2FYCB

Crystal structure of the catalytic domain of bovine beta1,4-galactosyltransferase-i in complex with alpha-lactalbumin, ca and udp-galactose
Total Genus 90
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
90
sequence length
272
structure length
272
Chain Sequence
LTACPEESPLLVGPMLIEFNIPVDLKLVEQQNPKVKLGGRYTPMDCISPHKVAIIIPFRNRQEHLKYWLYYLHPILQRQQLDYGIYVINQAGESMFNRAKLLNVGFKEALKDYDYNCFVFSDVDLIPMNDHNTYRCFSQPRHISVAMDKFGFSLPYVQYFGGVSALSKQQFLSINGFPNNYWGWGGEDDDIYNRLAFRGMSVSRPNAVIGKTRHIRHSRDKKNEPNPQRFDRIAHTKETMLSDGLNSLTYMVLEVQRYPLYTKITVDIGTPS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Alpha-lactalbumin
publication title Structural Snapshots of beta-1,4-Galactosyltransferase-I Along the Kinetic Pathway.
pubmed doi rcsb
source organism Mus musculus
molecule tags Transferase
total genus 90
structure length 272
sequence length 272
chains with identical sequence D
ec nomenclature ec 2.4.1.22: Lactose synthase.
pdb deposition date 2006-02-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF02709 Glyco_transf_7C N-terminal domain of galactosyltransferase
B PF13733 Glyco_transf_7N N-terminal region of glycosyl transferase group 7
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.550.10 Alpha Beta Alpha-Beta Complex Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A 2fycB00
1O23B 4M28A 1G1LA 3I0HA 1ZCVA 2NXVA 1VM8A 2E8BA 3I0CA 3I0LA 2AH9A 1FZWA 1FOAA 1H4CA 2Y4KA 1H7HA 1I52A 2ZU8A 3I0GA 2V0KA 3OH1A 4EEOA 1R7UA 1WT2A 3SXAA 1HM0A 3I0IX 3O3PA 4Y7TA 1QWJA 4NAKA 3V0OA 4AYJA 4FRMA 2XWNA 3SXEA 4B4BA 2V0HA 4KT7A 4FREA 1QGQA 2P6WA 4M4KA 2RJ6A 2FFVA 2FYDB 2VS3A 5CMFX 3BCVA 1G93A 4D0TA 4LW3A 1H5RB 1LL0A 2D7RA 2OI7A 2YQHA 1G8OA 1LZ0A 1WSZA 1GA8A 4CVHA 4C2SA 2VS4A 1JV3A 1ZIZA 3CGXA 3CKNA 1VGZA 3V8ZA 1W77A 1YP4A 1ZJ1A 2X60A 3F1YA 2V0IA 2E3DA 2VXMA 1OQMB 5EJZA 4EE5A 5FUHA 1MP5A 2RIXA 1XHBA 2OI6A 3D98A 1WT0A 5FYEA 5J49A 2YC5A 3ST8A 4NAIA 1NWGB 4HO8A 3SPTA 1IIMA 3USQA 5JQQA 3PKQA 4FRDA 4HO3A 4M2BA 1G2VA 4B4MA 5AJOA 2FY7A 4EEAA 1K4VA 4GBPA 2APCA 2O1GA 1PZTA 3R3IA 5IFYA 3RMVA 3OC9A 2XWMA 1FXOA 1V84A 4B4GA 5C8RA 2PA4A 2FYCB 3U2VA 1PZYB 3SX3A 3OH4A 1FG5N 4D0ZA 5CMJA 1TVYA 3FOQA 3LW6A 1MP3A 4HO4A 4LW6A 5CQPA 2BO6A 4Y9XA 1S4PA 2DPWA 3U2XA 4K6RA 1MC3A 1GWWA 4HCQA 1VPAA 1H7LA 2YESA 3EE5A 3T7MA 1FXJA 4D11A 2XMEA 4Y7GA 5C3BA 2V0JA 1NHEB 3SXGA 2VSIA 4AC3A 1TW1A 3OH3A 3IOHA 5EIYA 5C1HA 5DDTA 4KC1A 1R82A 1Z90A 2Y4MA 4ASJA 1ZCYA 3ZF8A 2OEGA 1S4NA 2Y6PA 1VGWA 3DK5A 3U2UA 2GGQA 2Q4JA 4E1KA 4FRPA 5I1FA 5CMGX 1H7GA 3V0QA 5C3DA 5C4EA 3N9WA 2PX7A 1W55A 2AM4A 5FTSA 4L41C 1QG8A 2RJ9A 2BO8A 2A8UA 1NKHB 2YQCA 1EYRA 4D48A 4B5BA 2ZU9A 1NQIB 2X5SA 2VD4A 4Y7VA 4G3PA 2YC3A 4ECMA 3CKOA 2BO7A 1G97A 2I5EA 3Q80A 3E26A 1V82A 4KPZA 4BQHA 3CKVA 2CU2A 3Q7UA 1O7QA 4NALA 2WGZA 5L6SA 5C4CA 1H7FA 1TW5A 4EVWA 3I0JA 2ZU7A 1S4OA 4Y7FA 3CKJA 4DE7A 1ZCUA 3V0PA 1OMZA 1WVCA 2WVLA 4G3SA 2AM3A 4FRHA 1INJA 4KNRA 2RIYA 3RSBA 5EJ1A 2D0JA 2WAWA 2XWLA 1HM8A 3D8VA 3SXDA 3V0NA 4DDZA 2QH5A 2VSHA 2W0VA 1H5SA 3U2TA 2GGOA 1ZDGA 2O1HA 4MYBA 4BMAA 2WE9A 2YQSA 3QVBA 4P02A 3I0DA 2JCKA 1H4EA 1WT1A 1R7XA 2FFUA 1JVDA 2AECA 4KXOA 1H4DA 3USRA 2RJ5A 1JV1A 1HJJA 2RJ7A 3SX5A 4AAWA 4KC2A 4KQLA 4CJ8A 1KWSA 5AJPA 2ICXA 1VH3A 1INIA 3ZGFA 3OAMA 1FWYA 2Y4LA 2WVMA 1JYLA 1H5TA 2WVKA 5AJNA 4YS8A 1H5SD 1LZJA 1ON6A 4KPXA 1LZIA 5C4DA 1ZJ2A 1VGTA 4Y6UA 2UX8A 3CU0A 3SXCA 1ZJ0A 4EEGA 3KIAA 1NF5B 4IRQA 2RJ4A 3E25A 3F1CA 3PNNA 3U0XA 1SS9A 3TQDA 2I7BA 5FU8A 3V91A 1ZI4A 2FYBA 2P72A 2BO4A 4FRAA 1VICA 3ZLKA 1ZI3A 3V90A 2AM5A 1O7OA 3I0FA 2RJ8A 1ZI5A 2XMHA 4EE4A 3JUKA 3T7OA 3DUVA 2RIZA 4CJCA 4D11C 4R7PA 1GX0A 5C3AA 1GQCA 3JTJA 5FTVA 1ZI1A 1HM9A 1TZFA 4MNDA 2I5KA 2W0WA 4B2XA 1NMMB 3TZTA 1FGGA 1R80A 1EZIA 3GUEA 3K8EA 3V0MA 2A8WA 4DECA 1H5RA 5L6VA 1VH1A 2VS5A 4FRQA 2AGDA 3CKQA 4HO0A 2AE7A 4HO6A 3D5NA 1G23A 1LL3A 2O1FA 4G3QA 3FWWA 4HOCA 5C1GA 2YCMA 2ICYA 5HS2A 4FCEA 3NGWA 3ZLLA 1VZUA 1W57A 3Q4SA 2Z87A 5BXCA 3U2WA 1FGXA 5DDVA 1E5KA 1FO8A 3DJ4A 3K8DA 5IDSA 1ZJ3A 4XWIA 3OGZA 4FRBA 4UEGA 4ZDQA 1ZCTA 1GWVA 4FCUA 3SX7A 1MP4A 4KC4A 3V0LA 4CJBA 4EEMA 1WT3A 2WEEA 4IRPA 4B2WA 1H7TA 1G0RA 2JCLA 3I0EA 2OI5A 3IOJA 5FV9A 1GX4A 1H7QA 1ZDFA 3POLA 2OEFA 2MZBA 2V0LA 3OKRA 5CMIA 4Y6NA 3OH2A 1LL2A 3I0KA 4B42A 4P00A 4J18A 2D7IA 1H5SC 2RJ0A 4KNXA 1VGUA 3OH0A 4Y7UA 3T7NA 1YP2A 1G9RA 2VXLA 4JD0A 1LZ7A 1HV9A 1FRWA 1ZJOA 2QGIA 1YP3A 1OMXA 1GQ9A 5C38A 4AYLA 1IINA 1V83A 3HL3A 5IDTA 1LVWA 3JUJA 4FQWA 4ASYA 3RMWA 5CMHA 4ARWA 2P73A 4HO9A 2AESA 5C36A 1O0RA 1JVGA 4HO5A 4B3UA 2RJ1A 4NANA 2JCOA 5CQMX 1QGSA 5C1LA 2PGVA 5C49A 3V8YA 1FR8A 5C4FA 1G3LA 5C4BA 1JYKA 4Y63A 4FROA 1XZ6A 5C47A 5CQNX 2PGYA 2VFZA 1H5SB 1ZHJA 2Y4JA 2FYAA 1R7TA 4JISA 3SXBA 2RITA 1ZJPA 1VZTA 1YROB 4Y64A 3BRKX 1R7VA 1H3MA 1FO9A 4KRVA 3U0YA 4HG6A 3IOIA 3ZGGA 2JCJA 2QKXA 1G95A 1HJLA 3PKPA 2Y7AA 4EE3A 1ON8A 4FRLA 4HO2A 4Y62A 5CQOA 2X65A 1FR9A 1H5TB 1R81A 4M2AA 2YQJA 2X5ZA 3R2WA 1H7EA 5FU0A 3SX8A 4G87A 5C48A 1R7YA 2Z86A 5CQLX 1VZXA
chains in the Genus database with same CATH superfamily
1O23B 4M28A 1G1LA 3I0HA 1ZCVA 2NXVA 1VM8A 2VK9A 2E8BA 3I0CA 3I0LA 2AH9A 1FZWA 1FOAA 1H4CA 2Y4KA 1H7HA 1I52A 2ZU8A 3I0GA 2V0KA 3OH1A 4EEOA 1R7UA 1WT2A 3SXAA 1HM0A 3I0IX 3O3PA 4Y7TA 1QWJA 4NAKA 3V0OA 4AYJA 4FRMA 2XWNA 3SXEA 4B4BA 2V0HA 4KT7A 4FREA 1QGQA 2P6WA 4M4KA 2RJ6A 2FFVA 2FYDB 2VS3A 5CMFX 5D92A 3BCVA 1G93A 4D0TA 4LW3A 1H5RB 1LL0A 2D7RA 2OI7A 2YQHA 1G8OA 1LZ0A 1WSZA 1GA8A 4CVHA 4C2SA 2VS4A 1JV3A 1ZIZA 3CGXA 3CKNA 1VGZA 3V8ZA 1W77A 1YP4A 1ZJ1A 2X60A 3F1YA 2V0IA 2E3DA 2VXMA 1OQMB 5EJZA 4EE5A 5FUHA 1MP5A 2RIXA 1XHBA 2OI6A 3D98A 1WT0A 5FYEA 5J49A 2YC5A 3ST8A 4NAIA 1NWGB 4HO8A 3SPTA 1IIMA 3USQA 5JQQA 3PKQA 4FRDA 4HO3A 4M2BA 1G2VA 4B4MA 5AJOA 2FY7A 4EEAA 1K4VA 4GBPA 2APCA 2O1GA 1PZTA 3R3IA 5IFYA 3RMVA 3OC9A 2XWMA 1FXOA 1V84A 4B4GA 5C8RA 2PA4A 2FYCB 3U2VA 1PZYB 3SX3A 2J0BA 1FG5N 3OH4A 4D0ZA 4FIXA 5CMJA 1TVYA 3FOQA 3LW6A 1MP3A 4HO4A 4LW6A 5CQPA 2BO6A 4Y9XA 1S4PA 2DPWA 3U2XA 4K6RA 1MC3A 1GWWA 4HCQA 1VPAA 1H7LA 2YESA 3EE5A 3T7MA 1FXJA 4D11A 2XMEA 4Y7GA 5C3BA 2V0JA 1NHEB 3SXGA 2VSIA 4AC3A 1TW1A 3OH3A 3IOHA 5EIYA 5C1HA 5DDTA 4KC1A 1R82A 1Z90A 2Y4MA 4ASJA 1ZCYA 3ZF8A 2OEGA 1S4NA 2Y6PA 1VGWA 3DK5A 3U2UA 2GGQA 2Q4JA 4E1KA 4FRPA 5I1FA 5CMGX 1H7GA 3V0QA 5C3DA 5C4EA 3N9WA 2PX7A 1W55A 2AM4A 5FTSA 4L41C 1QG8A 2RJ9A 2BO8A 2A8UA 1NKHB 2YQCA 1EYRA 4D48A 4B5BA 2ZU9A 1NQIB 2X5SA 2VD4A 4Y7VA 4G3PA 2YC3A 4ECMA 3CKOA 2BO7A 1G97A 2I5EA 3Q80A 3E26A 1V82A 4KPZA 4BQHA 3CKVA 2CU2A 3Q7UA 1O7QA 4NALA 2WGZA 5L6SA 5C4CA 1H7FA 1TW5A 4EVWA 3I0JA 2ZU7A 1S4OA 4Y7FA 3CKJA 4DE7A 1ZCUA 3V0PA 1OMZA 1WVCA 2WVLA 4G3SA 2AM3A 4FRHA 1INJA 4KNRA 4MIXA 2RIYA 3RSBA 5EJ1A 2D0JA 2WAWA 2XWLA 1HM8A 3D8VA 3SXDA 3V0NA 4DDZA 2QH5A 2VSHA 2W0VA 1H5SA 3U2TA 2GGOA 1ZDGA 2O1HA 4MYBA 4BMAA 2WE9A 2YQSA 3QVBA 4P02A 3I0DA 2JCKA 1H4EA 1WT1A 1R7XA 2FFUA 1JVDA 2AECA 4KXOA 1H4DA 4Q7CA 3USRA 2RJ5A 1JV1A 1HJJA 2RJ7A 3SX5A 4AAWA 4KC2A 4KQLA 4CJ8A 5D91A 1KWSA 5AJPA 2ICXA 1VH3A 1INIA 3ZGFA 3OAMA 4O6NA 1FWYA 2Y4LA 2WVMA 1JYLA 1H5TA 2WVKA 5AJNA 4YS8A 1H5SD 1LZJA 1ON6A 4KPXA 1LZIA 5C4DA 1ZJ2A 1VGTA 4Y6UA 2UX8A 3CU0A 3SXCA 1ZJ0A 4EEGA 3KIAA 1NF5B 2C0NA 4IRQA 2RJ4A 3E25A 3F1CA 3PNNA 3U0XA 1SS9A 3TQDA 2J0AA 2I7BA 5FU8A 3V91A 1ZI4A 2FYBA 2P72A 2BO4A 4FRAA 1VICA 3ZLKA 1ZI3A 3V90A 2AM5A 1O7OA 3I0FA 2RJ8A 1ZI5A 2XMHA 4EE4A 3JUKA 3T7OA 3DUVA 2RIZA 4CJCA 4D11C 4R7PA 1GX0A 5C3AA 1GQCA 3JTJA 5FTVA 4FIYA 1ZI1A 1HM9A 1TZFA 4MNDA 2I5KA 2W0WA 4B2XA 1NMMB 3TZTA 1FGGA 1R80A 1EZIA 3GUEA 3K8EA 3V0MA 2A8WA 4DECA 1H5RA 5L6VA 1VH1A 2VS5A 4FRQA 2AGDA 3CKQA 4HO0A 2AE7A 4HO6A 3D5NA 1G23A 1LL3A 2O1FA 4G3QA 3FWWA 4HOCA 5C1GA 2YCMA 2ICYA 5HS2A 4FCEA 3NGWA 3ZLLA 1VZUA 1W57A 3Q4SA 2Z87A 5BXCA 3U2WA 1FGXA 5DDVA 1E5KA 1FO8A 3DJ4A 3K8DA 5IDSA 1ZJ3A 4XWIA 3OGZA 4FRBA 4UEGA 4ZDQA 1ZCTA 1GWVA 4FCUA 3SX7A 1MP4A 4KC4A 3V0LA 4CJBA 4EEMA 1WT3A 2WEEA 4IRPA 4B2WA 1H7TA 1G0RA 2JCLA 3I0EA 2OI5A 3IOJA 5FV9A 1GX4A 1H7QA 1ZDFA 3POLA 2OEFA 2MZBA 2V0LA 3OKRA 5CMIA 4Y6NA 3OH2A 1LL2A 3I0KA 4B42A 4P00A 4J18A 2D7IA 1H5SC 2RJ0A 4KNXA 1VGUA 3OH0A 4Y7UA 3T7NA 1YP2A 1G9RA 2VXLA 4JD0A 1LZ7A 1HV9A 1FRWA 1ZJOA 2QGIA 1YP3A 1OMXA 1GQ9A 5C38A 4AYLA 1IINA 1V83A 3HL3A 5IDTA 1LVWA 3JUJA 4FQWA 4ASYA 3RMWA 5CMHA 4ARWA 2P73A 4HO9A 2AESA 5C36A 1O0RA 1JVGA 4HO5A 4B3UA 2RJ1A 4NANA 2JCOA 5CQMX 1QGSA 5C1LA 4O6MA 2PGVA 5C49A 3V8YA 1FR8A 5C4FA 1G3LA 5C4BA 1JYKA 4Y63A 4FROA 1XZ6A 5C47A 5CQNX 2PGYA 2VFZA 1H5SB 1ZHJA 2Y4JA 2FYAA 1R7TA 4JISA 3SXBA 2RITA 1ZJPA 1VZTA 1YROB 4Y64A 3BRKX 1R7VA 1H3MA 1FO9A 4KRVA 3U0YA 4HG6A 3IOIA 3ZGGA 2JCJA 2QKXA 1G95A 1HJLA 3PKPA 2Y7AA 4EE3A 1ON8A 4FRLA 4HO2A 4Y62A 5CQOA 2X65A 1FR9A 1H5TB 1R81A 4M2AA 2YQJA 2X5ZA 3R2WA 1H7EA 5FU0A 3SX8A 4G87A 5C48A 1R7YA 2Z86A 5CQLX 1VZXA
chains in the Genus database with same CATH topology
1O23B 4M28A 1G1LA 3I0HA 1ZCVA 2NXVA 1VM8A 2VK9A 2E8BA 3I0CA 3I0LA 2AH9A 1FZWA 1FOAA 1H4CA 2Y4KA 1H7HA 1I52A 2ZU8A 3I0GA 2V0KA 3OH1A 4EEOA 1R7UA 1WT2A 3SXAA 1HM0A 3I0IX 3O3PA 4Y7TA 1QWJA 4NAKA 3V0OA 4AYJA 4FRMA 2XWNA 3SXEA 4B4BA 2V0HA 4KT7A 4FREA 1QGQA 2P6WA 4M4KA 2RJ6A 2FFVA 2FYDB 2VS3A 5CMFX 5D92A 3BCVA 1G93A 4D0TA 4LW3A 1H5RB 1LL0A 2D7RA 2OI7A 2YQHA 1G8OA 1LZ0A 1WSZA 1GA8A 4CVHA 4C2SA 2VS4A 1JV3A 1ZIZA 3CGXA 3CKNA 1VGZA 3V8ZA 1W77A 1YP4A 1ZJ1A 2X60A 3F1YA 2V0IA 2E3DA 2VXMA 1OQMB 5EJZA 4EE5A 5FUHA 1MP5A 2RIXA 1XHBA 2OI6A 3D98A 1WT0A 5FYEA 5J49A 2YC5A 3ST8A 4NAIA 1NWGB 4HO8A 3SPTA 1IIMA 3USQA 5JQQA 3PKQA 4FRDA 4HO3A 4M2BA 1G2VA 4B4MA 5AJOA 2FY7A 4EEAA 1K4VA 4GBPA 2APCA 2O1GA 1PZTA 3R3IA 5IFYA 3RMVA 3OC9A 2XWMA 1FXOA 1V84A 4B4GA 5C8RA 2PA4A 2FYCB 3U2VA 1PZYB 3SX3A 2J0BA 1FG5N 3OH4A 4D0ZA 4FIXA 5CMJA 1TVYA 3FOQA 3LW6A 1MP3A 4HO4A 4LW6A 5CQPA 2BO6A 4Y9XA 1S4PA 2DPWA 3U2XA 4K6RA 1MC3A 1GWWA 4HCQA 1VPAA 1H7LA 2YESA 3EE5A 3T7MA 1FXJA 4D11A 2XMEA 4Y7GA 5C3BA 2V0JA 1NHEB 3SXGA 2VSIA 4AC3A 1TW1A 3OH3A 3IOHA 5EIYA 5C1HA 5DDTA 4KC1A 1R82A 1Z90A 2Y4MA 4ASJA 1ZCYA 3ZF8A 2OEGA 1S4NA 2Y6PA 1VGWA 3DK5A 3U2UA 2GGQA 2Q4JA 4E1KA 4FRPA 5I1FA 5CMGX 1H7GA 3V0QA 5C3DA 5C4EA 3N9WA 2PX7A 1W55A 2AM4A 5FTSA 4L41C 1QG8A 2RJ9A 2BO8A 2A8UA 1NKHB 2YQCA 1EYRA 4D48A 4B5BA 2ZU9A 1NQIB 2X5SA 2VD4A 4Y7VA 4G3PA 2YC3A 4ECMA 3CKOA 2BO7A 1G97A 2I5EA 3Q80A 3E26A 1V82A 4KPZA 4BQHA 3CKVA 2CU2A 3Q7UA 1O7QA 4NALA 2WGZA 5L6SA 5C4CA 1H7FA 1TW5A 4EVWA 3I0JA 2ZU7A 1S4OA 4Y7FA 3CKJA 4DE7A 1ZCUA 3V0PA 1OMZA 1WVCA 2WVLA 4G3SA 2AM3A 4FRHA 1INJA 4KNRA 4MIXA 2RIYA 3RSBA 5EJ1A 2D0JA 2WAWA 2XWLA 1HM8A 3D8VA 3SXDA 3V0NA 4DDZA 2QH5A 2VSHA 2W0VA 1H5SA 3U2TA 2GGOA 1ZDGA 2O1HA 4MYBA 4BMAA 2WE9A 2YQSA 3QVBA 4P02A 3I0DA 2JCKA 1H4EA 1WT1A 1R7XA 2FFUA 1JVDA 2AECA 4KXOA 1H4DA 4Q7CA 3USRA 2RJ5A 1JV1A 1HJJA 2RJ7A 3SX5A 4AAWA 4KC2A 4KQLA 4CJ8A 5D91A 1KWSA 5AJPA 2ICXA 1VH3A 1INIA 3ZGFA 3OAMA 4O6NA 1FWYA 2Y4LA 2WVMA 1JYLA 1H5TA 2WVKA 5AJNA 4YS8A 1H5SD 1LZJA 1ON6A 4KPXA 1LZIA 5C4DA 1ZJ2A 1VGTA 4Y6UA 2UX8A 3CU0A 3SXCA 1ZJ0A 4EEGA 3KIAA 1NF5B 2C0NA 4IRQA 2RJ4A 3E25A 3F1CA 3PNNA 3U0XA 1SS9A 3TQDA 2J0AA 2I7BA 5FU8A 3V91A 1ZI4A 2FYBA 2P72A 2BO4A 4FRAA 1VICA 3ZLKA 1ZI3A 3V90A 2AM5A 1O7OA 3I0FA 2RJ8A 1ZI5A 2XMHA 4EE4A 3JUKA 3T7OA 3DUVA 2RIZA 4CJCA 4D11C 4R7PA 1GX0A 5C3AA 1GQCA 3JTJA 5FTVA 4FIYA 1ZI1A 1HM9A 1TZFA 4MNDA 2I5KA 2W0WA 4B2XA 1NMMB 3TZTA 1FGGA 1R80A 1EZIA 3GUEA 3K8EA 3V0MA 2A8WA 4DECA 1H5RA 5L6VA 1VH1A 2VS5A 4FRQA 2AGDA 3CKQA 4HO0A 2AE7A 4HO6A 3D5NA 1G23A 1LL3A 2O1FA 4G3QA 3FWWA 4HOCA 5C1GA 2YCMA 2ICYA 5HS2A 4FCEA 3NGWA 3ZLLA 1VZUA 1W57A 3Q4SA 2Z87A 5BXCA 3U2WA 1FGXA 5DDVA 1E5KA 1FO8A 3DJ4A 3K8DA 5IDSA 1ZJ3A 4XWIA 3OGZA 4FRBA 4UEGA 4ZDQA 1ZCTA 1GWVA 4FCUA 3SX7A 1MP4A 4KC4A 3V0LA 4CJBA 4EEMA 1WT3A 2WEEA 4IRPA 4B2WA 1H7TA 1G0RA 2JCLA 3I0EA 2OI5A 3IOJA 5FV9A 1GX4A 1H7QA 1ZDFA 3POLA 2OEFA 2MZBA 2V0LA 3OKRA 5CMIA 4Y6NA 3OH2A 1LL2A 3I0KA 4B42A 4P00A 4J18A 2D7IA 1H5SC 2RJ0A 4KNXA 1VGUA 3OH0A 4Y7UA 3T7NA 1YP2A 1G9RA 2VXLA 4JD0A 1LZ7A 1HV9A 1FRWA 1ZJOA 2QGIA 1YP3A 1OMXA 1GQ9A 5C38A 4AYLA 1IINA 1V83A 3HL3A 5IDTA 1LVWA 3JUJA 4FQWA 4ASYA 3RMWA 5CMHA 4ARWA 2P73A 4HO9A 2AESA 5C36A 1O0RA 1JVGA 4HO5A 4B3UA 2RJ1A 4NANA 2JCOA 5CQMX 1QGSA 5C1LA 4O6MA 2PGVA 5C49A 3V8YA 1FR8A 5C4FA 1G3LA 5C4BA 1JYKA 4Y63A 4FROA 1XZ6A 5C47A 5CQNX 2PGYA 2VFZA 1H5SB 1ZHJA 2Y4JA 2FYAA 1R7TA 4JISA 3SXBA 2RITA 1ZJPA 1VZTA 1YROB 4Y64A 3BRKX 1R7VA 1H3MA 1FO9A 4KRVA 3U0YA 4HG6A 3IOIA 3ZGGA 2JCJA 2QKXA 1G95A 1HJLA 3PKPA 2Y7AA 4EE3A 1ON8A 4FRLA 4HO2A 4Y62A 5CQOA 2X65A 1FR9A 1H5TB 1R81A 4M2AA 2YQJA 2X5ZA 3R2WA 1H7EA 5FU0A 3SX8A 4G87A 5C48A 1R7YA 2Z86A 5CQLX 1VZXA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1O23 B;  4M28 A;  1G1L A;  3I0H A;  1ZCV A;  2NXV A;  1VM8 A;  2E8B A;  3I0C A;  3I0L A;  2AH9 A;  1FZW A;  1FOA A;  1H4C A;  2Y4K A;  1H7H A;  1I52 A;  2ZU8 A;  3I0G A;  2V0K A;  3OH1 A;  4EEO A;  1R7U A;  1WT2 A;  3SXA A;  1HM0 A;  3I0I X;  3O3P A;  4Y7T A;  1QWJ A;  4NAK A;  3V0O A;  4AYJ A;  4FRM A;  2XWN A;  3SXE A;  4B4B A;  2V0H A;  4KT7 A;  4FRE A;  1QGQ A;  2P6W A;  4M4K A;  2RJ6 A;  2FFV A;  2FYD B;  2VS3 A;  5CMF X;  3BCV A;  1G93 A;  4D0T A;  4LW3 A;  1H5R B;  1LL0 A;  2D7R A;  2OI7 A;  2YQH A;  1G8O A;  1LZ0 A;  1WSZ A;  1GA8 A;  4CVH A;  4C2S A;  2VS4 A;  1JV3 A;  1ZIZ A;  3CGX A;  3CKN A;  1VGZ A;  3V8Z A;  1W77 A;  1YP4 A;  1ZJ1 A;  2X60 A;  3F1Y A;  2V0I A;  2E3D A;  2VXM A;  1OQM B;  5EJZ A;  4EE5 A;  5FUH A;  1MP5 A;  2RIX A;  1XHB A;  2OI6 A;  3D98 A;  1WT0 A;  5FYE A;  5J49 A;  2YC5 A;  3ST8 A;  4NAI A;  1NWG B;  4HO8 A;  3SPT A;  1IIM A;  3USQ A;  5JQQ A;  3PKQ A;  4FRD A;  4HO3 A;  4M2B A;  1G2V A;  4B4M A;  5AJO A;  2FY7 A;  4EEA A;  1K4V A;  4GBP A;  2APC A;  2O1G A;  1PZT A;  3R3I A;  5IFY A;  3RMV A;  3OC9 A;  2XWM A;  1FXO A;  1V84 A;  4B4G A;  5C8R A;  2PA4 A;  2FYC B;  3U2V A;  1PZY B;  3SX3 A;  3OH4 A;  1FG5 N;  4D0Z A;  5CMJ A;  1TVY A;  3FOQ A;  3LW6 A;  1MP3 A;  4HO4 A;  4LW6 A;  5CQP A;  2BO6 A;  4Y9X A;  1S4P A;  2DPW A;  3U2X A;  4K6R A;  1MC3 A;  1GWW A;  4HCQ A;  1VPA A;  1H7L A;  2YES A;  3EE5 A;  3T7M A;  1FXJ A;  4D11 A;  2XME A;  4Y7G A;  5C3B A;  2V0J A;  1NHE B;  3SXG A;  2VSI A;  4AC3 A;  1TW1 A;  3OH3 A;  3IOH A;  5EIY A;  5C1H A;  5DDT A;  4KC1 A;  1R82 A;  1Z90 A;  2Y4M A;  4ASJ A;  1ZCY A;  3ZF8 A;  2OEG A;  1S4N A;  2Y6P A;  1VGW A;  3DK5 A;  3U2U A;  2GGQ A;  2Q4J A;  4E1K A;  4FRP A;  5I1F A;  5CMG X;  1H7G A;  3V0Q A;  5C3D A;  5C4E A;  3N9W A;  2PX7 A;  1W55 A;  2AM4 A;  5FTS A;  4L41 C;  1QG8 A;  2RJ9 A;  2BO8 A;  2A8U A;  1NKH B;  2YQC A;  1EYR A;  4D48 A;  4B5B A;  2ZU9 A;  1NQI B;  2X5S A;  2VD4 A;  4Y7V A;  4G3P A;  2YC3 A;  4ECM A;  3CKO A;  2BO7 A;  1G97 A;  2I5E A;  3Q80 A;  3E26 A;  1V82 A;  4KPZ A;  4BQH A;  3CKV A;  2CU2 A;  3Q7U A;  1O7Q A;  4NAL A;  2WGZ A;  5L6S A;  5C4C A;  1H7F A;  1TW5 A;  4EVW A;  3I0J A;  2ZU7 A;  1S4O A;  4Y7F A;  3CKJ A;  4DE7 A;  1ZCU A;  3V0P A;  1OMZ A;  1WVC A;  2WVL A;  4G3S A;  2AM3 A;  4FRH A;  1INJ A;  4KNR A;  2RIY A;  3RSB A;  5EJ1 A;  2D0J A;  2WAW A;  2XWL A;  1HM8 A;  3D8V A;  3SXD A;  3V0N A;  4DDZ A;  2QH5 A;  2VSH A;  2W0V A;  1H5S A;  3U2T A;  2GGO A;  1ZDG A;  2O1H A;  4MYB A;  4BMA A;  2WE9 A;  2YQS A;  3QVB A;  4P02 A;  3I0D A;  2JCK A;  1H4E A;  1WT1 A;  1R7X A;  2FFU A;  1JVD A;  2AEC A;  4KXO A;  1H4D A;  3USR A;  2RJ5 A;  1JV1 A;  1HJJ A;  2RJ7 A;  3SX5 A;  4AAW A;  4KC2 A;  4KQL A;  4CJ8 A;  1KWS A;  5AJP A;  2ICX A;  1VH3 A;  1INI A;  3ZGF A;  3OAM A;  1FWY A;  2Y4L A;  2WVM A;  1JYL A;  1H5T A;  2WVK A;  5AJN A;  4YS8 A;  1H5S D;  1LZJ A;  1ON6 A;  4KPX A;  1LZI A;  5C4D A;  1ZJ2 A;  1VGT A;  4Y6U A;  2UX8 A;  3CU0 A;  3SXC A;  1ZJ0 A;  4EEG A;  3KIA A;  1NF5 B;  4IRQ A;  2RJ4 A;  3E25 A;  3F1C A;  3PNN A;  3U0X A;  1SS9 A;  3TQD A;  2I7B A;  5FU8 A;  3V91 A;  1ZI4 A;  2FYB A;  2P72 A;  2BO4 A;  4FRA A;  1VIC A;  3ZLK A;  1ZI3 A;  3V90 A;  2AM5 A;  1O7O A;  3I0F A;  2RJ8 A;  1ZI5 A;  2XMH A;  4EE4 A;  3JUK A;  3T7O A;  3DUV A;  2RIZ A;  4CJC A;  4D11 C;  4R7P A;  1GX0 A;  5C3A A;  1GQC A;  3JTJ A;  5FTV A;  1ZI1 A;  1HM9 A;  1TZF A;  4MND A;  2I5K A;  2W0W A;  4B2X A;  1NMM B;  3TZT A;  1FGG A;  1R80 A;  1EZI A;  3GUE A;  3K8E A;  3V0M A;  2A8W A;  4DEC A;  1H5R A;  5L6V A;  1VH1 A;  2VS5 A;  4FRQ A;  2AGD A;  3CKQ A;  4HO0 A;  2AE7 A;  4HO6 A;  3D5N A;  1G23 A;  1LL3 A;  2O1F A;  4G3Q A;  3FWW A;  4HOC A;  5C1G A;  2YCM A;  2ICY A;  5HS2 A;  4FCE A;  3NGW A;  3ZLL A;  1VZU A;  1W57 A;  3Q4S A;  2Z87 A;  5BXC A;  3U2W A;  1FGX A;  5DDV A;  1E5K A;  1FO8 A;  3DJ4 A;  3K8D A;  5IDS A;  1ZJ3 A;  4XWI A;  3OGZ A;  4FRB A;  4UEG A;  4ZDQ A;  1ZCT A;  1GWV A;  4FCU A;  3SX7 A;  1MP4 A;  4KC4 A;  3V0L A;  4CJB A;  4EEM A;  1WT3 A;  2WEE A;  4IRP A;  4B2W A;  1H7T A;  1G0R A;  2JCL A;  3I0E A;  2OI5 A;  3IOJ A;  5FV9 A;  1GX4 A;  1H7Q A;  1ZDF A;  3POL A;  2OEF A;  2MZB A;  2V0L A;  3OKR A;  5CMI A;  4Y6N A;  3OH2 A;  1LL2 A;  3I0K A;  4B42 A;  4P00 A;  4J18 A;  2D7I A;  1H5S C;  2RJ0 A;  4KNX A;  1VGU A;  3OH0 A;  4Y7U A;  3T7N A;  1YP2 A;  1G9R A;  2VXL A;  4JD0 A;  1LZ7 A;  1HV9 A;  1FRW A;  1ZJO A;  2QGI A;  1YP3 A;  1OMX A;  1GQ9 A;  5C38 A;  4AYL A;  1IIN A;  1V83 A;  3HL3 A;  5IDT A;  1LVW A;  3JUJ A;  4FQW A;  4ASY A;  3RMW A;  5CMH A;  4ARW A;  2P73 A;  4HO9 A;  2AES A;  5C36 A;  1O0R A;  1JVG A;  4HO5 A;  4B3U A;  2RJ1 A;  4NAN A;  2JCO A;  5CQM X;  1QGS A;  5C1L A;  2PGV A;  5C49 A;  3V8Y A;  1FR8 A;  5C4F A;  1G3L A;  5C4B A;  1JYK A;  4Y63 A;  4FRO A;  1XZ6 A;  5C47 A;  5CQN X;  2PGY A;  2VFZ A;  1H5S B;  1ZHJ A;  2Y4J A;  2FYA A;  1R7T A;  4JIS A;  3SXB A;  2RIT A;  1ZJP A;  1VZT A;  1YRO B;  4Y64 A;  3BRK X;  1R7V A;  1H3M A;  1FO9 A;  4KRV A;  3U0Y A;  4HG6 A;  3IOI A;  3ZGG A;  2JCJ A;  2QKX A;  1G95 A;  1HJL A;  3PKP A;  2Y7A A;  4EE3 A;  1ON8 A;  4FRL A;  4HO2 A;  4Y62 A;  5CQO A;  2X65 A;  1FR9 A;  1H5T B;  1R81 A;  4M2A A;  2YQJ A;  2X5Z A;  3R2W A;  1H7E A;  5FU0 A;  3SX8 A;  4G87 A;  5C48 A;  1R7Y A;  2Z86 A;  5CQL X;  1VZX A; 
#chains in the Genus database with same CATH topology
 1O23 B;  4M28 A;  1G1L A;  3I0H A;  1ZCV A;  2NXV A;  1VM8 A;  2VK9 A;  2E8B A;  3I0C A;  3I0L A;  2AH9 A;  1FZW A;  1FOA A;  1H4C A;  2Y4K A;  1H7H A;  1I52 A;  2ZU8 A;  3I0G A;  2V0K A;  3OH1 A;  4EEO A;  1R7U A;  1WT2 A;  3SXA A;  1HM0 A;  3I0I X;  3O3P A;  4Y7T A;  1QWJ A;  4NAK A;  3V0O A;  4AYJ A;  4FRM A;  2XWN A;  3SXE A;  4B4B A;  2V0H A;  4KT7 A;  4FRE A;  1QGQ A;  2P6W A;  4M4K A;  2RJ6 A;  2FFV A;  2FYD B;  2VS3 A;  5CMF X;  5D92 A;  3BCV A;  1G93 A;  4D0T A;  4LW3 A;  1H5R B;  1LL0 A;  2D7R A;  2OI7 A;  2YQH A;  1G8O A;  1LZ0 A;  1WSZ A;  1GA8 A;  4CVH A;  4C2S A;  2VS4 A;  1JV3 A;  1ZIZ A;  3CGX A;  3CKN A;  1VGZ A;  3V8Z A;  1W77 A;  1YP4 A;  1ZJ1 A;  2X60 A;  3F1Y A;  2V0I A;  2E3D A;  2VXM A;  1OQM B;  5EJZ A;  4EE5 A;  5FUH A;  1MP5 A;  2RIX A;  1XHB A;  2OI6 A;  3D98 A;  1WT0 A;  5FYE A;  5J49 A;  2YC5 A;  3ST8 A;  4NAI A;  1NWG B;  4HO8 A;  3SPT A;  1IIM A;  3USQ A;  5JQQ A;  3PKQ A;  4FRD A;  4HO3 A;  4M2B A;  1G2V A;  4B4M A;  5AJO A;  2FY7 A;  4EEA A;  1K4V A;  4GBP A;  2APC A;  2O1G A;  1PZT A;  3R3I A;  5IFY A;  3RMV A;  3OC9 A;  2XWM A;  1FXO A;  1V84 A;  4B4G A;  5C8R A;  2PA4 A;  2FYC B;  3U2V A;  1PZY B;  3SX3 A;  2J0B A;  1FG5 N;  3OH4 A;  4D0Z A;  4FIX A;  5CMJ A;  1TVY A;  3FOQ A;  3LW6 A;  1MP3 A;  4HO4 A;  4LW6 A;  5CQP A;  2BO6 A;  4Y9X A;  1S4P A;  2DPW A;  3U2X A;  4K6R A;  1MC3 A;  1GWW A;  4HCQ A;  1VPA A;  1H7L A;  2YES A;  3EE5 A;  3T7M A;  1FXJ A;  4D11 A;  2XME A;  4Y7G A;  5C3B A;  2V0J A;  1NHE B;  3SXG A;  2VSI A;  4AC3 A;  1TW1 A;  3OH3 A;  3IOH A;  5EIY A;  5C1H A;  5DDT A;  4KC1 A;  1R82 A;  1Z90 A;  2Y4M A;  4ASJ A;  1ZCY A;  3ZF8 A;  2OEG A;  1S4N A;  2Y6P A;  1VGW A;  3DK5 A;  3U2U A;  2GGQ A;  2Q4J A;  4E1K A;  4FRP A;  5I1F A;  5CMG X;  1H7G A;  3V0Q A;  5C3D A;  5C4E A;  3N9W A;  2PX7 A;  1W55 A;  2AM4 A;  5FTS A;  4L41 C;  1QG8 A;  2RJ9 A;  2BO8 A;  2A8U A;  1NKH B;  2YQC A;  1EYR A;  4D48 A;  4B5B A;  2ZU9 A;  1NQI B;  2X5S A;  2VD4 A;  4Y7V A;  4G3P A;  2YC3 A;  4ECM A;  3CKO A;  2BO7 A;  1G97 A;  2I5E A;  3Q80 A;  3E26 A;  1V82 A;  4KPZ A;  4BQH A;  3CKV A;  2CU2 A;  3Q7U A;  1O7Q A;  4NAL A;  2WGZ A;  5L6S A;  5C4C A;  1H7F A;  1TW5 A;  4EVW A;  3I0J A;  2ZU7 A;  1S4O A;  4Y7F A;  3CKJ A;  4DE7 A;  1ZCU A;  3V0P A;  1OMZ A;  1WVC A;  2WVL A;  4G3S A;  2AM3 A;  4FRH A;  1INJ A;  4KNR A;  4MIX A;  2RIY A;  3RSB A;  5EJ1 A;  2D0J A;  2WAW A;  2XWL A;  1HM8 A;  3D8V A;  3SXD A;  3V0N A;  4DDZ A;  2QH5 A;  2VSH A;  2W0V A;  1H5S A;  3U2T A;  2GGO A;  1ZDG A;  2O1H A;  4MYB A;  4BMA A;  2WE9 A;  2YQS A;  3QVB A;  4P02 A;  3I0D A;  2JCK A;  1H4E A;  1WT1 A;  1R7X A;  2FFU A;  1JVD A;  2AEC A;  4KXO A;  1H4D A;  4Q7C A;  3USR A;  2RJ5 A;  1JV1 A;  1HJJ A;  2RJ7 A;  3SX5 A;  4AAW A;  4KC2 A;  4KQL A;  4CJ8 A;  5D91 A;  1KWS A;  5AJP A;  2ICX A;  1VH3 A;  1INI A;  3ZGF A;  3OAM A;  4O6N A;  1FWY A;  2Y4L A;  2WVM A;  1JYL A;  1H5T A;  2WVK A;  5AJN A;  4YS8 A;  1H5S D;  1LZJ A;  1ON6 A;  4KPX A;  1LZI A;  5C4D A;  1ZJ2 A;  1VGT A;  4Y6U A;  2UX8 A;  3CU0 A;  3SXC A;  1ZJ0 A;  4EEG A;  3KIA A;  1NF5 B;  2C0N A;  4IRQ A;  2RJ4 A;  3E25 A;  3F1C A;  3PNN A;  3U0X A;  1SS9 A;  3TQD A;  2J0A A;  2I7B A;  5FU8 A;  3V91 A;  1ZI4 A;  2FYB A;  2P72 A;  2BO4 A;  4FRA A;  1VIC A;  3ZLK A;  1ZI3 A;  3V90 A;  2AM5 A;  1O7O A;  3I0F A;  2RJ8 A;  1ZI5 A;  2XMH A;  4EE4 A;  3JUK A;  3T7O A;  3DUV A;  2RIZ A;  4CJC A;  4D11 C;  4R7P A;  1GX0 A;  5C3A A;  1GQC A;  3JTJ A;  5FTV A;  4FIY A;  1ZI1 A;  1HM9 A;  1TZF A;  4MND A;  2I5K A;  2W0W A;  4B2X A;  1NMM B;  3TZT A;  1FGG A;  1R80 A;  1EZI A;  3GUE A;  3K8E A;  3V0M A;  2A8W A;  4DEC A;  1H5R A;  5L6V A;  1VH1 A;  2VS5 A;  4FRQ A;  2AGD A;  3CKQ A;  4HO0 A;  2AE7 A;  4HO6 A;  3D5N A;  1G23 A;  1LL3 A;  2O1F A;  4G3Q A;  3FWW A;  4HOC A;  5C1G A;  2YCM A;  2ICY A;  5HS2 A;  4FCE A;  3NGW A;  3ZLL A;  1VZU A;  1W57 A;  3Q4S A;  2Z87 A;  5BXC A;  3U2W A;  1FGX A;  5DDV A;  1E5K A;  1FO8 A;  3DJ4 A;  3K8D A;  5IDS A;  1ZJ3 A;  4XWI A;  3OGZ A;  4FRB A;  4UEG A;  4ZDQ A;  1ZCT A;  1GWV A;  4FCU A;  3SX7 A;  1MP4 A;  4KC4 A;  3V0L A;  4CJB A;  4EEM A;  1WT3 A;  2WEE A;  4IRP A;  4B2W A;  1H7T A;  1G0R A;  2JCL A;  3I0E A;  2OI5 A;  3IOJ A;  5FV9 A;  1GX4 A;  1H7Q A;  1ZDF A;  3POL A;  2OEF A;  2MZB A;  2V0L A;  3OKR A;  5CMI A;  4Y6N A;  3OH2 A;  1LL2 A;  3I0K A;  4B42 A;  4P00 A;  4J18 A;  2D7I A;  1H5S C;  2RJ0 A;  4KNX A;  1VGU A;  3OH0 A;  4Y7U A;  3T7N A;  1YP2 A;  1G9R A;  2VXL A;  4JD0 A;  1LZ7 A;  1HV9 A;  1FRW A;  1ZJO A;  2QGI A;  1YP3 A;  1OMX A;  1GQ9 A;  5C38 A;  4AYL A;  1IIN A;  1V83 A;  3HL3 A;  5IDT A;  1LVW A;  3JUJ A;  4FQW A;  4ASY A;  3RMW A;  5CMH A;  4ARW A;  2P73 A;  4HO9 A;  2AES A;  5C36 A;  1O0R A;  1JVG A;  4HO5 A;  4B3U A;  2RJ1 A;  4NAN A;  2JCO A;  5CQM X;  1QGS A;  5C1L A;  4O6M A;  2PGV A;  5C49 A;  3V8Y A;  1FR8 A;  5C4F A;  1G3L A;  5C4B A;  1JYK A;  4Y63 A;  4FRO A;  1XZ6 A;  5C47 A;  5CQN X;  2PGY A;  2VFZ A;  1H5S B;  1ZHJ A;  2Y4J A;  2FYA A;  1R7T A;  4JIS A;  3SXB A;  2RIT A;  1ZJP A;  1VZT A;  1YRO B;  4Y64 A;  3BRK X;  1R7V A;  1H3M A;  1FO9 A;  4KRV A;  3U0Y A;  4HG6 A;  3IOI A;  3ZGG A;  2JCJ A;  2QKX A;  1G95 A;  1HJL A;  3PKP A;  2Y7A A;  4EE3 A;  1ON8 A;  4FRL A;  4HO2 A;  4Y62 A;  5CQO A;  2X65 A;  1FR9 A;  1H5T B;  1R81 A;  4M2A A;  2YQJ A;  2X5Z A;  3R2W A;  1H7E A;  5FU0 A;  3SX8 A;  4G87 A;  5C48 A;  1R7Y A;  2Z86 A;  5CQL X;  1VZX A; 
#chains in the Genus database with same CATH homology
 1O23 B;  4M28 A;  1G1L A;  3I0H A;  1ZCV A;  2NXV A;  1VM8 A;  2VK9 A;  2E8B A;  3I0C A;  3I0L A;  2AH9 A;  1FZW A;  1FOA A;  1H4C A;  2Y4K A;  1H7H A;  1I52 A;  2ZU8 A;  3I0G A;  2V0K A;  3OH1 A;  4EEO A;  1R7U A;  1WT2 A;  3SXA A;  1HM0 A;  3I0I X;  3O3P A;  4Y7T A;  1QWJ A;  4NAK A;  3V0O A;  4AYJ A;  4FRM A;  2XWN A;  3SXE A;  4B4B A;  2V0H A;  4KT7 A;  4FRE A;  1QGQ A;  2P6W A;  4M4K A;  2RJ6 A;  2FFV A;  2FYD B;  2VS3 A;  5CMF X;  5D92 A;  3BCV A;  1G93 A;  4D0T A;  4LW3 A;  1H5R B;  1LL0 A;  2D7R A;  2OI7 A;  2YQH A;  1G8O A;  1LZ0 A;  1WSZ A;  1GA8 A;  4CVH A;  4C2S A;  2VS4 A;  1JV3 A;  1ZIZ A;  3CGX A;  3CKN A;  1VGZ A;  3V8Z A;  1W77 A;  1YP4 A;  1ZJ1 A;  2X60 A;  3F1Y A;  2V0I A;  2E3D A;  2VXM A;  1OQM B;  5EJZ A;  4EE5 A;  5FUH A;  1MP5 A;  2RIX A;  1XHB A;  2OI6 A;  3D98 A;  1WT0 A;  5FYE A;  5J49 A;  2YC5 A;  3ST8 A;  4NAI A;  1NWG B;  4HO8 A;  3SPT A;  1IIM A;  3USQ A;  5JQQ A;  3PKQ A;  4FRD A;  4HO3 A;  4M2B A;  1G2V A;  4B4M A;  5AJO A;  2FY7 A;  4EEA A;  1K4V A;  4GBP A;  2APC A;  2O1G A;  1PZT A;  3R3I A;  5IFY A;  3RMV A;  3OC9 A;  2XWM A;  1FXO A;  1V84 A;  4B4G A;  5C8R A;  2PA4 A;  2FYC B;  3U2V A;  1PZY B;  3SX3 A;  2J0B A;  1FG5 N;  3OH4 A;  4D0Z A;  4FIX A;  5CMJ A;  1TVY A;  3FOQ A;  3LW6 A;  1MP3 A;  4HO4 A;  4LW6 A;  5CQP A;  2BO6 A;  4Y9X A;  1S4P A;  2DPW A;  3U2X A;  4K6R A;  1MC3 A;  1GWW A;  4HCQ A;  1VPA A;  1H7L A;  2YES A;  3EE5 A;  3T7M A;  1FXJ A;  4D11 A;  2XME A;  4Y7G A;  5C3B A;  2V0J A;  1NHE B;  3SXG A;  2VSI A;  4AC3 A;  1TW1 A;  3OH3 A;  3IOH A;  5EIY A;  5C1H A;  5DDT A;  4KC1 A;  1R82 A;  1Z90 A;  2Y4M A;  4ASJ A;  1ZCY A;  3ZF8 A;  2OEG A;  1S4N A;  2Y6P A;  1VGW A;  3DK5 A;  3U2U A;  2GGQ A;  2Q4J A;  4E1K A;  4FRP A;  5I1F A;  5CMG X;  1H7G A;  3V0Q A;  5C3D A;  5C4E A;  3N9W A;  2PX7 A;  1W55 A;  2AM4 A;  5FTS A;  4L41 C;  1QG8 A;  2RJ9 A;  2BO8 A;  2A8U A;  1NKH B;  2YQC A;  1EYR A;  4D48 A;  4B5B A;  2ZU9 A;  1NQI B;  2X5S A;  2VD4 A;  4Y7V A;  4G3P A;  2YC3 A;  4ECM A;  3CKO A;  2BO7 A;  1G97 A;  2I5E A;  3Q80 A;  3E26 A;  1V82 A;  4KPZ A;  4BQH A;  3CKV A;  2CU2 A;  3Q7U A;  1O7Q A;  4NAL A;  2WGZ A;  5L6S A;  5C4C A;  1H7F A;  1TW5 A;  4EVW A;  3I0J A;  2ZU7 A;  1S4O A;  4Y7F A;  3CKJ A;  4DE7 A;  1ZCU A;  3V0P A;  1OMZ A;  1WVC A;  2WVL A;  4G3S A;  2AM3 A;  4FRH A;  1INJ A;  4KNR A;  4MIX A;  2RIY A;  3RSB A;  5EJ1 A;  2D0J A;  2WAW A;  2XWL A;  1HM8 A;  3D8V A;  3SXD A;  3V0N A;  4DDZ A;  2QH5 A;  2VSH A;  2W0V A;  1H5S A;  3U2T A;  2GGO A;  1ZDG A;  2O1H A;  4MYB A;  4BMA A;  2WE9 A;  2YQS A;  3QVB A;  4P02 A;  3I0D A;  2JCK A;  1H4E A;  1WT1 A;  1R7X A;  2FFU A;  1JVD A;  2AEC A;  4KXO A;  1H4D A;  4Q7C A;  3USR A;  2RJ5 A;  1JV1 A;  1HJJ A;  2RJ7 A;  3SX5 A;  4AAW A;  4KC2 A;  4KQL A;  4CJ8 A;  5D91 A;  1KWS A;  5AJP A;  2ICX A;  1VH3 A;  1INI A;  3ZGF A;  3OAM A;  4O6N A;  1FWY A;  2Y4L A;  2WVM A;  1JYL A;  1H5T A;  2WVK A;  5AJN A;  4YS8 A;  1H5S D;  1LZJ A;  1ON6 A;  4KPX A;  1LZI A;  5C4D A;  1ZJ2 A;  1VGT A;  4Y6U A;  2UX8 A;  3CU0 A;  3SXC A;  1ZJ0 A;  4EEG A;  3KIA A;  1NF5 B;  2C0N A;  4IRQ A;  2RJ4 A;  3E25 A;  3F1C A;  3PNN A;  3U0X A;  1SS9 A;  3TQD A;  2J0A A;  2I7B A;  5FU8 A;  3V91 A;  1ZI4 A;  2FYB A;  2P72 A;  2BO4 A;  4FRA A;  1VIC A;  3ZLK A;  1ZI3 A;  3V90 A;  2AM5 A;  1O7O A;  3I0F A;  2RJ8 A;  1ZI5 A;  2XMH A;  4EE4 A;  3JUK A;  3T7O A;  3DUV A;  2RIZ A;  4CJC A;  4D11 C;  4R7P A;  1GX0 A;  5C3A A;  1GQC A;  3JTJ A;  5FTV A;  4FIY A;  1ZI1 A;  1HM9 A;  1TZF A;  4MND A;  2I5K A;  2W0W A;  4B2X A;  1NMM B;  3TZT A;  1FGG A;  1R80 A;  1EZI A;  3GUE A;  3K8E A;  3V0M A;  2A8W A;  4DEC A;  1H5R A;  5L6V A;  1VH1 A;  2VS5 A;  4FRQ A;  2AGD A;  3CKQ A;  4HO0 A;  2AE7 A;  4HO6 A;  3D5N A;  1G23 A;  1LL3 A;  2O1F A;  4G3Q A;  3FWW A;  4HOC A;  5C1G A;  2YCM A;  2ICY A;  5HS2 A;  4FCE A;  3NGW A;  3ZLL A;  1VZU A;  1W57 A;  3Q4S A;  2Z87 A;  5BXC A;  3U2W A;  1FGX A;  5DDV A;  1E5K A;  1FO8 A;  3DJ4 A;  3K8D A;  5IDS A;  1ZJ3 A;  4XWI A;  3OGZ A;  4FRB A;  4UEG A;  4ZDQ A;  1ZCT A;  1GWV A;  4FCU A;  3SX7 A;  1MP4 A;  4KC4 A;  3V0L A;  4CJB A;  4EEM A;  1WT3 A;  2WEE A;  4IRP A;  4B2W A;  1H7T A;  1G0R A;  2JCL A;  3I0E A;  2OI5 A;  3IOJ A;  5FV9 A;  1GX4 A;  1H7Q A;  1ZDF A;  3POL A;  2OEF A;  2MZB A;  2V0L A;  3OKR A;  5CMI A;  4Y6N A;  3OH2 A;  1LL2 A;  3I0K A;  4B42 A;  4P00 A;  4J18 A;  2D7I A;  1H5S C;  2RJ0 A;  4KNX A;  1VGU A;  3OH0 A;  4Y7U A;  3T7N A;  1YP2 A;  1G9R A;  2VXL A;  4JD0 A;  1LZ7 A;  1HV9 A;  1FRW A;  1ZJO A;  2QGI A;  1YP3 A;  1OMX A;  1GQ9 A;  5C38 A;  4AYL A;  1IIN A;  1V83 A;  3HL3 A;  5IDT A;  1LVW A;  3JUJ A;  4FQW A;  4ASY A;  3RMW A;  5CMH A;  4ARW A;  2P73 A;  4HO9 A;  2AES A;  5C36 A;  1O0R A;  1JVG A;  4HO5 A;  4B3U A;  2RJ1 A;  4NAN A;  2JCO A;  5CQM X;  1QGS A;  5C1L A;  4O6M A;  2PGV A;  5C49 A;  3V8Y A;  1FR8 A;  5C4F A;  1G3L A;  5C4B A;  1JYK A;  4Y63 A;  4FRO A;  1XZ6 A;  5C47 A;  5CQN X;  2PGY A;  2VFZ A;  1H5S B;  1ZHJ A;  2Y4J A;  2FYA A;  1R7T A;  4JIS A;  3SXB A;  2RIT A;  1ZJP A;  1VZT A;  1YRO B;  4Y64 A;  3BRK X;  1R7V A;  1H3M A;  1FO9 A;  4KRV A;  3U0Y A;  4HG6 A;  3IOI A;  3ZGG A;  2JCJ A;  2QKX A;  1G95 A;  1HJL A;  3PKP A;  2Y7A A;  4EE3 A;  1ON8 A;  4FRL A;  4HO2 A;  4Y62 A;  5CQO A;  2X65 A;  1FR9 A;  1H5T B;  1R81 A;  4M2A A;  2YQJ A;  2X5Z A;  3R2W A;  1H7E A;  5FU0 A;  3SX8 A;  4G87 A;  5C48 A;  1R7Y A;  2Z86 A;  5CQL X;  1VZX A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...