ASJA 5L6VA 5FYEA 4HO8A 1FGGA 2YCMA 4EEGA 1XHBA 2AE7A 1G9RA 3RSBA 1H7TA 3BCVA 5EIYA 1W57A 2ICYA 5C3BA 1JVGA 4NALA 5J49A 1G95A 2RIXA 5C36A 4D11A 1TW1A 4CJ8A 5CQPA 4B2WA 3R3IA 4AYJA 4CVHA 1H4CA 2JCJA 2VSIA 1ZJPA 3OC9A 2VD4A 1G8OA 4Y6UA 3D5NA 2WE9A 1JV1A 5C4EA 3JUJA 4BQHA 2APCA 3T7MA 4FRPA 2E8BA 2RJ6A 2A8UA 5C1LA 3IOHA 1TVYA 2Y7AA 4B4GA 3ZLLA 3NGWA 2AESA 1SS9A 2QH5A 1ZJ1A 2YQHA 2JCKA 4MYBA 2XWNA 4HOCA 2V0KA 1H5SB 2Q4JA 1GX0A 1TW5A 2JCOA 4P02A 1QGSA 3CKVA 3POLA 4HO6A 3V0LA 2RIYA 1HM8A 3IOJA 1LVWA 2AM5A 3EE5A 4LW6A 1HV9A 1MC3A 4B2XA 3SXBA 1W77A 2OEFA 1S4NA 3FOQA 1G93A 5IDTA 5C4DA 3E25A 1V83A 1G1LA 1R7XA 1QG8A 2X5ZA 3DUVA 1R82A 4FCEA 4ZDQA 3V90A 2FFVA 3CKJA 1ZIZA 1EZIA 5CMHA 1ZCTA 2Y4JA 5CMGX 4XWIA 4MNDA 3ZF8A 3CKOA 4M4KA 5IDSA 3I0IX 1H3MA 4KPZA 4G3SA 3CU0A 1NMMB 3I0GA 1MP4A 1O7QA 4CJCA 1H7LA 1PZTA 1QWJA 4FRQA 4FQWA 3OH3A 3SX3A 3USQA 3ZGGA 4C2SA 4DDZA 2FYBA 4EE5A 2FFUA 4FRHA 5C4BA 4UEGA 5AJPA 1JYLA 4P00A 2O1HA 2BO8A 2VS5A 3I0CA 3OGZA 1G23A 4FRBA 5FTVA 4HO5A 4B42A 2WAWA 1FO8A 1WT1A 2O1FA 1H5SC 1LL3A 3K8EA 1ZCYA 1G0RA 2AECA 3ST8A 3T7OA 4NAKA 1FWYA 4EEMA 1VM8A 3I0EA 1YP3A 1HM0A 2V0JA 3CKQA 1ZCVA 2FYCB 1ZI1A 1R81A 3DJ4A 1VPAA 3I0HA 1H7EA 4B4MA 5C38A 3SX7A 1ZI5A 2YC3A 3V0PA 3SXCA 2A8WA 2GGQA 2BO6A 1GX4A 1H5RB 1FXJA 2Z86A 4KC2A 5AJOA 5CQNX 4M28A 4FRDA 1H7HA 2ZU7A 3U0YA 2P6WA 3U2UA 4GBPA 3U2WA 4HG6A 3SXGA 4DE7A 4DECA 1LZJA 1WT3A 2YESA 3IOIA 1FR9A 2WVKA 3I0DA 4FRLA 2D7IA 2Y6PA 5CQOA 3DK5A 5IFYA 1YP4A 2PA4A 1H5SA 3I0JA 1FXOA 3LW6A 3TQDA 2XMEA 1TZFA 4FREA 1VICA 3TZTA 1QGQA 3HL3A 2BO4A 3U0XA 5C48A 1LZ7A 1ZCUA 3Q4SA 2AGDA 1H7GA 2XMHA 1VH3A 2OEGA 3E26A 4EE3A 2Y4LA 1HM9A 1INIA 1GA8A 2RJ0A 5C3AA 5C8RA 1MP3A 2WGZA 1NKHB 4HO9A 2BO7A 1S4PA 1EYRA 2MZBA 3OH0A 4FCUA 2RIZA 2GGOA 1R7TA 4Y7FA 4HO4A 3PNNA 4L41C 5FU0A 1FR8A 1K4VA 2PGVA 4Y7VA 3OH1A 3PKQA 1ON8A 5C1GA 1R7YA 5L6SA 3CGXA 2WEEA 3SX8A 2P72A 1JYKA 4CJBA 3I0FA 3K8DA 1G97A 4FROA 4IRPA 1FRWA
chains in the Genus database with same CATH superfamily
2V0LA 2VS4A 1H5SD 2I5KA 5CMJA 2Y4MA 2UX8A 4BMAA 3BRKX 1FG5N 1VGWA 4KQLA 1G2VA 3GUEA 2QKXA 4KC4A 1VH1A 5C4FA 1JVDA 5CMFX 1VZUA 1NHEB 1NWGB 4O6NA 2OI6A 2X65A 1YROB 2YQJA 5C1HA 2Y4KA 1NF5B 3JUKA 2O1GA 4HO0A 1WT0A 1H5RA 3SPTA 2W0VA 5HS2A 5D91A 1Z90A 3ZLKA 2D7RA 4HO2A 4NAIA 4ARWA 3OAMA 2XWLA 2VS3A 4D11C 2FY7A 1VZXA 1KWSA 2P73A 2YQCA 4Y7UA 1H5TB 1ZI4A 2OI5A 1VZTA 5I1FA 1LZIA 4EE4A 1ZHJA 1HJJA 3OH4A 3U2XA 5DDVA 1ZDGA 4EEAA 1ZJ3A 1ZDFA 3T7NA 2V0IA 2VSHA 2VFZA 3D98A 2PX7A 1LL2A 5FUHA 4EEOA 4G3PA 1S4OA 4Y62A 4KXOA 1ZJ0A 4M2AA 1ZI3A 5CMIA 4AYLA 3USRA 1ON6A 3CKNA 4R7PA 3I0KA 1O7OA 5BXCA 1R7UA 1ZJOA 1WSZA 2WVLA 1ZJ2A 5EJ1A 5EJZA 4HO3A 4JD0A 1INJA 1V84A 1O23B 1IIMA 3O3PA 3PKPA 3V0QA 4D48A 3U2TA 5C3DA 4FRMA 4B5BA 3KIAA 2YC5A 4AC3A 1E5KA 2Z87A 1FZWA 4NANA 4Y7GA 2RJ8A 2PGYA 2I5EA 4D0ZA 1IINA 3SXAA 2JCLA 1R80A 3I0LA 4Y63A 1OMZA 3V91A 1R7VA 4Y64A 2XWMA 3V0OA 1MP5A 4IRQA 2X60A 3D8VA 5DDTA 4HCQA 1VGZA 3OKRA 1W55A 3ZGFA 5JQQA 2VXLA 4Y6NA 2FYAA 3V0MA 3QVBA 2ZU9A 4KNXA 4ECMA 1WVCA 2W0WA 4Y9XA 4E1KA 3V0NA 2D0JA 2AM4A 1VGTA 1VGUA 2RJ5A 2X5SA 3SX5A 1H7FA 4J18A 3SXEA 1HJLA 4JISA 2J0BA 1O0RA 1I52A 4EVWA 2E3DA 2FYDB 3F1CA 1FOAA 5C47A 4B3UA 4YS8A 5C4CA 4B4BA 3JTJA 4FIYA 2WVMA 3U2VA 4M2BA 3RMWA 1H7QA 2QGIA 4AAWA 1OQMB 1H5TA 5CQMX 1GQ9A 4Y7TA 1NQIB 4ASYA 3V8ZA 1YP2A 5FTSA 4KRVA 1FO9A 5CQLX 5FV9A 1XZ6A 1GWVA 2RJ4A 1LL0A 4KT7A 4KC1A 1FGXA 3RMVA 3V8YA 2AM3A 3F1YA 4G3QA 2ICXA 1GQCA 1H4DA 2AH9A 2NXVA 4LW3A 1V82A 1OMXA 3Q80A 1H4EA 5C49A 1LZ0A 2RITA 3N9WA 4FRAA 1WT2A 1PZYB 4KPXA 2DPWA 1G3LA 2YQSA 2V0HA 3SXDA 1JV3A 4KNRA 3FWWA 2RJ7A 5AJNA 3OH2A 5FU8A 4K6RA 2I7BA 3Q7UA 2VXMA 2RJ1A 2OI7A 3R2WA 1GWWA 2RJ9A 2ZU8A 4G87A 4D0TA 2CU2A 4ASJA 5L6VA 5FYEA 4HO8A 1FGGA 2YCMA 4EEGA 1XHBA 2AE7A 1G9RA 3RSBA 2J0AA 1H7TA 2VK9A 3BCVA 5EIYA 1W57A 2ICYA 5C3BA 1JVGA 4NALA 5J49A 1G95A 2RIXA 5C36A 4D11A 1TW1A 4CJ8A 5CQPA 4B2WA 3R3IA 4AYJA 4CVHA 1H4CA 2JCJA 2VSIA 1ZJPA 3OC9A 2VD4A 1G8OA 4Y6UA 3D5NA 2WE9A 1JV1A 5C4EA 3JUJA 4BQHA 2APCA 3T7MA 4FRPA 2E8BA 2RJ6A 2A8UA 5C1LA 3IOHA 4MIXA 1TVYA 2Y7AA 4B4GA 3ZLLA 3NGWA 2AESA 1SS9A 2QH5A 1ZJ1A 2YQHA 2JCKA 4MYBA 2XWNA 4HOCA 2V0KA 1H5SB 2Q4JA 1GX0A 1TW5A 2JCOA 4P02A 1QGSA 3CKVA 3POLA 4HO6A 3V0LA 5D92A 2RIYA 1HM8A 3IOJA 1LVWA 2AM5A 3EE5A 4LW6A 1HV9A 1MC3A 4B2XA 3SXBA 1W77A 2OEFA 1S4NA 3FOQA 1G93A 5IDTA 5C4DA 3E25A 1V83A 1G1LA 1R7XA 1QG8A 2X5ZA 3DUVA 1R82A 4FCEA 4ZDQA 3V90A 2FFVA 3CKJA 1ZIZA 1EZIA 5CMHA 1ZCTA 2Y4JA 5CMGX 4XWIA 4MNDA 3ZF8A 3CKOA 4M4KA 5IDSA 3I0IX 1H3MA 4KPZA 4G3SA 3CU0A 1NMMB 3I0GA 1MP4A 1O7QA 4CJCA 1H7LA 1PZTA 1QWJA 4FRQA 4FQWA 3OH3A 3SX3A 3USQA 3ZGGA 4C2SA 4DDZA 2FYBA 4EE5A 2FFUA 4FRHA 4FIXA 5C4BA 4UEGA 5AJPA 1JYLA 4P00A 2O1HA 2BO8A 2VS5A 3I0CA 3OGZA 1G23A 4FRBA 5FTVA 4HO5A 4B42A 2WAWA 1FO8A 1WT1A 2O1FA 1H5SC 1LL3A 3K8EA 1ZCYA 1G0RA 2AECA 3ST8A 3T7OA 4NAKA 1FWYA 4EEMA 1VM8A 3I0EA 1YP3A 1HM0A 2V0JA 3CKQA 1ZCVA 2FYCB 1ZI1A 1R81A 3DJ4A 1VPAA 3I0HA 1H7EA 4B4MA 5C38A 3SX7A 1ZI5A 2YC3A 3V0PA 3SXCA 2A8WA 2GGQA 2BO6A 1GX4A 1H5RB 1FXJA 2Z86A 4KC2A 5AJOA 5CQNX 4M28A 4FRDA 1H7HA 2ZU7A 3U0YA 2P6WA 3U2UA 4GBPA 3U2WA 4HG6A 3SXGA 4DE7A 4DECA 1LZJA 1WT3A 2YESA 3IOIA 1FR9A 2WVKA 3I0DA 4FRLA 2D7IA 2Y6PA 5CQOA 3DK5A 5IFYA 1YP4A 2PA4A 1H5SA 3I0JA 1FXOA 3LW6A 3TQDA 2XMEA 1TZFA 4FREA 1VICA 3TZTA 1QGQA 3HL3A 2BO4A 3U0XA 5C48A 1LZ7A 1ZCUA 3Q4SA 2AGDA 1H7GA 2XMHA 1VH3A 2OEGA 3E26A 4EE3A 2Y4LA 1HM9A 1INIA 1GA8A 2RJ0A 5C3AA 5C8RA 1MP3A 2WGZA 4O6MA 1NKHB 4HO9A 2BO7A 1S4PA 1EYRA 2MZBA 3OH0A 4FCUA 2RIZA 2GGOA 1R7TA 4Y7FA 4HO4A 3PNNA 4L41C 5FU0A 1FR8A 1K4VA 2PGVA 2C0NA 4Y7VA 3OH1A 3PKQA 1ON8A 5C1GA 1R7YA 4Q7CA 5L6SA 3CGXA 2WEEA 3SX8A 2P72A 1JYKA 4CJBA 3I0FA 3K8DA 1G97A 4FROA 4IRPA 1FRWA
chains in the Genus database with same CATH topology
2V0LA 2VS4A 1H5SD 2I5KA 5CMJA 2Y4MA 2UX8A 4BMAA 3BRKX 1FG5N 1VGWA 4KQLA 1G2VA 3GUEA 2QKXA 4KC4A 1VH1A 5C4FA 1JVDA 5CMFX 1VZUA 1NHEB 1NWGB 4O6NA 2OI6A 2X65A 1YROB 2YQJA 5C1HA 2Y4KA 1NF5B 3JUKA 2O1GA 4HO0A 1WT0A 1H5RA 3SPTA 2W0VA 5HS2A 5D91A 1Z90A 3ZLKA 2D7RA 4HO2A 4NAIA 4ARWA 3OAMA 2XWLA 2VS3A 4D11C 2FY7A 1VZXA 1KWSA 2P73A 2YQCA 4Y7UA 1H5TB 1ZI4A 2OI5A 1VZTA 5I1FA 1LZIA 4EE4A 1ZHJA 1HJJA 3OH4A 3U2XA 5DDVA 1ZDGA 4EEAA 1ZJ3A 1ZDFA 3T7NA 2V0IA 2VSHA 2VFZA 3D98A 2PX7A 1LL2A 5FUHA 4EEOA 4G3PA 1S4OA 4Y62A 4KXOA 1ZJ0A 4M2AA 1ZI3A 5CMIA 4AYLA 3USRA 1ON6A 3CKNA 4R7PA 3I0KA 1O7OA 5BXCA 1R7UA 1ZJOA 1WSZA 2WVLA 1ZJ2A 5EJ1A 5EJZA 4HO3A 4JD0A 1INJA 1V84A 1O23B 1IIMA 3O3PA 3PKPA 3V0QA 4D48A 3U2TA 5C3DA 4FRMA 4B5BA 3KIAA 2YC5A 4AC3A 1E5KA 2Z87A 1FZWA 4NANA 4Y7GA 2RJ8A 2PGYA 2I5EA 4D0ZA 1IINA 3SXAA 2JCLA 1R80A 3I0LA 4Y63A 1OMZA 3V91A 1R7VA 4Y64A 2XWMA 3V0OA 1MP5A 4IRQA 2X60A 3D8VA 5DDTA 4HCQA 1VGZA 3OKRA 1W55A 3ZGFA 5JQQA 2VXLA 4Y6NA 2FYAA 3V0MA 3QVBA 2ZU9A 4KNXA 4ECMA 1WVCA 2W0WA 4Y9XA 4E1KA 3V0NA 2D0JA 2AM4A 1VGTA 1VGUA 2RJ5A 2X5SA 3SX5A 1H7FA 4J18A 3SXEA 1HJLA 4JISA 2J0BA 1O0RA 1I52A 4EVWA 2E3DA 2FYDB 3F1CA 1FOAA 5C47A 4B3UA 4YS8A 5C4CA 4B4BA 3JTJA 4FIYA 2WVMA 3U2VA 4M2BA 3RMWA 1H7QA 2QGIA 4AAWA 1OQMB 1H5TA 5CQMX 1GQ9A 4Y7TA 1NQIB 4ASYA 3V8ZA 1YP2A 5FTSA 4KRVA 1FO9A 5CQLX 5FV9A 1XZ6A 1GWVA 2RJ4A 1LL0A 4KT7A 4KC1A 1FGXA 3RMVA 3V8YA 2AM3A 3F1YA 4G3QA 2ICXA 1GQCA 1H4DA 2AH9A 2NXVA 4LW3A 1V82A 1OMXA 3Q80A 1H4EA 5C49A 1LZ0A 2RITA 3N9WA 4FRAA 1WT2A 1PZYB 4KPXA 2DPWA 1G3LA 2YQSA 2V0HA 3SXDA 1JV3A 4KNRA 3FWWA 2RJ7A 5AJNA 3OH2A 5FU8A 4K6RA 2I7BA 3Q7UA 2VXMA 2RJ1A 2OI7A 3R2WA 1GWWA 2RJ9A 2ZU8A 4G87A 4D0TA 2CU2A 4ASJA 5L6VA 5FYEA 4HO8A 1FGGA 2YCMA 4EEGA 1XHBA 2AE7A 1G9RA 3RSBA 2J0AA 1H7TA 2VK9A 3BCVA 5EIYA 1W57A 2ICYA 5C3BA 1JVGA 4NALA 5J49A 1G95A 2RIXA 5C36A 4D11A 1TW1A 4CJ8A 5CQPA 4B2WA 3R3IA 4AYJA 4CVHA 1H4CA 2JCJA 2VSIA 1ZJPA 3OC9A 2VD4A 1G8OA 4Y6UA 3D5NA 2WE9A 1JV1A 5C4EA 3JUJA 4BQHA 2APCA 3T7MA 4FRPA 2E8BA 2RJ6A 2A8UA 5C1LA 3IOHA 4MIXA 1TVYA 2Y7AA 4B4GA 3ZLLA 3NGWA 2AESA 1SS9A 2QH5A 1ZJ1A 2YQHA 2JCKA 4MYBA 2XWNA 4HOCA 2V0KA 1H5SB 2Q4JA 1GX0A 1TW5A 2JCOA 4P02A 1QGSA 3CKVA 3POLA 4HO6A 3V0LA 5D92A 2RIYA 1HM8A 3IOJA 1LVWA 2AM5A 3EE5A 4LW6A 1HV9A 1MC3A 4B2XA 3SXBA 1W77A 2OEFA 1S4NA 3FOQA 1G93A 5IDTA 5C4DA 3E25A 1V83A 1G1LA 1R7XA 1QG8A 2X5ZA 3DUVA 1R82A 4FCEA 4ZDQA 3V90A 2FFVA 3CKJA 1ZIZA 1EZIA 5CMHA 1ZCTA 2Y4JA 5CMGX 4XWIA 4MNDA 3ZF8A 3CKOA 4M4KA 5IDSA 3I0IX 1H3MA 4KPZA 4G3SA 3CU0A 1NMMB 3I0GA 1MP4A 1O7QA 4CJCA 1H7LA 1PZTA 1QWJA 4FRQA 4FQWA 3OH3A 3SX3A 3USQA 3ZGGA 4C2SA 4DDZA 2FYBA 4EE5A 2FFUA 4FRHA 4FIXA 5C4BA 4UEGA 5AJPA 1JYLA 4P00A 2O1HA 2BO8A 2VS5A 3I0CA 3OGZA 1G23A 4FRBA 5FTVA 4HO5A 4B42A 2WAWA 1FO8A 1WT1A 2O1FA 1H5SC 1LL3A 3K8EA 1ZCYA 1G0RA 2AECA 3ST8A 3T7OA 4NAKA 1FWYA 4EEMA 1VM8A 3I0EA 1YP3A 1HM0A 2V0JA 3CKQA 1ZCVA 2FYCB 1ZI1A 1R81A 3DJ4A 1VPAA 3I0HA 1H7EA 4B4MA 5C38A 3SX7A 1ZI5A 2YC3A 3V0PA 3SXCA 2A8WA 2GGQA 2BO6A 1GX4A 1H5RB 1FXJA 2Z86A 4KC2A 5AJOA 5CQNX 4M28A 4FRDA 1H7HA 2ZU7A 3U0YA 2P6WA 3U2UA 4GBPA 3U2WA 4HG6A 3SXGA 4DE7A 4DECA 1LZJA 1WT3A 2YESA 3IOIA 1FR9A 2WVKA 3I0DA 4FRLA 2D7IA 2Y6PA 5CQOA 3DK5A 5IFYA 1YP4A 2PA4A 1H5SA 3I0JA 1FXOA 3LW6A 3TQDA 2XMEA 1TZFA 4FREA 1VICA 3TZTA 1QGQA 3HL3A 2BO4A 3U0XA 5C48A 1LZ7A 1ZCUA 3Q4SA 2AGDA 1H7GA 2XMHA 1VH3A 2OEGA 3E26A 4EE3A 2Y4LA 1HM9A 1INIA 1GA8A 2RJ0A 5C3AA 5C8RA 1MP3A 2WGZA 4O6MA 1NKHB 4HO9A 2BO7A 1S4PA 1EYRA 2MZBA 3OH0A 4FCUA 2RIZA 2GGOA 1R7TA 4Y7FA 4HO4A 3PNNA 4L41C 5FU0A 1FR8A 1K4VA 2PGVA 2C0NA 4Y7VA 3OH1A 3PKQA 1ON8A 5C1GA 1R7YA 4Q7CA 5L6SA 3CGXA 2WEEA 3SX8A 2P72A 1JYKA 4CJBA 3I0FA 3K8DA 1G97A 4FROA 4IRPA 1FRWA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2V0L A;  2VS4 A;  1H5S D;  2I5K A;  5CMJ A;  2Y4M A;  2UX8 A;  4BMA A;  3BRK X;  1FG5 N;  1VGW A;  4KQL A;  1G2V A;  3GUE A;  2QKX A;  4KC4 A;  1VH1 A;  5C4F A;  1JVD A;  5CMF X;  1VZU A;  1NHE B;  1NWG B;  2OI6 A;  2X65 A;  1YRO B;  2YQJ A;  5C1H A;  2Y4K A;  1NF5 B;  3JUK A;  2O1G A;  4HO0 A;  1WT0 A;  1H5R A;  3SPT A;  2W0V A;  5HS2 A;  1Z90 A;  3ZLK A;  2D7R A;  4HO2 A;  4NAI A;  4ARW A;  3OAM A;  2XWL A;  2VS3 A;  4D11 C;  2FY7 A;  1VZX A;  1KWS A;  2P73 A;  2YQC A;  4Y7U A;  1H5T B;  1ZI4 A;  2OI5 A;  1VZT A;  5I1F A;  1LZI A;  4EE4 A;  1ZHJ A;  1HJJ A;  3OH4 A;  3U2X A;  5DDV A;  1ZDG A;  4EEA A;  1ZJ3 A;  1ZDF A;  3T7N A;  2V0I A;  2VSH A;  2VFZ A;  3D98 A;  2PX7 A;  1LL2 A;  5FUH A;  4EEO A;  4G3P A;  1S4O A;  4Y62 A;  4KXO A;  1ZJ0 A;  4M2A A;  1ZI3 A;  5CMI A;  4AYL A;  3USR A;  1ON6 A;  3CKN A;  4R7P A;  3I0K A;  1O7O A;  5BXC A;  1R7U A;  1ZJO A;  1WSZ A;  2WVL A;  1ZJ2 A;  5EJ1 A;  5EJZ A;  4HO3 A;  4JD0 A;  1INJ A;  1V84 A;  1O23 B;  1IIM A;  3O3P A;  3PKP A;  3V0Q A;  4D48 A;  3U2T A;  5C3D A;  4FRM A;  4B5B A;  3KIA A;  2YC5 A;  4AC3 A;  1E5K A;  2Z87 A;  1FZW A;  4NAN A;  4Y7G A;  2RJ8 A;  2PGY A;  2I5E A;  4D0Z A;  1IIN A;  3SXA A;  2JCL A;  1R80 A;  3I0L A;  4Y63 A;  1OMZ A;  3V91 A;  1R7V A;  4Y64 A;  2XWM A;  3V0O A;  1MP5 A;  4IRQ A;  2X60 A;  3D8V A;  5DDT A;  4HCQ A;  1VGZ A;  3OKR A;  1W55 A;  3ZGF A;  5JQQ A;  2VXL A;  4Y6N A;  2FYA A;  3V0M A;  3QVB A;  2ZU9 A;  4KNX A;  4ECM A;  1WVC A;  2W0W A;  4Y9X A;  4E1K A;  3V0N A;  2D0J A;  2AM4 A;  1VGT A;  1VGU A;  2RJ5 A;  2X5S A;  3SX5 A;  1H7F A;  4J18 A;  3SXE A;  1HJL A;  4JIS A;  1O0R A;  1I52 A;  4EVW A;  2E3D A;  2FYD B;  3F1C A;  1FOA A;  5C47 A;  4B3U A;  4YS8 A;  5C4C A;  4B4B A;  3JTJ A;  2WVM A;  3U2V A;  4M2B A;  3RMW A;  1H7Q A;  2QGI A;  4AAW A;  1OQM B;  1H5T A;  5CQM X;  1GQ9 A;  4Y7T A;  1NQI B;  4ASY A;  3V8Z A;  1YP2 A;  5FTS A;  4KRV A;  1FO9 A;  5CQL X;  5FV9 A;  1XZ6 A;  1GWV A;  2RJ4 A;  1LL0 A;  4KT7 A;  4KC1 A;  1FGX A;  3RMV A;  3V8Y A;  2AM3 A;  3F1Y A;  4G3Q A;  2ICX A;  1GQC A;  1H4D A;  2AH9 A;  2NXV A;  4LW3 A;  1V82 A;  1OMX A;  3Q80 A;  1H4E A;  5C49 A;  1LZ0 A;  2RIT A;  3N9W A;  4FRA A;  1WT2 A;  1PZY B;  4KPX A;  2DPW A;  1G3L A;  2YQS A;  2V0H A;  3SXD A;  1JV3 A;  4KNR A;  3FWW A;  2RJ7 A;  5AJN A;  3OH2 A;  5FU8 A;  4K6R A;  2I7B A;  3Q7U A;  2VXM A;  2RJ1 A;  2OI7 A;  3R2W A;  1GWW A;  2RJ9 A;  2ZU8 A;  4G87 A;  4D0T A;  2CU2 A;  4ASJ A;  5L6V A;  5FYE A;  4HO8 A;  1FGG A;  2YCM A;  4EEG A;  1XHB A;  2AE7 A;  1G9R A;  3RSB A;  1H7T A;  3BCV A;  5EIY A;  1W57 A;  2ICY A;  5C3B A;  1JVG A;  4NAL A;  5J49 A;  1G95 A;  2RIX A;  5C36 A;  4D11 A;  1TW1 A;  4CJ8 A;  5CQP A;  4B2W A;  3R3I A;  4AYJ A;  4CVH A;  1H4C A;  2JCJ A;  2VSI A;  1ZJP A;  3OC9 A;  2VD4 A;  1G8O A;  4Y6U A;  3D5N A;  2WE9 A;  1JV1 A;  5C4E A;  3JUJ A;  4BQH A;  2APC A;  3T7M A;  4FRP A;  2E8B A;  2RJ6 A;  2A8U A;  5C1L A;  3IOH A;  1TVY A;  2Y7A A;  4B4G A;  3ZLL A;  3NGW A;  2AES A;  1SS9 A;  2QH5 A;  1ZJ1 A;  2YQH A;  2JCK A;  4MYB A;  2XWN A;  4HOC A;  2V0K A;  1H5S B;  2Q4J A;  1GX0 A;  1TW5 A;  2JCO A;  4P02 A;  1QGS A;  3CKV A;  3POL A;  4HO6 A;  3V0L A;  2RIY A;  1HM8 A;  3IOJ A;  1LVW A;  2AM5 A;  3EE5 A;  4LW6 A;  1HV9 A;  1MC3 A;  4B2X A;  3SXB A;  1W77 A;  2OEF A;  1S4N A;  3FOQ A;  1G93 A;  5IDT A;  5C4D A;  3E25 A;  1V83 A;  1G1L A;  1R7X A;  1QG8 A;  2X5Z A;  3DUV A;  1R82 A;  4FCE A;  4ZDQ A;  3V90 A;  2FFV A;  3CKJ A;  1ZIZ A;  1EZI A;  5CMH A;  1ZCT A;  2Y4J A;  5CMG X;  4XWI A;  4MND A;  3ZF8 A;  3CKO A;  4M4K A;  5IDS A;  3I0I X;  1H3M A;  4KPZ A;  4G3S A;  3CU0 A;  1NMM B;  3I0G A;  1MP4 A;  1O7Q A;  4CJC A;  1H7L A;  1PZT A;  1QWJ A;  4FRQ A;  4FQW A;  3OH3 A;  3SX3 A;  3USQ A;  3ZGG A;  4C2S A;  4DDZ A;  2FYB A;  4EE5 A;  2FFU A;  4FRH A;  5C4B A;  4UEG A;  5AJP A;  1JYL A;  4P00 A;  2O1H A;  2BO8 A;  2VS5 A;  3I0C A;  3OGZ A;  1G23 A;  4FRB A;  5FTV A;  4HO5 A;  4B42 A;  2WAW A;  1FO8 A;  1WT1 A;  2O1F A;  1H5S C;  1LL3 A;  3K8E A;  1ZCY A;  1G0R A;  2AEC A;  3ST8 A;  3T7O A;  4NAK A;  1FWY A;  4EEM A;  1VM8 A;  3I0E A;  1YP3 A;  1HM0 A;  2V0J A;  3CKQ A;  1ZCV A;  2FYC B;  1ZI1 A;  1R81 A;  3DJ4 A;  1VPA A;  3I0H A;  1H7E A;  4B4M A;  5C38 A;  3SX7 A;  1ZI5 A;  2YC3 A;  3V0P A;  3SXC A;  2A8W A;  2GGQ A;  2BO6 A;  1GX4 A;  1H5R B;  1FXJ A;  2Z86 A;  4KC2 A;  5AJO A;  5CQN X;  4M28 A;  4FRD A;  1H7H A;  2ZU7 A;  3U0Y A;  2P6W A;  3U2U A;  4GBP A;  3U2W A;  4HG6 A;  3SXG A;  4DE7 A;  4DEC A;  1LZJ A;  1WT3 A;  2YES A;  3IOI A;  1FR9 A;  2WVK A;  3I0D A;  4FRL A;  2D7I A;  2Y6P A;  5CQO A;  3DK5 A;  5IFY A;  1YP4 A;  2PA4 A;  1H5S A;  3I0J A;  1FXO A;  3LW6 A;  3TQD A;  2XME A;  1TZF A;  4FRE A;  1VIC A;  3TZT A;  1QGQ A;  3HL3 A;  2BO4 A;  3U0X A;  5C48 A;  1LZ7 A;  1ZCU A;  3Q4S A;  2AGD A;  1H7G A;  2XMH A;  1VH3 A;  2OEG A;  3E26 A;  4EE3 A;  2Y4L A;  1HM9 A;  1INI A;  1GA8 A;  2RJ0 A;  5C3A A;  5C8R A;  1MP3 A;  2WGZ A;  1NKH B;  4HO9 A;  2BO7 A;  1S4P A;  1EYR A;  2MZB A;  3OH0 A;  4FCU A;  2RIZ A;  2GGO A;  1R7T A;  4Y7F A;  4HO4 A;  3PNN A;  4L41 C;  5FU0 A;  1FR8 A;  1K4V A;  2PGV A;  4Y7V A;  3OH1 A;  3PKQ A;  1ON8 A;  5C1G A;  1R7Y A;  5L6S A;  3CGX A;  2WEE A;  3SX8 A;  2P72 A;  1JYK A;  4CJB A;  3I0F A;  3K8D A;  1G97 A;  4FRO A;  4IRP A;  1FRW A; 
#chains in the Genus database with same CATH topology
 2V0L A;  2VS4 A;  1H5S D;  2I5K A;  5CMJ A;  2Y4M A;  2UX8 A;  4BMA A;  3BRK X;  1FG5 N;  1VGW A;  4KQL A;  1G2V A;  3GUE A;  2QKX A;  4KC4 A;  1VH1 A;  5C4F A;  1JVD A;  5CMF X;  1VZU A;  1NHE B;  1NWG B;  4O6N A;  2OI6 A;  2X65 A;  1YRO B;  2YQJ A;  5C1H A;  2Y4K A;  1NF5 B;  3JUK A;  2O1G A;  4HO0 A;  1WT0 A;  1H5R A;  3SPT A;  2W0V A;  5HS2 A;  5D91 A;  1Z90 A;  3ZLK A;  2D7R A;  4HO2 A;  4NAI A;  4ARW A;  3OAM A;  2XWL A;  2VS3 A;  4D11 C;  2FY7 A;  1VZX A;  1KWS A;  2P73 A;  2YQC A;  4Y7U A;  1H5T B;  1ZI4 A;  2OI5 A;  1VZT A;  5I1F A;  1LZI A;  4EE4 A;  1ZHJ A;  1HJJ A;  3OH4 A;  3U2X A;  5DDV A;  1ZDG A;  4EEA A;  1ZJ3 A;  1ZDF A;  3T7N A;  2V0I A;  2VSH A;  2VFZ A;  3D98 A;  2PX7 A;  1LL2 A;  5FUH A;  4EEO A;  4G3P A;  1S4O A;  4Y62 A;  4KXO A;  1ZJ0 A;  4M2A A;  1ZI3 A;  5CMI A;  4AYL A;  3USR A;  1ON6 A;  3CKN A;  4R7P A;  3I0K A;  1O7O A;  5BXC A;  1R7U A;  1ZJO A;  1WSZ A;  2WVL A;  1ZJ2 A;  5EJ1 A;  5EJZ A;  4HO3 A;  4JD0 A;  1INJ A;  1V84 A;  1O23 B;  1IIM A;  3O3P A;  3PKP A;  3V0Q A;  4D48 A;  3U2T A;  5C3D A;  4FRM A;  4B5B A;  3KIA A;  2YC5 A;  4AC3 A;  1E5K A;  2Z87 A;  1FZW A;  4NAN A;  4Y7G A;  2RJ8 A;  2PGY A;  2I5E A;  4D0Z A;  1IIN A;  3SXA A;  2JCL A;  1R80 A;  3I0L A;  4Y63 A;  1OMZ A;  3V91 A;  1R7V A;  4Y64 A;  2XWM A;  3V0O A;  1MP5 A;  4IRQ A;  2X60 A;  3D8V A;  5DDT A;  4HCQ A;  1VGZ A;  3OKR A;  1W55 A;  3ZGF A;  5JQQ A;  2VXL A;  4Y6N A;  2FYA A;  3V0M A;  3QVB A;  2ZU9 A;  4KNX A;  4ECM A;  1WVC A;  2W0W A;  4Y9X A;  4E1K A;  3V0N A;  2D0J A;  2AM4 A;  1VGT A;  1VGU A;  2RJ5 A;  2X5S A;  3SX5 A;  1H7F A;  4J18 A;  3SXE A;  1HJL A;  4JIS A;  2J0B A;  1O0R A;  1I52 A;  4EVW A;  2E3D A;  2FYD B;  3F1C A;  1FOA A;  5C47 A;  4B3U A;  4YS8 A;  5C4C A;  4B4B A;  3JTJ A;  4FIY A;  2WVM A;  3U2V A;  4M2B A;  3RMW A;  1H7Q A;  2QGI A;  4AAW A;  1OQM B;  1H5T A;  5CQM X;  1GQ9 A;  4Y7T A;  1NQI B;  4ASY A;  3V8Z A;  1YP2 A;  5FTS A;  4KRV A;  1FO9 A;  5CQL X;  5FV9 A;  1XZ6 A;  1GWV A;  2RJ4 A;  1LL0 A;  4KT7 A;  4KC1 A;  1FGX A;  3RMV A;  3V8Y A;  2AM3 A;  3F1Y A;  4G3Q A;  2ICX A;  1GQC A;  1H4D A;  2AH9 A;  2NXV A;  4LW3 A;  1V82 A;  1OMX A;  3Q80 A;  1H4E A;  5C49 A;  1LZ0 A;  2RIT A;  3N9W A;  4FRA A;  1WT2 A;  1PZY B;  4KPX A;  2DPW A;  1G3L A;  2YQS A;  2V0H A;  3SXD A;  1JV3 A;  4KNR A;  3FWW A;  2RJ7 A;  5AJN A;  3OH2 A;  5FU8 A;  4K6R A;  2I7B A;  3Q7U A;  2VXM A;  2RJ1 A;  2OI7 A;  3R2W A;  1GWW A;  2RJ9 A;  2ZU8 A;  4G87 A;  4D0T A;  2CU2 A;  4ASJ A;  5L6V A;  5FYE A;  4HO8 A;  1FGG A;  2YCM A;  4EEG A;  1XHB A;  2AE7 A;  1G9R A;  3RSB A;  2J0A A;  1H7T A;  2VK9 A;  3BCV A;  5EIY A;  1W57 A;  2ICY A;  5C3B A;  1JVG A;  4NAL A;  5J49 A;  1G95 A;  2RIX A;  5C36 A;  4D11 A;  1TW1 A;  4CJ8 A;  5CQP A;  4B2W A;  3R3I A;  4AYJ A;  4CVH A;  1H4C A;  2JCJ A;  2VSI A;  1ZJP A;  3OC9 A;  2VD4 A;  1G8O A;  4Y6U A;  3D5N A;  2WE9 A;  1JV1 A;  5C4E A;  3JUJ A;  4BQH A;  2APC A;  3T7M A;  4FRP A;  2E8B A;  2RJ6 A;  2A8U A;  5C1L A;  3IOH A;  4MIX A;  1TVY A;  2Y7A A;  4B4G A;  3ZLL A;  3NGW A;  2AES A;  1SS9 A;  2QH5 A;  1ZJ1 A;  2YQH A;  2JCK A;  4MYB A;  2XWN A;  4HOC A;  2V0K A;  1H5S B;  2Q4J A;  1GX0 A;  1TW5 A;  2JCO A;  4P02 A;  1QGS A;  3CKV A;  3POL A;  4HO6 A;  3V0L A;  5D92 A;  2RIY A;  1HM8 A;  3IOJ A;  1LVW A;  2AM5 A;  3EE5 A;  4LW6 A;  1HV9 A;  1MC3 A;  4B2X A;  3SXB A;  1W77 A;  2OEF A;  1S4N A;  3FOQ A;  1G93 A;  5IDT A;  5C4D A;  3E25 A;  1V83 A;  1G1L A;  1R7X A;  1QG8 A;  2X5Z A;  3DUV A;  1R82 A;  4FCE A;  4ZDQ A;  3V90 A;  2FFV A;  3CKJ A;  1ZIZ A;  1EZI A;  5CMH A;  1ZCT A;  2Y4J A;  5CMG X;  4XWI A;  4MND A;  3ZF8 A;  3CKO A;  4M4K A;  5IDS A;  3I0I X;  1H3M A;  4KPZ A;  4G3S A;  3CU0 A;  1NMM B;  3I0G A;  1MP4 A;  1O7Q A;  4CJC A;  1H7L A;  1PZT A;  1QWJ A;  4FRQ A;  4FQW A;  3OH3 A;  3SX3 A;  3USQ A;  3ZGG A;  4C2S A;  4DDZ A;  2FYB A;  4EE5 A;  2FFU A;  4FRH A;  4FIX A;  5C4B A;  4UEG A;  5AJP A;  1JYL A;  4P00 A;  2O1H A;  2BO8 A;  2VS5 A;  3I0C A;  3OGZ A;  1G23 A;  4FRB A;  5FTV A;  4HO5 A;  4B42 A;  2WAW A;  1FO8 A;  1WT1 A;  2O1F A;  1H5S C;  1LL3 A;  3K8E A;  1ZCY A;  1G0R A;  2AEC A;  3ST8 A;  3T7O A;  4NAK A;  1FWY A;  4EEM A;  1VM8 A;  3I0E A;  1YP3 A;  1HM0 A;  2V0J A;  3CKQ A;  1ZCV A;  2FYC B;  1ZI1 A;  1R81 A;  3DJ4 A;  1VPA A;  3I0H A;  1H7E A;  4B4M A;  5C38 A;  3SX7 A;  1ZI5 A;  2YC3 A;  3V0P A;  3SXC A;  2A8W A;  2GGQ A;  2BO6 A;  1GX4 A;  1H5R B;  1FXJ A;  2Z86 A;  4KC2 A;  5AJO A;  5CQN X;  4M28 A;  4FRD A;  1H7H A;  2ZU7 A;  3U0Y A;  2P6W A;  3U2U A;  4GBP A;  3U2W A;  4HG6 A;  3SXG A;  4DE7 A;  4DEC A;  1LZJ A;  1WT3 A;  2YES A;  3IOI A;  1FR9 A;  2WVK A;  3I0D A;  4FRL A;  2D7I A;  2Y6P A;  5CQO A;  3DK5 A;  5IFY A;  1YP4 A;  2PA4 A;  1H5S A;  3I0J A;  1FXO A;  3LW6 A;  3TQD A;  2XME A;  1TZF A;  4FRE A;  1VIC A;  3TZT A;  1QGQ A;  3HL3 A;  2BO4 A;  3U0X A;  5C48 A;  1LZ7 A;  1ZCU A;  3Q4S A;  2AGD A;  1H7G A;  2XMH A;  1VH3 A;  2OEG A;  3E26 A;  4EE3 A;  2Y4L A;  1HM9 A;  1INI A;  1GA8 A;  2RJ0 A;  5C3A A;  5C8R A;  1MP3 A;  2WGZ A;  4O6M A;  1NKH B;  4HO9 A;  2BO7 A;  1S4P A;  1EYR A;  2MZB A;  3OH0 A;  4FCU A;  2RIZ A;  2GGO A;  1R7T A;  4Y7F A;  4HO4 A;  3PNN A;  4L41 C;  5FU0 A;  1FR8 A;  1K4V A;  2PGV A;  2C0N A;  4Y7V A;  3OH1 A;  3PKQ A;  1ON8 A;  5C1G A;  1R7Y A;  4Q7C A;  5L6S A;  3CGX A;  2WEE A;  3SX8 A;  2P72 A;  1JYK A;  4CJB A;  3I0F A;  3K8D A;  1G97 A;  4FRO A;  4IRP A;  1FRW A; 
#chains in the Genus database with same CATH homology
 2V0L A;  2VS4 A;  1H5S D;  2I5K A;  5CMJ A;  2Y4M A;  2UX8 A;  4BMA A;  3BRK X;  1FG5 N;  1VGW A;  4KQL A;  1G2V A;  3GUE A;  2QKX A;  4KC4 A;  1VH1 A;  5C4F A;  1JVD A;  5CMF X;  1VZU A;  1NHE B;  1NWG B;  4O6N A;  2OI6 A;  2X65 A;  1YRO B;  2YQJ A;  5C1H A;  2Y4K A;  1NF5 B;  3JUK A;  2O1G A;  4HO0 A;  1WT0 A;  1H5R A;  3SPT A;  2W0V A;  5HS2 A;  5D91 A;  1Z90 A;  3ZLK A;  2D7R A;  4HO2 A;  4NAI A;  4ARW A;  3OAM A;  2XWL A;  2VS3 A;  4D11 C;  2FY7 A;  1VZX A;  1KWS A;  2P73 A;  2YQC A;  4Y7U A;  1H5T B;  1ZI4 A;  2OI5 A;  1VZT A;  5I1F A;  1LZI A;  4EE4 A;  1ZHJ A;  1HJJ A;  3OH4 A;  3U2X A;  5DDV A;  1ZDG A;  4EEA A;  1ZJ3 A;  1ZDF A;  3T7N A;  2V0I A;  2VSH A;  2VFZ A;  3D98 A;  2PX7 A;  1LL2 A;  5FUH A;  4EEO A;  4G3P A;  1S4O A;  4Y62 A;  4KXO A;  1ZJ0 A;  4M2A A;  1ZI3 A;  5CMI A;  4AYL A;  3USR A;  1ON6 A;  3CKN A;  4R7P A;  3I0K A;  1O7O A;  5BXC A;  1R7U A;  1ZJO A;  1WSZ A;  2WVL A;  1ZJ2 A;  5EJ1 A;  5EJZ A;  4HO3 A;  4JD0 A;  1INJ A;  1V84 A;  1O23 B;  1IIM A;  3O3P A;  3PKP A;  3V0Q A;  4D48 A;  3U2T A;  5C3D A;  4FRM A;  4B5B A;  3KIA A;  2YC5 A;  4AC3 A;  1E5K A;  2Z87 A;  1FZW A;  4NAN A;  4Y7G A;  2RJ8 A;  2PGY A;  2I5E A;  4D0Z A;  1IIN A;  3SXA A;  2JCL A;  1R80 A;  3I0L A;  4Y63 A;  1OMZ A;  3V91 A;  1R7V A;  4Y64 A;  2XWM A;  3V0O A;  1MP5 A;  4IRQ A;  2X60 A;  3D8V A;  5DDT A;  4HCQ A;  1VGZ A;  3OKR A;  1W55 A;  3ZGF A;  5JQQ A;  2VXL A;  4Y6N A;  2FYA A;  3V0M A;  3QVB A;  2ZU9 A;  4KNX A;  4ECM A;  1WVC A;  2W0W A;  4Y9X A;  4E1K A;  3V0N A;  2D0J A;  2AM4 A;  1VGT A;  1VGU A;  2RJ5 A;  2X5S A;  3SX5 A;  1H7F A;  4J18 A;  3SXE A;  1HJL A;  4JIS A;  2J0B A;  1O0R A;  1I52 A;  4EVW A;  2E3D A;  2FYD B;  3F1C A;  1FOA A;  5C47 A;  4B3U A;  4YS8 A;  5C4C A;  4B4B A;  3JTJ A;  4FIY A;  2WVM A;  3U2V A;  4M2B A;  3RMW A;  1H7Q A;  2QGI A;  4AAW A;  1OQM B;  1H5T A;  5CQM X;  1GQ9 A;  4Y7T A;  1NQI B;  4ASY A;  3V8Z A;  1YP2 A;  5FTS A;  4KRV A;  1FO9 A;  5CQL X;  5FV9 A;  1XZ6 A;  1GWV A;  2RJ4 A;  1LL0 A;  4KT7 A;  4KC1 A;  1FGX A;  3RMV A;  3V8Y A;  2AM3 A;  3F1Y A;  4G3Q A;  2ICX A;  1GQC A;  1H4D A;  2AH9 A;  2NXV A;  4LW3 A;  1V82 A;  1OMX A;  3Q80 A;  1H4E A;  5C49 A;  1LZ0 A;  2RIT A;  3N9W A;  4FRA A;  1WT2 A;  1PZY B;  4KPX A;  2DPW A;  1G3L A;  2YQS A;  2V0H A;  3SXD A;  1JV3 A;  4KNR A;  3FWW A;  2RJ7 A;  5AJN A;  3OH2 A;  5FU8 A;  4K6R A;  2I7B A;  3Q7U A;  2VXM A;  2RJ1 A;  2OI7 A;  3R2W A;  1GWW A;  2RJ9 A;  2ZU8 A;  4G87 A;  4D0T A;  2CU2 A;  4ASJ A;  5L6V A;  5FYE A;  4HO8 A;  1FGG A;  2YCM A;  4EEG A;  1XHB A;  2AE7 A;  1G9R A;  3RSB A;  2J0A A;  1H7T A;  2VK9 A;  3BCV A;  5EIY A;  1W57 A;  2ICY A;  5C3B A;  1JVG A;  4NAL A;  5J49 A;  1G95 A;  2RIX A;  5C36 A;  4D11 A;  1TW1 A;  4CJ8 A;  5CQP A;  4B2W A;  3R3I A;  4AYJ A;  4CVH A;  1H4C A;  2JCJ A;  2VSI A;  1ZJP A;  3OC9 A;  2VD4 A;  1G8O A;  4Y6U A;  3D5N A;  2WE9 A;  1JV1 A;  5C4E A;  3JUJ A;  4BQH A;  2APC A;  3T7M A;  4FRP A;  2E8B A;  2RJ6 A;  2A8U A;  5C1L A;  3IOH A;  4MIX A;  1TVY A;  2Y7A A;  4B4G A;  3ZLL A;  3NGW A;  2AES A;  1SS9 A;  2QH5 A;  1ZJ1 A;  2YQH A;  2JCK A;  4MYB A;  2XWN A;  4HOC A;  2V0K A;  1H5S B;  2Q4J A;  1GX0 A;  1TW5 A;  2JCO A;  4P02 A;  1QGS A;  3CKV A;  3POL A;  4HO6 A;  3V0L A;  5D92 A;  2RIY A;  1HM8 A;  3IOJ A;  1LVW A;  2AM5 A;  3EE5 A;  4LW6 A;  1HV9 A;  1MC3 A;  4B2X A;  3SXB A;  1W77 A;  2OEF A;  1S4N A;  3FOQ A;  1G93 A;  5IDT A;  5C4D A;  3E25 A;  1V83 A;  1G1L A;  1R7X A;  1QG8 A;  2X5Z A;  3DUV A;  1R82 A;  4FCE A;  4ZDQ A;  3V90 A;  2FFV A;  3CKJ A;  1ZIZ A;  1EZI A;  5CMH A;  1ZCT A;  2Y4J A;  5CMG X;  4XWI A;  4MND A;  3ZF8 A;  3CKO A;  4M4K A;  5IDS A;  3I0I X;  1H3M A;  4KPZ A;  4G3S A;  3CU0 A;  1NMM B;  3I0G A;  1MP4 A;  1O7Q A;  4CJC A;  1H7L A;  1PZT A;  1QWJ A;  4FRQ A;  4FQW A;  3OH3 A;  3SX3 A;  3USQ A;  3ZGG A;  4C2S A;  4DDZ A;  2FYB A;  4EE5 A;  2FFU A;  4FRH A;  4FIX A;  5C4B A;  4UEG A;  5AJP A;  1JYL A;  4P00 A;  2O1H A;  2BO8 A;  2VS5 A;  3I0C A;  3OGZ A;  1G23 A;  4FRB A;  5FTV A;  4HO5 A;  4B42 A;  2WAW A;  1FO8 A;  1WT1 A;  2O1F A;  1H5S C;  1LL3 A;  3K8E A;  1ZCY A;  1G0R A;  2AEC A;  3ST8 A;  3T7O A;  4NAK A;  1FWY A;  4EEM A;  1VM8 A;  3I0E A;  1YP3 A;  1HM0 A;  2V0J A;  3CKQ A;  1ZCV A;  2FYC B;  1ZI1 A;  1R81 A;  3DJ4 A;  1VPA A;  3I0H A;  1H7E A;  4B4M A;  5C38 A;  3SX7 A;  1ZI5 A;  2YC3 A;  3V0P A;  3SXC A;  2A8W A;  2GGQ A;  2BO6 A;  1GX4 A;  1H5R B;  1FXJ A;  2Z86 A;  4KC2 A;  5AJO A;  5CQN X;  4M28 A;  4FRD A;  1H7H A;  2ZU7 A;  3U0Y A;  2P6W A;  3U2U A;  4GBP A;  3U2W A;  4HG6 A;  3SXG A;  4DE7 A;  4DEC A;  1LZJ A;  1WT3 A;  2YES A;  3IOI A;  1FR9 A;  2WVK A;  3I0D A;  4FRL A;  2D7I A;  2Y6P A;  5CQO A;  3DK5 A;  5IFY A;  1YP4 A;  2PA4 A;  1H5S A;  3I0J A;  1FXO A;  3LW6 A;  3TQD A;  2XME A;  1TZF A;  4FRE A;  1VIC A;  3TZT A;  1QGQ A;  3HL3 A;  2BO4 A;  3U0X A;  5C48 A;  1LZ7 A;  1ZCU A;  3Q4S A;  2AGD A;  1H7G A;  2XMH A;  1VH3 A;  2OEG A;  3E26 A;  4EE3 A;  2Y4L A;  1HM9 A;  1INI A;  1GA8 A;  2RJ0 A;  5C3A A;  5C8R A;  1MP3 A;  2WGZ A;  4O6M A;  1NKH B;  4HO9 A;  2BO7 A;  1S4P A;  1EYR A;  2MZB A;  3OH0 A;  4FCU A;  2RIZ A;  2GGO A;  1R7T A;  4Y7F A;  4HO4 A;  3PNN A;  4L41 C;  5FU0 A;  1FR8 A;  1K4V A;  2PGV A;  2C0N A;  4Y7V A;  3OH1 A;  3PKQ A;  1ON8 A;  5C1G A;  1R7Y A;  4Q7C A;  5L6S A;  3CGX A;  2WEE A;  3SX8 A;  2P72 A;  1JYK A;  4CJB A;  3I0F A;  3K8D A;  1G97 A;  4FRO A;  4IRP A;  1FRW A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...