3IOJA

Crystal structure of the fucosylgalactoside alpha n-acetylgalactosaminyltransferase (gta, cisab mutant l266g, g268a) in complex with udp
Total Genus 94
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
94
sequence length
284
structure length
284
Chain Sequence
MVSLPRMVYPQPKVLTPCRKDVLVVTPWLAPIVWEGTFNIDILNEQFRLQNTTIGLTVFAIKKYVAFLKLFLETAEKHFMVGHRVHYYVFTDQPAAVPRVTLGTGRQLSVLEVRAYKRWQDVSMRRMEMISDFCERRFLSEVDYLVCVDVDMEFRDHVGVEILTPLFGTLHPGFYGSSREAFTYERRPQSQAYIPKDEGDFYYGGAFFGGSVQEVQRLTRACHQAMMVDQANGIEAVWHDESHLNKYLLRHKPTKVLSPEYLWDQQLLGWPAVLRKLRFTAVPK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Histo-blood group ABO system transferase
publication title Structural and mechanistic basis for a new mode of glycosyltransferase inhibition.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 94
structure length 284
sequence length 284
chains with identical sequence B
ec nomenclature ec 2.4.1.37: Fucosylgalactoside 3-alpha-galactosyltransferase.
pdb deposition date 2009-08-14
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.550.10 Alpha Beta Alpha-Beta Complex Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A 3iojA00
1H7FA 2XWMA 1TZFA 1LL3A 1ZCYA 5CQNX 5C4DA 2BO7A 5IFYA 2Y6PA 2D0JA 2WE9A 4KC4A 3SXGA 3CGXA 5C36A 1WT0A 5L6VA 2O1FA 2ZU9A 4Y7TA 4FRLA 3T7OA 3V0LA 1MP4A 3I0KA 3I0HA 5IDTA 3IOIA 3BRKX 1NHEB 2I5EA 3U2VA 4DECA 2FFUA 2A8WA 2Y4JA 4FRBA 2YQHA 4FRHA 5C1LA 4CVHA 1ZDGA 1WSZA 4NAKA 2MZBA 1JV1A 4KNXA 4FRPA 1I52A 4HG6A 1ZCTA 3OH4A 3IOJA 3USRA 4Y7GA 2VSIA 2RJ9A 4FQWA 1HM8A 1VM8A 1QGSA 1S4NA 3KIAA 4HO5A 2RJ1A 1GQCA 2Y4KA 4ASJA 1HV9A 2RJ7A 2APCA 4EEAA 1H5RA 2OI5A 5CMHA 3PKPA 1V83A 3USQA 3OH2A 3Q80A 3V8YA 4IRPA 3GUEA 4HO3A 3RSBA 4KPZA 3POLA 1IINA 4Y64A 4HO0A 1G9RA 1YP4A 3U2TA 5I1FA 4Y7FA 1OMXA 2E3DA 2YCMA 1GWWA 1ZJPA 5CMGX 2OI7A 4KC1A 1WVCA 3K8DA 2YQJA 4ARWA 2NXVA 4BMAA 2RJ4A 1ON8A 1ZJ0A 4JISA 5HS2A 4HO9A 4G3SA 3CKNA 4M4KA 2P6WA 4HO2A 1LZJA 1EYRA 4EE3A 4M2AA 1H7EA 5C4BA 5C8RA 4M2BA 2JCOA 1WT3A 1VH3A 3U2XA 5C1HA 5J49A 2VS5A 4YS8A 4CJBA 3OC9A 4HO6A 3DUVA 2FY7A 1JYLA 2WVKA 1LVWA 1R7TA 1W57A 3U2UA 3IOHA 3I0IX 2FYDB 3RMVA 2BO4A 5JQQA 1WT2A 2RJ6A 1MP5A 4P00A 4FRMA 1LZ7A 5CQLX 4B42A 4MYBA 2V0KA 2ZU8A 2VS4A 1LL2A 5BXCA 5FV9A 1VZUA 3Q4SA 4FCUA 1H5RB 4AYJA 3I0CA 2GGOA 4R7PA 3V0PA 2PA4A 3V8ZA 2JCJA 5CQOA 4NALA 1V82A 1MC3A 4G3QA 5FUHA 2VXLA 1Z90A 3I0DA 3ZLKA 1FR8A 2FYBA 1H7TA 2V0HA 1FZWA 3TQDA 3LW6A 3V90A 1E5KA 3CKJA 5C1GA 2XMHA 1YP3A 1INIA 2ZU7A 4IRQA 1MP3A 2D7RA 1IIMA 1R81A 1H5SA 4B4MA 1TW5A 1V84A 1VGZA 3PNNA 1JVGA 4Y9XA 4DDZA 5EJ1A 1FWYA 3F1CA 2AE7A 1G8OA 3CU0A 1ZJ3A 1R80A 5FU8A 3F1YA 1H4EA 5C38A 2AH9A 1H7LA 5FU0A 1H5SD 2RIZA 2Y4MA 1ZJ1A 5C4FA 2RJ0A 4L41C 1HJLA 4EE5A 2FFVA 4HO8A 5AJPA 2RIYA 4KXOA 2D7IA 2WGZA 1O23B 1VGWA 1NQIB 4EEOA 2A8UA 3I0JA 5C3DA 4KNRA 4GBPA 3SXAA 3SXBA 1LL0A 1W77A 1VZXA 1PZTA 1H4DA 2FYAA 3EE5A 2PX7A 2RJ8A 2GGQA 4AAWA 1VICA 2XWNA 4NANA 2WEEA 1FOAA 5C3BA 1H4CA 4KPXA 4CJCA 2ICYA 3OH0A 3DK5A 5FTSA 5IDSA 5EIYA 3JTJA 3I0LA 2QGIA 5CMJA 1GX4A 2AM3A 3OKRA 2XMEA 3NGWA 1YROB 4B4BA 4D11A 1ZJ2A 1QG8A 4Y7VA 4CJ8A 1LZ0A 2JCLA 2X5SA 1NKHB 4LW3A 5DDTA 1HJJA 5C4CA 1R82A 5CMIA 3OH1A 3SXEA 5AJOA 2VSHA 4B2WA 1FGXA 1S4PA 1H5SB 1HM0A 5CMFX 3OGZA 4KRVA 1PZYB 2XWLA 4G3PA 4UEGA 1JVDA 3I0EA 1HM9A 5FYEA 2AESA 4B5BA 4J18A 2O1HA 3E26A 2W0WA 5C49A 3HL3A 4FCEA 2Q4JA 1JV3A 3D98A 2O1GA 1QWJA 4KQLA 2YQSA 2ICXA 4Y7UA 5C4EA 2AM5A 2YESA 1G23A 1XHBA 2BO8A 1W55A 2FYCB 1FO9A 4KC2A 2V0JA 1XZ6A 3TZTA 2X5ZA 4C2SA 3BCVA 4HOCA 2WVMA 1H5SC 4EVWA 2V0IA 2JCKA 1KWSA 1SS9A 3FWWA 4B2XA 4BQHA 2VFZA 2W0VA 3SX7A 1NWGB 1ZCUA 4MNDA 2VXMA 3K8EA 3ZGGA 2RIXA 4FRDA 1G1LA 2I5KA 2X60A 3I0FA 4D0TA 4B4GA 1ZCVA 3V0NA 4ECMA 1VZTA 5CQMX 2DPWA 1G95A 1VPAA 3ZF8A 3SX8A 1GQ9A 1YP2A 1G2VA 1VGTA 3SXDA 1G0RA 3R2WA 5FTVA 3OAMA 2YQCA 2AM4A 1R7VA 3SPTA 1GX0A 4KT7A 2E8BA 2YC5A 1FG5N 3O3PA 3V91A 3D8VA 3D5NA 3V0MA 3Q7UA 1R7UA 3SX5A 3I0GA 4NAIA 1H5TA 4E1KA 4XWIA 4D48A 1TW1A 4AYLA 2Y7AA 4FRQA 4D0ZA 4M28A 1R7XA 3PKQA 4FROA 4D11C 1ON6A 1VH1A 1G3LA 3CKQA 5C3AA 4B3UA 2I7BA 1JYKA 4G87A 4EE4A 1K4VA 2X65A 1NMMB 1ZI5A 1LZIA 1FXOA 3R3IA 1S4OA 1OMZA 4LW6A 1GWVA 4HO4A 2RJ5A 3SXCA 3U0YA 1H7HA 3ZGFA 2BO6A 3FOQA 5CQPA 1VGUA 2VS3A 4P02A 1ZDFA 2CU2A 1H7GA 1WT1A 1G97A 3N9WA 4DE7A 4FRAA 4HCQA 1FO8A 1ZJOA 3ZLLA 5C47A 1R7YA 5AJNA 3T7NA 1EZIA 3V0OA 3SX3A 1FXJA 1FR9A 2AGDA 2WVLA 4Y63A 5DDVA 4K6RA 2PGYA 4JD0A 3V0QA 2VD4A 1NF5B 2Y4LA 3JUJA 3T7MA 5C48A 2OEFA 1QGQA 2QH5A 5L6SA 2RITA 3RMWA 4Y62A 1OQMB 1ZI3A 2P73A 3JUKA 4EEGA 4EEMA 3CKOA 4Y6NA 3U2WA 3CKVA 1G93A 1GA8A 4FREA 1O7OA 2OEGA 2YC3A 5EJZA 1TVYA 1H3MA 2Z87A 2AECA 4ZDQA 2PGVA 3ST8A 3DJ4A 3OH3A 1H5TB 3QVBA 4Y6UA 1FRWA 3U0XA 2QKXA 2WAWA 2V0LA 4AC3A 3E25A 1O0RA 1FGGA 1ZIZA 2Z86A 4ASYA 2P72A 1INJA 1ZHJA 1ZI1A 2UX8A 1O7QA 2OI6A 1H7QA 1ZI4A
chains in the Genus database with same CATH superfamily
1H7FA 2XWMA 1TZFA 1LL3A 1ZCYA 5CQNX 5C4DA 2BO7A 5IFYA 2Y6PA 2D0JA 2WE9A 4KC4A 3SXGA 3CGXA 5C36A 1WT0A 5L6VA 2O1FA 2ZU9A 4Y7TA 4FRLA 3T7OA 3V0LA 1MP4A 3I0KA 3I0HA 5IDTA 3IOIA 3BRKX 1NHEB 2I5EA 3U2VA 4DECA 2FFUA 2A8WA 2Y4JA 4FRBA 2YQHA 4FRHA 5C1LA 4CVHA 1ZDGA 1WSZA 4MIXA 4NAKA 2MZBA 1JV1A 4KNXA 4FRPA 1I52A 4HG6A 1ZCTA 3OH4A 3IOJA 3USRA 4Y7GA 2VSIA 2RJ9A 4FQWA 1HM8A 1VM8A 1QGSA 1S4NA 3KIAA 4HO5A 4FIXA 2RJ1A 1GQCA 2Y4KA 4ASJA 1HV9A 2RJ7A 2APCA 4EEAA 1H5RA 2OI5A 5CMHA 3PKPA 1V83A 3USQA 3OH2A 3Q80A 3V8YA 4IRPA 3GUEA 4HO3A 3RSBA 4KPZA 3POLA 1IINA 4Y64A 4HO0A 1G9RA 1YP4A 3U2TA 5I1FA 4Y7FA 1OMXA 2E3DA 2YCMA 1GWWA 1ZJPA 5CMGX 2OI7A 4KC1A 1WVCA 3K8DA 2YQJA 4ARWA 2NXVA 4BMAA 2RJ4A 1ON8A 1ZJ0A 4JISA 5HS2A 4HO9A 4G3SA 3CKNA 4M4KA 2P6WA 4HO2A 1LZJA 1EYRA 4EE3A 4M2AA 1H7EA 5C4BA 5C8RA 4M2BA 2JCOA 1WT3A 1VH3A 3U2XA 5C1HA 5J49A 2VS5A 4YS8A 4CJBA 3OC9A 4HO6A 4O6MA 3DUVA 2FY7A 1JYLA 2WVKA 1LVWA 1R7TA 1W57A 3U2UA 3IOHA 3I0IX 2FYDB 3RMVA 2BO4A 5JQQA 1WT2A 2RJ6A 1MP5A 4P00A 4FRMA 1LZ7A 5CQLX 4B42A 4MYBA 2V0KA 2ZU8A 2VS4A 1LL2A 5BXCA 5FV9A 1VZUA 5D91A 3Q4SA 4FCUA 1H5RB 4AYJA 3I0CA 2GGOA 4R7PA 3V0PA 2PA4A 3V8ZA 2JCJA 5CQOA 4NALA 1V82A 1MC3A 4G3QA 5FUHA 2VXLA 1Z90A 3I0DA 3ZLKA 1FR8A 2FYBA 1H7TA 2V0HA 1FZWA 3TQDA 3LW6A 3V90A 1E5KA 3CKJA 5C1GA 2XMHA 1YP3A 1INIA 2ZU7A 4IRQA 1MP3A 2D7RA 1IIMA 1R81A 1H5SA 4B4MA 1TW5A 4O6NA 1V84A 1VGZA 3PNNA 1JVGA 4Y9XA 4DDZA 4Q7CA 5EJ1A 1FWYA 3F1CA 2AE7A 1G8OA 3CU0A 1ZJ3A 1R80A 5FU8A 3F1YA 1H4EA 5C38A 2AH9A 1H7LA 5FU0A 1H5SD 2RIZA 2Y4MA 1ZJ1A 5C4FA 2RJ0A 4L41C 1HJLA 4EE5A 2FFVA 4HO8A 5AJPA 2RIYA 4KXOA 2D7IA 2WGZA 1O23B 1VGWA 1NQIB 4EEOA 2A8UA 3I0JA 5C3DA 4KNRA 4GBPA 3SXAA 3SXBA 1LL0A 1W77A 1VZXA 1PZTA 1H4DA 2FYAA 3EE5A 2PX7A 2RJ8A 2GGQA 4AAWA 1VICA 2XWNA 4NANA 2WEEA 1FOAA 5C3BA 1H4CA 4KPXA 4CJCA 2ICYA 3OH0A 3DK5A 5FTSA 5IDSA 5EIYA 3JTJA 3I0LA 2QGIA 5CMJA 1GX4A 2AM3A 3OKRA 2XMEA 3NGWA 1YROB 4B4BA 4D11A 1ZJ2A 1QG8A 4Y7VA 4CJ8A 1LZ0A 2JCLA 2J0AA 2X5SA 1NKHB 4LW3A 2C0NA 5DDTA 1HJJA 5C4CA 1R82A 5CMIA 3OH1A 3SXEA 5AJOA 2VSHA 4B2WA 1FGXA 1S4PA 1H5SB 1HM0A 5CMFX 3OGZA 4KRVA 1PZYB 2XWLA 4G3PA 4UEGA 1JVDA 3I0EA 1HM9A 5FYEA 2AESA 4B5BA 4J18A 2O1HA 3E26A 2W0WA 5C49A 3HL3A 4FCEA 2Q4JA 1JV3A 3D98A 2O1GA 1QWJA 4KQLA 2YQSA 2ICXA 4Y7UA 5C4EA 2AM5A 2YESA 1G23A 1XHBA 2BO8A 1W55A 2FYCB 1FO9A 4KC2A 2V0JA 1XZ6A 3TZTA 2X5ZA 4C2SA 3BCVA 4HOCA 2WVMA 1H5SC 4EVWA 2V0IA 2JCKA 1KWSA 1SS9A 3FWWA 4B2XA 4BQHA 2VFZA 2W0VA 3SX7A 1NWGB 1ZCUA 4MNDA 2VXMA 3K8EA 3ZGGA 2RIXA 4FRDA 1G1LA 5D92A 2I5KA 2X60A 3I0FA 4D0TA 4B4GA 1ZCVA 3V0NA 4ECMA 1VZTA 5CQMX 2DPWA 1G95A 1VPAA 3ZF8A 3SX8A 1GQ9A 1YP2A 1G2VA 1VGTA 3SXDA 1G0RA 3R2WA 5FTVA 3OAMA 4FIYA 2YQCA 2AM4A 1R7VA 3SPTA 1GX0A 4KT7A 2E8BA 2YC5A 1FG5N 3O3PA 3V91A 3D8VA 3D5NA 3V0MA 3Q7UA 1R7UA 3SX5A 3I0GA 4NAIA 1H5TA 4E1KA 4XWIA 4D48A 1TW1A 4AYLA 2Y7AA 4FRQA 4D0ZA 4M28A 1R7XA 3PKQA 4FROA 4D11C 1ON6A 1VH1A 1G3LA 3CKQA 5C3AA 4B3UA 2I7BA 1JYKA 4G87A 4EE4A 1K4VA 2X65A 1NMMB 1ZI5A 1LZIA 1FXOA 3R3IA 1S4OA 1OMZA 4LW6A 1GWVA 4HO4A 2RJ5A 3SXCA 3U0YA 1H7HA 3ZGFA 2BO6A 3FOQA 5CQPA 1VGUA 2VS3A 4P02A 1ZDFA 2CU2A 1H7GA 1WT1A 1G97A 3N9WA 4DE7A 4FRAA 4HCQA 1FO8A 1ZJOA 3ZLLA 5C47A 1R7YA 5AJNA 3T7NA 1EZIA 3V0OA 3SX3A 1FXJA 2J0BA 1FR9A 2AGDA 2WVLA 4Y63A 5DDVA 4K6RA 2PGYA 4JD0A 3V0QA 2VD4A 1NF5B 2Y4LA 3JUJA 3T7MA 5C48A 2OEFA 1QGQA 2QH5A 5L6SA 2RITA 3RMWA 4Y62A 1OQMB 1ZI3A 2P73A 3JUKA 4EEGA 4EEMA 3CKOA 4Y6NA 3U2WA 3CKVA 1G93A 1GA8A 4FREA 1O7OA 2OEGA 2YC3A 5EJZA 1TVYA 1H3MA 2Z87A 2AECA 4ZDQA 2PGVA 3ST8A 3DJ4A 3OH3A 1H5TB 3QVBA 4Y6UA 1FRWA 3U0XA 2QKXA 2WAWA 2V0LA 4AC3A 3E25A 1O0RA 1FGGA 1ZIZA 2Z86A 4ASYA 2P72A 1INJA 1ZHJA 1ZI1A 2UX8A 1O7QA 2OI6A 1H7QA 1ZI4A 2VK9A
chains in the Genus database with same CATH topology
1H7FA 2XWMA 1TZFA 1LL3A 1ZCYA 5CQNX 5C4DA 2BO7A 5IFYA 2Y6PA 2D0JA 2WE9A 4KC4A 3SXGA 3CGXA 5C36A 1WT0A 5L6VA 2O1FA 2ZU9A 4Y7TA 4FRLA 3T7OA 3V0LA 1MP4A 3I0KA 3I0HA 5IDTA 3IOIA 3BRKX 1NHEB 2I5EA 3U2VA 4DECA 2FFUA 2A8WA 2Y4JA 4FRBA 2YQHA 4FRHA 5C1LA 4CVHA 1ZDGA 1WSZA 4MIXA 4NAKA 2MZBA 1JV1A 4KNXA 4FRPA 1I52A 4HG6A 1ZCTA 3OH4A 3IOJA 3USRA 4Y7GA 2VSIA 2RJ9A 4FQWA 1HM8A 1VM8A 1QGSA 1S4NA 3KIAA 4HO5A 4FIXA 2RJ1A 1GQCA 2Y4KA 4ASJA 1HV9A 2RJ7A 2APCA 4EEAA 1H5RA 2OI5A 5CMHA 3PKPA 1V83A 3USQA 3OH2A 3Q80A 3V8YA 4IRPA 3GUEA 4HO3A 3RSBA 4KPZA 3POLA 1IINA 4Y64A 4HO0A 1G9RA 1YP4A 3U2TA 5I1FA 4Y7FA 1OMXA 2E3DA 2YCMA 1GWWA 1ZJPA 5CMGX 2OI7A 4KC1A 1WVCA 3K8DA 2YQJA 4ARWA 2NXVA 4BMAA 2RJ4A 1ON8A 1ZJ0A 4JISA 5HS2A 4HO9A 4G3SA 3CKNA 4M4KA 2P6WA 4HO2A 1LZJA 1EYRA 4EE3A 4M2AA 1H7EA 5C4BA 5C8RA 4M2BA 2JCOA 1WT3A 1VH3A 3U2XA 5C1HA 5J49A 2VS5A 4YS8A 4CJBA 3OC9A 4HO6A 4O6MA 3DUVA 2FY7A 1JYLA 2WVKA 1LVWA 1R7TA 1W57A 3U2UA 3IOHA 3I0IX 2FYDB 3RMVA 2BO4A 5JQQA 1WT2A 2RJ6A 1MP5A 4P00A 4FRMA 1LZ7A 5CQLX 4B42A 4MYBA 2V0KA 2ZU8A 2VS4A 1LL2A 5BXCA 5FV9A 1VZUA 5D91A 3Q4SA 4FCUA 1H5RB 4AYJA 3I0CA 2GGOA 4R7PA 3V0PA 2PA4A 3V8ZA 2JCJA 5CQOA 4NALA 1V82A 1MC3A 4G3QA 5FUHA 2VXLA 1Z90A 3I0DA 3ZLKA 1FR8A 2FYBA 1H7TA 2V0HA 1FZWA 3TQDA 3LW6A 3V90A 1E5KA 3CKJA 5C1GA 2XMHA 1YP3A 1INIA 2ZU7A 4IRQA 1MP3A 2D7RA 1IIMA 1R81A 1H5SA 4B4MA 1TW5A 4O6NA 1V84A 1VGZA 3PNNA 1JVGA 4Y9XA 4DDZA 4Q7CA 5EJ1A 1FWYA 3F1CA 2AE7A 1G8OA 3CU0A 1ZJ3A 1R80A 5FU8A 3F1YA 1H4EA 5C38A 2AH9A 1H7LA 5FU0A 1H5SD 2RIZA 2Y4MA 1ZJ1A 5C4FA 2RJ0A 4L41C 1HJLA 4EE5A 2FFVA 4HO8A 5AJPA 2RIYA 4KXOA 2D7IA 2WGZA 1O23B 1VGWA 1NQIB 4EEOA 2A8UA 3I0JA 5C3DA 4KNRA 4GBPA 3SXAA 3SXBA 1LL0A 1W77A 1VZXA 1PZTA 1H4DA 2FYAA 3EE5A 2PX7A 2RJ8A 2GGQA 4AAWA 1VICA 2XWNA 4NANA 2WEEA 1FOAA 5C3BA 1H4CA 4KPXA 4CJCA 2ICYA 3OH0A 3DK5A 5FTSA 5IDSA 5EIYA 3JTJA 3I0LA 2QGIA 5CMJA 1GX4A 2AM3A 3OKRA 2XMEA 3NGWA 1YROB 4B4BA 4D11A 1ZJ2A 1QG8A 4Y7VA 4CJ8A 1LZ0A 2JCLA 2J0AA 2X5SA 1NKHB 4LW3A 2C0NA 5DDTA 1HJJA 5C4CA 1R82A 5CMIA 3OH1A 3SXEA 5AJOA 2VSHA 4B2WA 1FGXA 1S4PA 1H5SB 1HM0A 5CMFX 3OGZA 4KRVA 1PZYB 2XWLA 4G3PA 4UEGA 1JVDA 3I0EA 1HM9A 5FYEA 2AESA 4B5BA 4J18A 2O1HA 3E26A 2W0WA 5C49A 3HL3A 4FCEA 2Q4JA 1JV3A 3D98A 2O1GA 1QWJA 4KQLA 2YQSA 2ICXA 4Y7UA 5C4EA 2AM5A 2YESA 1G23A 1XHBA 2BO8A 1W55A 2FYCB 1FO9A 4KC2A 2V0JA 1XZ6A 3TZTA 2X5ZA 4C2SA 3BCVA 4HOCA 2WVMA 1H5SC 4EVWA 2V0IA 2JCKA 1KWSA 1SS9A 3FWWA 4B2XA 4BQHA 2VFZA 2W0VA 3SX7A 1NWGB 1ZCUA 4MNDA 2VXMA 3K8EA 3ZGGA 2RIXA 4FRDA 1G1LA 5D92A 2I5KA 2X60A 3I0FA 4D0TA 4B4GA 1ZCVA 3V0NA 4ECMA 1VZTA 5CQMX 2DPWA 1G95A 1VPAA 3ZF8A 3SX8A 1GQ9A 1YP2A 1G2VA 1VGTA 3SXDA 1G0RA 3R2WA 5FTVA 3OAMA 4FIYA 2YQCA 2AM4A 1R7VA 3SPTA 1GX0A 4KT7A 2E8BA 2YC5A 1FG5N 3O3PA 3V91A 3D8VA 3D5NA 3V0MA 3Q7UA 1R7UA 3SX5A 3I0GA 4NAIA 1H5TA 4E1KA 4XWIA 4D48A 1TW1A 4AYLA 2Y7AA 4FRQA 4D0ZA 4M28A 1R7XA 3PKQA 4FROA 4D11C 1ON6A 1VH1A 1G3LA 3CKQA 5C3AA 4B3UA 2I7BA 1JYKA 4G87A 4EE4A 1K4VA 2X65A 1NMMB 1ZI5A 1LZIA 1FXOA 3R3IA 1S4OA 1OMZA 4LW6A 1GWVA 4HO4A 2RJ5A 3SXCA 3U0YA 1H7HA 3ZGFA 2BO6A 3FOQA 5CQPA 1VGUA 2VS3A 4P02A 1ZDFA 2CU2A 1H7GA 1WT1A 1G97A 3N9WA 4DE7A 4FRAA 4HCQA 1FO8A 1ZJOA 3ZLLA 5C47A 1R7YA 5AJNA 3T7NA 1EZIA 3V0OA 3SX3A 1FXJA 2J0BA 1FR9A 2AGDA 2WVLA 4Y63A 5DDVA 4K6RA 2PGYA 4JD0A 3V0QA 2VD4A 1NF5B 2Y4LA 3JUJA 3T7MA 5C48A 2OEFA 1QGQA 2QH5A 5L6SA 2RITA 3RMWA 4Y62A 1OQMB 1ZI3A 2P73A 3JUKA 4EEGA 4EEMA 3CKOA 4Y6NA 3U2WA 3CKVA 1G93A 1GA8A 4FREA 1O7OA 2OEGA 2YC3A 5EJZA 1TVYA 1H3MA 2Z87A 2AECA 4ZDQA 2PGVA 3ST8A 3DJ4A 3OH3A 1H5TB 3QVBA 4Y6UA 1FRWA 3U0XA 2QKXA 2WAWA 2V0LA 4AC3A 3E25A 1O0RA 1FGGA 1ZIZA 2Z86A 4ASYA 2P72A 1INJA 1ZHJA 1ZI1A 2UX8A 1O7QA 2OI6A 1H7QA 1ZI4A 2VK9A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1H7F A;  2XWM A;  1TZF A;  1LL3 A;  1ZCY A;  5CQN X;  5C4D A;  2BO7 A;  5IFY A;  2Y6P A;  2D0J A;  2WE9 A;  4KC4 A;  3SXG A;  3CGX A;  5C36 A;  1WT0 A;  5L6V A;  2O1F A;  2ZU9 A;  4Y7T A;  4FRL A;  3T7O A;  3V0L A;  1MP4 A;  3I0K A;  3I0H A;  5IDT A;  3IOI A;  3BRK X;  1NHE B;  2I5E A;  3U2V A;  4DEC A;  2FFU A;  2A8W A;  2Y4J A;  4FRB A;  2YQH A;  4FRH A;  5C1L A;  4CVH A;  1ZDG A;  1WSZ A;  4NAK A;  2MZB A;  1JV1 A;  4KNX A;  4FRP A;  1I52 A;  4HG6 A;  1ZCT A;  3OH4 A;  3IOJ A;  3USR A;  4Y7G A;  2VSI A;  2RJ9 A;  4FQW A;  1HM8 A;  1VM8 A;  1QGS A;  1S4N A;  3KIA A;  4HO5 A;  2RJ1 A;  1GQC A;  2Y4K A;  4ASJ A;  1HV9 A;  2RJ7 A;  2APC A;  4EEA A;  1H5R A;  2OI5 A;  5CMH A;  3PKP A;  1V83 A;  3USQ A;  3OH2 A;  3Q80 A;  3V8Y A;  4IRP A;  3GUE A;  4HO3 A;  3RSB A;  4KPZ A;  3POL A;  1IIN A;  4Y64 A;  4HO0 A;  1G9R A;  1YP4 A;  3U2T A;  5I1F A;  4Y7F A;  1OMX A;  2E3D A;  2YCM A;  1GWW A;  1ZJP A;  5CMG X;  2OI7 A;  4KC1 A;  1WVC A;  3K8D A;  2YQJ A;  4ARW A;  2NXV A;  4BMA A;  2RJ4 A;  1ON8 A;  1ZJ0 A;  4JIS A;  5HS2 A;  4HO9 A;  4G3S A;  3CKN A;  4M4K A;  2P6W A;  4HO2 A;  1LZJ A;  1EYR A;  4EE3 A;  4M2A A;  1H7E A;  5C4B A;  5C8R A;  4M2B A;  2JCO A;  1WT3 A;  1VH3 A;  3U2X A;  5C1H A;  5J49 A;  2VS5 A;  4YS8 A;  4CJB A;  3OC9 A;  4HO6 A;  3DUV A;  2FY7 A;  1JYL A;  2WVK A;  1LVW A;  1R7T A;  1W57 A;  3U2U A;  3IOH A;  3I0I X;  2FYD B;  3RMV A;  2BO4 A;  5JQQ A;  1WT2 A;  2RJ6 A;  1MP5 A;  4P00 A;  4FRM A;  1LZ7 A;  5CQL X;  4B42 A;  4MYB A;  2V0K A;  2ZU8 A;  2VS4 A;  1LL2 A;  5BXC A;  5FV9 A;  1VZU A;  3Q4S A;  4FCU A;  1H5R B;  4AYJ A;  3I0C A;  2GGO A;  4R7P A;  3V0P A;  2PA4 A;  3V8Z A;  2JCJ A;  5CQO A;  4NAL A;  1V82 A;  1MC3 A;  4G3Q A;  5FUH A;  2VXL A;  1Z90 A;  3I0D A;  3ZLK A;  1FR8 A;  2FYB A;  1H7T A;  2V0H A;  1FZW A;  3TQD A;  3LW6 A;  3V90 A;  1E5K A;  3CKJ A;  5C1G A;  2XMH A;  1YP3 A;  1INI A;  2ZU7 A;  4IRQ A;  1MP3 A;  2D7R A;  1IIM A;  1R81 A;  1H5S A;  4B4M A;  1TW5 A;  1V84 A;  1VGZ A;  3PNN A;  1JVG A;  4Y9X A;  4DDZ A;  5EJ1 A;  1FWY A;  3F1C A;  2AE7 A;  1G8O A;  3CU0 A;  1ZJ3 A;  1R80 A;  5FU8 A;  3F1Y A;  1H4E A;  5C38 A;  2AH9 A;  1H7L A;  5FU0 A;  1H5S D;  2RIZ A;  2Y4M A;  1ZJ1 A;  5C4F A;  2RJ0 A;  4L41 C;  1HJL A;  4EE5 A;  2FFV A;  4HO8 A;  5AJP A;  2RIY A;  4KXO A;  2D7I A;  2WGZ A;  1O23 B;  1VGW A;  1NQI B;  4EEO A;  2A8U A;  3I0J A;  5C3D A;  4KNR A;  4GBP A;  3SXA A;  3SXB A;  1LL0 A;  1W77 A;  1VZX A;  1PZT A;  1H4D A;  2FYA A;  3EE5 A;  2PX7 A;  2RJ8 A;  2GGQ A;  4AAW A;  1VIC A;  2XWN A;  4NAN A;  2WEE A;  1FOA A;  5C3B A;  1H4C A;  4KPX A;  4CJC A;  2ICY A;  3OH0 A;  3DK5 A;  5FTS A;  5IDS A;  5EIY A;  3JTJ A;  3I0L A;  2QGI A;  5CMJ A;  1GX4 A;  2AM3 A;  3OKR A;  2XME A;  3NGW A;  1YRO B;  4B4B A;  4D11 A;  1ZJ2 A;  1QG8 A;  4Y7V A;  4CJ8 A;  1LZ0 A;  2JCL A;  2X5S A;  1NKH B;  4LW3 A;  5DDT A;  1HJJ A;  5C4C A;  1R82 A;  5CMI A;  3OH1 A;  3SXE A;  5AJO A;  2VSH A;  4B2W A;  1FGX A;  1S4P A;  1H5S B;  1HM0 A;  5CMF X;  3OGZ A;  4KRV A;  1PZY B;  2XWL A;  4G3P A;  4UEG A;  1JVD A;  3I0E A;  1HM9 A;  5FYE A;  2AES A;  4B5B A;  4J18 A;  2O1H A;  3E26 A;  2W0W A;  5C49 A;  3HL3 A;  4FCE A;  2Q4J A;  1JV3 A;  3D98 A;  2O1G A;  1QWJ A;  4KQL A;  2YQS A;  2ICX A;  4Y7U A;  5C4E A;  2AM5 A;  2YES A;  1G23 A;  1XHB A;  2BO8 A;  1W55 A;  2FYC B;  1FO9 A;  4KC2 A;  2V0J A;  1XZ6 A;  3TZT A;  2X5Z A;  4C2S A;  3BCV A;  4HOC A;  2WVM A;  1H5S C;  4EVW A;  2V0I A;  2JCK A;  1KWS A;  1SS9 A;  3FWW A;  4B2X A;  4BQH A;  2VFZ A;  2W0V A;  3SX7 A;  1NWG B;  1ZCU A;  4MND A;  2VXM A;  3K8E A;  3ZGG A;  2RIX A;  4FRD A;  1G1L A;  2I5K A;  2X60 A;  3I0F A;  4D0T A;  4B4G A;  1ZCV A;  3V0N A;  4ECM A;  1VZT A;  5CQM X;  2DPW A;  1G95 A;  1VPA A;  3ZF8 A;  3SX8 A;  1GQ9 A;  1YP2 A;  1G2V A;  1VGT A;  3SXD A;  1G0R A;  3R2W A;  5FTV A;  3OAM A;  2YQC A;  2AM4 A;  1R7V A;  3SPT A;  1GX0 A;  4KT7 A;  2E8B A;  2YC5 A;  1FG5 N;  3O3P A;  3V91 A;  3D8V A;  3D5N A;  3V0M A;  3Q7U A;  1R7U A;  3SX5 A;  3I0G A;  4NAI A;  1H5T A;  4E1K A;  4XWI A;  4D48 A;  1TW1 A;  4AYL A;  2Y7A A;  4FRQ A;  4D0Z A;  4M28 A;  1R7X A;  3PKQ A;  4FRO A;  4D11 C;  1ON6 A;  1VH1 A;  1G3L A;  3CKQ A;  5C3A A;  4B3U A;  2I7B A;  1JYK A;  4G87 A;  4EE4 A;  1K4V A;  2X65 A;  1NMM B;  1ZI5 A;  1LZI A;  1FXO A;  3R3I A;  1S4O A;  1OMZ A;  4LW6 A;  1GWV A;  4HO4 A;  2RJ5 A;  3SXC A;  3U0Y A;  1H7H A;  3ZGF A;  2BO6 A;  3FOQ A;  5CQP A;  1VGU A;  2VS3 A;  4P02 A;  1ZDF A;  2CU2 A;  1H7G A;  1WT1 A;  1G97 A;  3N9W A;  4DE7 A;  4FRA A;  4HCQ A;  1FO8 A;  1ZJO A;  3ZLL A;  5C47 A;  1R7Y A;  5AJN A;  3T7N A;  1EZI A;  3V0O A;  3SX3 A;  1FXJ A;  1FR9 A;  2AGD A;  2WVL A;  4Y63 A;  5DDV A;  4K6R A;  2PGY A;  4JD0 A;  3V0Q A;  2VD4 A;  1NF5 B;  2Y4L A;  3JUJ A;  3T7M A;  5C48 A;  2OEF A;  1QGQ A;  2QH5 A;  5L6S A;  2RIT A;  3RMW A;  4Y62 A;  1OQM B;  1ZI3 A;  2P73 A;  3JUK A;  4EEG A;  4EEM A;  3CKO A;  4Y6N A;  3U2W A;  3CKV A;  1G93 A;  1GA8 A;  4FRE A;  1O7O A;  2OEG A;  2YC3 A;  5EJZ A;  1TVY A;  1H3M A;  2Z87 A;  2AEC A;  4ZDQ A;  2PGV A;  3ST8 A;  3DJ4 A;  3OH3 A;  1H5T B;  3QVB A;  4Y6U A;  1FRW A;  3U0X A;  2QKX A;  2WAW A;  2V0L A;  4AC3 A;  3E25 A;  1O0R A;  1FGG A;  1ZIZ A;  2Z86 A;  4ASY A;  2P72 A;  1INJ A;  1ZHJ A;  1ZI1 A;  2UX8 A;  1O7Q A;  2OI6 A;  1H7Q A;  1ZI4 A; 
#chains in the Genus database with same CATH topology
 1H7F A;  2XWM A;  1TZF A;  1LL3 A;  1ZCY A;  5CQN X;  5C4D A;  2BO7 A;  5IFY A;  2Y6P A;  2D0J A;  2WE9 A;  4KC4 A;  3SXG A;  3CGX A;  5C36 A;  1WT0 A;  5L6V A;  2O1F A;  2ZU9 A;  4Y7T A;  4FRL A;  3T7O A;  3V0L A;  1MP4 A;  3I0K A;  3I0H A;  5IDT A;  3IOI A;  3BRK X;  1NHE B;  2I5E A;  3U2V A;  4DEC A;  2FFU A;  2A8W A;  2Y4J A;  4FRB A;  2YQH A;  4FRH A;  5C1L A;  4CVH A;  1ZDG A;  1WSZ A;  4MIX A;  4NAK A;  2MZB A;  1JV1 A;  4KNX A;  4FRP A;  1I52 A;  4HG6 A;  1ZCT A;  3OH4 A;  3IOJ A;  3USR A;  4Y7G A;  2VSI A;  2RJ9 A;  4FQW A;  1HM8 A;  1VM8 A;  1QGS A;  1S4N A;  3KIA A;  4HO5 A;  4FIX A;  2RJ1 A;  1GQC A;  2Y4K A;  4ASJ A;  1HV9 A;  2RJ7 A;  2APC A;  4EEA A;  1H5R A;  2OI5 A;  5CMH A;  3PKP A;  1V83 A;  3USQ A;  3OH2 A;  3Q80 A;  3V8Y A;  4IRP A;  3GUE A;  4HO3 A;  3RSB A;  4KPZ A;  3POL A;  1IIN A;  4Y64 A;  4HO0 A;  1G9R A;  1YP4 A;  3U2T A;  5I1F A;  4Y7F A;  1OMX A;  2E3D A;  2YCM A;  1GWW A;  1ZJP A;  5CMG X;  2OI7 A;  4KC1 A;  1WVC A;  3K8D A;  2YQJ A;  4ARW A;  2NXV A;  4BMA A;  2RJ4 A;  1ON8 A;  1ZJ0 A;  4JIS A;  5HS2 A;  4HO9 A;  4G3S A;  3CKN A;  4M4K A;  2P6W A;  4HO2 A;  1LZJ A;  1EYR A;  4EE3 A;  4M2A A;  1H7E A;  5C4B A;  5C8R A;  4M2B A;  2JCO A;  1WT3 A;  1VH3 A;  3U2X A;  5C1H A;  5J49 A;  2VS5 A;  4YS8 A;  4CJB A;  3OC9 A;  4HO6 A;  4O6M A;  3DUV A;  2FY7 A;  1JYL A;  2WVK A;  1LVW A;  1R7T A;  1W57 A;  3U2U A;  3IOH A;  3I0I X;  2FYD B;  3RMV A;  2BO4 A;  5JQQ A;  1WT2 A;  2RJ6 A;  1MP5 A;  4P00 A;  4FRM A;  1LZ7 A;  5CQL X;  4B42 A;  4MYB A;  2V0K A;  2ZU8 A;  2VS4 A;  1LL2 A;  5BXC A;  5FV9 A;  1VZU A;  5D91 A;  3Q4S A;  4FCU A;  1H5R B;  4AYJ A;  3I0C A;  2GGO A;  4R7P A;  3V0P A;  2PA4 A;  3V8Z A;  2JCJ A;  5CQO A;  4NAL A;  1V82 A;  1MC3 A;  4G3Q A;  5FUH A;  2VXL A;  1Z90 A;  3I0D A;  3ZLK A;  1FR8 A;  2FYB A;  1H7T A;  2V0H A;  1FZW A;  3TQD A;  3LW6 A;  3V90 A;  1E5K A;  3CKJ A;  5C1G A;  2XMH A;  1YP3 A;  1INI A;  2ZU7 A;  4IRQ A;  1MP3 A;  2D7R A;  1IIM A;  1R81 A;  1H5S A;  4B4M A;  1TW5 A;  4O6N A;  1V84 A;  1VGZ A;  3PNN A;  1JVG A;  4Y9X A;  4DDZ A;  4Q7C A;  5EJ1 A;  1FWY A;  3F1C A;  2AE7 A;  1G8O A;  3CU0 A;  1ZJ3 A;  1R80 A;  5FU8 A;  3F1Y A;  1H4E A;  5C38 A;  2AH9 A;  1H7L A;  5FU0 A;  1H5S D;  2RIZ A;  2Y4M A;  1ZJ1 A;  5C4F A;  2RJ0 A;  4L41 C;  1HJL A;  4EE5 A;  2FFV A;  4HO8 A;  5AJP A;  2RIY A;  4KXO A;  2D7I A;  2WGZ A;  1O23 B;  1VGW A;  1NQI B;  4EEO A;  2A8U A;  3I0J A;  5C3D A;  4KNR A;  4GBP A;  3SXA A;  3SXB A;  1LL0 A;  1W77 A;  1VZX A;  1PZT A;  1H4D A;  2FYA A;  3EE5 A;  2PX7 A;  2RJ8 A;  2GGQ A;  4AAW A;  1VIC A;  2XWN A;  4NAN A;  2WEE A;  1FOA A;  5C3B A;  1H4C A;  4KPX A;  4CJC A;  2ICY A;  3OH0 A;  3DK5 A;  5FTS A;  5IDS A;  5EIY A;  3JTJ A;  3I0L A;  2QGI A;  5CMJ A;  1GX4 A;  2AM3 A;  3OKR A;  2XME A;  3NGW A;  1YRO B;  4B4B A;  4D11 A;  1ZJ2 A;  1QG8 A;  4Y7V A;  4CJ8 A;  1LZ0 A;  2JCL A;  2J0A A;  2X5S A;  1NKH B;  4LW3 A;  2C0N A;  5DDT A;  1HJJ A;  5C4C A;  1R82 A;  5CMI A;  3OH1 A;  3SXE A;  5AJO A;  2VSH A;  4B2W A;  1FGX A;  1S4P A;  1H5S B;  1HM0 A;  5CMF X;  3OGZ A;  4KRV A;  1PZY B;  2XWL A;  4G3P A;  4UEG A;  1JVD A;  3I0E A;  1HM9 A;  5FYE A;  2AES A;  4B5B A;  4J18 A;  2O1H A;  3E26 A;  2W0W A;  5C49 A;  3HL3 A;  4FCE A;  2Q4J A;  1JV3 A;  3D98 A;  2O1G A;  1QWJ A;  4KQL A;  2YQS A;  2ICX A;  4Y7U A;  5C4E A;  2AM5 A;  2YES A;  1G23 A;  1XHB A;  2BO8 A;  1W55 A;  2FYC B;  1FO9 A;  4KC2 A;  2V0J A;  1XZ6 A;  3TZT A;  2X5Z A;  4C2S A;  3BCV A;  4HOC A;  2WVM A;  1H5S C;  4EVW A;  2V0I A;  2JCK A;  1KWS A;  1SS9 A;  3FWW A;  4B2X A;  4BQH A;  2VFZ A;  2W0V A;  3SX7 A;  1NWG B;  1ZCU A;  4MND A;  2VXM A;  3K8E A;  3ZGG A;  2RIX A;  4FRD A;  1G1L A;  5D92 A;  2I5K A;  2X60 A;  3I0F A;  4D0T A;  4B4G A;  1ZCV A;  3V0N A;  4ECM A;  1VZT A;  5CQM X;  2DPW A;  1G95 A;  1VPA A;  3ZF8 A;  3SX8 A;  1GQ9 A;  1YP2 A;  1G2V A;  1VGT A;  3SXD A;  1G0R A;  3R2W A;  5FTV A;  3OAM A;  4FIY A;  2YQC A;  2AM4 A;  1R7V A;  3SPT A;  1GX0 A;  4KT7 A;  2E8B A;  2YC5 A;  1FG5 N;  3O3P A;  3V91 A;  3D8V A;  3D5N A;  3V0M A;  3Q7U A;  1R7U A;  3SX5 A;  3I0G A;  4NAI A;  1H5T A;  4E1K A;  4XWI A;  4D48 A;  1TW1 A;  4AYL A;  2Y7A A;  4FRQ A;  4D0Z A;  4M28 A;  1R7X A;  3PKQ A;  4FRO A;  4D11 C;  1ON6 A;  1VH1 A;  1G3L A;  3CKQ A;  5C3A A;  4B3U A;  2I7B A;  1JYK A;  4G87 A;  4EE4 A;  1K4V A;  2X65 A;  1NMM B;  1ZI5 A;  1LZI A;  1FXO A;  3R3I A;  1S4O A;  1OMZ A;  4LW6 A;  1GWV A;  4HO4 A;  2RJ5 A;  3SXC A;  3U0Y A;  1H7H A;  3ZGF A;  2BO6 A;  3FOQ A;  5CQP A;  1VGU A;  2VS3 A;  4P02 A;  1ZDF A;  2CU2 A;  1H7G A;  1WT1 A;  1G97 A;  3N9W A;  4DE7 A;  4FRA A;  4HCQ A;  1FO8 A;  1ZJO A;  3ZLL A;  5C47 A;  1R7Y A;  5AJN A;  3T7N A;  1EZI A;  3V0O A;  3SX3 A;  1FXJ A;  2J0B A;  1FR9 A;  2AGD A;  2WVL A;  4Y63 A;  5DDV A;  4K6R A;  2PGY A;  4JD0 A;  3V0Q A;  2VD4 A;  1NF5 B;  2Y4L A;  3JUJ A;  3T7M A;  5C48 A;  2OEF A;  1QGQ A;  2QH5 A;  5L6S A;  2RIT A;  3RMW A;  4Y62 A;  1OQM B;  1ZI3 A;  2P73 A;  3JUK A;  4EEG A;  4EEM A;  3CKO A;  4Y6N A;  3U2W A;  3CKV A;  1G93 A;  1GA8 A;  4FRE A;  1O7O A;  2OEG A;  2YC3 A;  5EJZ A;  1TVY A;  1H3M A;  2Z87 A;  2AEC A;  4ZDQ A;  2PGV A;  3ST8 A;  3DJ4 A;  3OH3 A;  1H5T B;  3QVB A;  4Y6U A;  1FRW A;  3U0X A;  2QKX A;  2WAW A;  2V0L A;  4AC3 A;  3E25 A;  1O0R A;  1FGG A;  1ZIZ A;  2Z86 A;  4ASY A;  2P72 A;  1INJ A;  1ZHJ A;  1ZI1 A;  2UX8 A;  1O7Q A;  2OI6 A;  1H7Q A;  1ZI4 A;  2VK9 A; 
#chains in the Genus database with same CATH homology
 1H7F A;  2XWM A;  1TZF A;  1LL3 A;  1ZCY A;  5CQN X;  5C4D A;  2BO7 A;  5IFY A;  2Y6P A;  2D0J A;  2WE9 A;  4KC4 A;  3SXG A;  3CGX A;  5C36 A;  1WT0 A;  5L6V A;  2O1F A;  2ZU9 A;  4Y7T A;  4FRL A;  3T7O A;  3V0L A;  1MP4 A;  3I0K A;  3I0H A;  5IDT A;  3IOI A;  3BRK X;  1NHE B;  2I5E A;  3U2V A;  4DEC A;  2FFU A;  2A8W A;  2Y4J A;  4FRB A;  2YQH A;  4FRH A;  5C1L A;  4CVH A;  1ZDG A;  1WSZ A;  4MIX A;  4NAK A;  2MZB A;  1JV1 A;  4KNX A;  4FRP A;  1I52 A;  4HG6 A;  1ZCT A;  3OH4 A;  3IOJ A;  3USR A;  4Y7G A;  2VSI A;  2RJ9 A;  4FQW A;  1HM8 A;  1VM8 A;  1QGS A;  1S4N A;  3KIA A;  4HO5 A;  4FIX A;  2RJ1 A;  1GQC A;  2Y4K A;  4ASJ A;  1HV9 A;  2RJ7 A;  2APC A;  4EEA A;  1H5R A;  2OI5 A;  5CMH A;  3PKP A;  1V83 A;  3USQ A;  3OH2 A;  3Q80 A;  3V8Y A;  4IRP A;  3GUE A;  4HO3 A;  3RSB A;  4KPZ A;  3POL A;  1IIN A;  4Y64 A;  4HO0 A;  1G9R A;  1YP4 A;  3U2T A;  5I1F A;  4Y7F A;  1OMX A;  2E3D A;  2YCM A;  1GWW A;  1ZJP A;  5CMG X;  2OI7 A;  4KC1 A;  1WVC A;  3K8D A;  2YQJ A;  4ARW A;  2NXV A;  4BMA A;  2RJ4 A;  1ON8 A;  1ZJ0 A;  4JIS A;  5HS2 A;  4HO9 A;  4G3S A;  3CKN A;  4M4K A;  2P6W A;  4HO2 A;  1LZJ A;  1EYR A;  4EE3 A;  4M2A A;  1H7E A;  5C4B A;  5C8R A;  4M2B A;  2JCO A;  1WT3 A;  1VH3 A;  3U2X A;  5C1H A;  5J49 A;  2VS5 A;  4YS8 A;  4CJB A;  3OC9 A;  4HO6 A;  4O6M A;  3DUV A;  2FY7 A;  1JYL A;  2WVK A;  1LVW A;  1R7T A;  1W57 A;  3U2U A;  3IOH A;  3I0I X;  2FYD B;  3RMV A;  2BO4 A;  5JQQ A;  1WT2 A;  2RJ6 A;  1MP5 A;  4P00 A;  4FRM A;  1LZ7 A;  5CQL X;  4B42 A;  4MYB A;  2V0K A;  2ZU8 A;  2VS4 A;  1LL2 A;  5BXC A;  5FV9 A;  1VZU A;  5D91 A;  3Q4S A;  4FCU A;  1H5R B;  4AYJ A;  3I0C A;  2GGO A;  4R7P A;  3V0P A;  2PA4 A;  3V8Z A;  2JCJ A;  5CQO A;  4NAL A;  1V82 A;  1MC3 A;  4G3Q A;  5FUH A;  2VXL A;  1Z90 A;  3I0D A;  3ZLK A;  1FR8 A;  2FYB A;  1H7T A;  2V0H A;  1FZW A;  3TQD A;  3LW6 A;  3V90 A;  1E5K A;  3CKJ A;  5C1G A;  2XMH A;  1YP3 A;  1INI A;  2ZU7 A;  4IRQ A;  1MP3 A;  2D7R A;  1IIM A;  1R81 A;  1H5S A;  4B4M A;  1TW5 A;  4O6N A;  1V84 A;  1VGZ A;  3PNN A;  1JVG A;  4Y9X A;  4DDZ A;  4Q7C A;  5EJ1 A;  1FWY A;  3F1C A;  2AE7 A;  1G8O A;  3CU0 A;  1ZJ3 A;  1R80 A;  5FU8 A;  3F1Y A;  1H4E A;  5C38 A;  2AH9 A;  1H7L A;  5FU0 A;  1H5S D;  2RIZ A;  2Y4M A;  1ZJ1 A;  5C4F A;  2RJ0 A;  4L41 C;  1HJL A;  4EE5 A;  2FFV A;  4HO8 A;  5AJP A;  2RIY A;  4KXO A;  2D7I A;  2WGZ A;  1O23 B;  1VGW A;  1NQI B;  4EEO A;  2A8U A;  3I0J A;  5C3D A;  4KNR A;  4GBP A;  3SXA A;  3SXB A;  1LL0 A;  1W77 A;  1VZX A;  1PZT A;  1H4D A;  2FYA A;  3EE5 A;  2PX7 A;  2RJ8 A;  2GGQ A;  4AAW A;  1VIC A;  2XWN A;  4NAN A;  2WEE A;  1FOA A;  5C3B A;  1H4C A;  4KPX A;  4CJC A;  2ICY A;  3OH0 A;  3DK5 A;  5FTS A;  5IDS A;  5EIY A;  3JTJ A;  3I0L A;  2QGI A;  5CMJ A;  1GX4 A;  2AM3 A;  3OKR A;  2XME A;  3NGW A;  1YRO B;  4B4B A;  4D11 A;  1ZJ2 A;  1QG8 A;  4Y7V A;  4CJ8 A;  1LZ0 A;  2JCL A;  2J0A A;  2X5S A;  1NKH B;  4LW3 A;  2C0N A;  5DDT A;  1HJJ A;  5C4C A;  1R82 A;  5CMI A;  3OH1 A;  3SXE A;  5AJO A;  2VSH A;  4B2W A;  1FGX A;  1S4P A;  1H5S B;  1HM0 A;  5CMF X;  3OGZ A;  4KRV A;  1PZY B;  2XWL A;  4G3P A;  4UEG A;  1JVD A;  3I0E A;  1HM9 A;  5FYE A;  2AES A;  4B5B A;  4J18 A;  2O1H A;  3E26 A;  2W0W A;  5C49 A;  3HL3 A;  4FCE A;  2Q4J A;  1JV3 A;  3D98 A;  2O1G A;  1QWJ A;  4KQL A;  2YQS A;  2ICX A;  4Y7U A;  5C4E A;  2AM5 A;  2YES A;  1G23 A;  1XHB A;  2BO8 A;  1W55 A;  2FYC B;  1FO9 A;  4KC2 A;  2V0J A;  1XZ6 A;  3TZT A;  2X5Z A;  4C2S A;  3BCV A;  4HOC A;  2WVM A;  1H5S C;  4EVW A;  2V0I A;  2JCK A;  1KWS A;  1SS9 A;  3FWW A;  4B2X A;  4BQH A;  2VFZ A;  2W0V A;  3SX7 A;  1NWG B;  1ZCU A;  4MND A;  2VXM A;  3K8E A;  3ZGG A;  2RIX A;  4FRD A;  1G1L A;  5D92 A;  2I5K A;  2X60 A;  3I0F A;  4D0T A;  4B4G A;  1ZCV A;  3V0N A;  4ECM A;  1VZT A;  5CQM X;  2DPW A;  1G95 A;  1VPA A;  3ZF8 A;  3SX8 A;  1GQ9 A;  1YP2 A;  1G2V A;  1VGT A;  3SXD A;  1G0R A;  3R2W A;  5FTV A;  3OAM A;  4FIY A;  2YQC A;  2AM4 A;  1R7V A;  3SPT A;  1GX0 A;  4KT7 A;  2E8B A;  2YC5 A;  1FG5 N;  3O3P A;  3V91 A;  3D8V A;  3D5N A;  3V0M A;  3Q7U A;  1R7U A;  3SX5 A;  3I0G A;  4NAI A;  1H5T A;  4E1K A;  4XWI A;  4D48 A;  1TW1 A;  4AYL A;  2Y7A A;  4FRQ A;  4D0Z A;  4M28 A;  1R7X A;  3PKQ A;  4FRO A;  4D11 C;  1ON6 A;  1VH1 A;  1G3L A;  3CKQ A;  5C3A A;  4B3U A;  2I7B A;  1JYK A;  4G87 A;  4EE4 A;  1K4V A;  2X65 A;  1NMM B;  1ZI5 A;  1LZI A;  1FXO A;  3R3I A;  1S4O A;  1OMZ A;  4LW6 A;  1GWV A;  4HO4 A;  2RJ5 A;  3SXC A;  3U0Y A;  1H7H A;  3ZGF A;  2BO6 A;  3FOQ A;  5CQP A;  1VGU A;  2VS3 A;  4P02 A;  1ZDF A;  2CU2 A;  1H7G A;  1WT1 A;  1G97 A;  3N9W A;  4DE7 A;  4FRA A;  4HCQ A;  1FO8 A;  1ZJO A;  3ZLL A;  5C47 A;  1R7Y A;  5AJN A;  3T7N A;  1EZI A;  3V0O A;  3SX3 A;  1FXJ A;  2J0B A;  1FR9 A;  2AGD A;  2WVL A;  4Y63 A;  5DDV A;  4K6R A;  2PGY A;  4JD0 A;  3V0Q A;  2VD4 A;  1NF5 B;  2Y4L A;  3JUJ A;  3T7M A;  5C48 A;  2OEF A;  1QGQ A;  2QH5 A;  5L6S A;  2RIT A;  3RMW A;  4Y62 A;  1OQM B;  1ZI3 A;  2P73 A;  3JUK A;  4EEG A;  4EEM A;  3CKO A;  4Y6N A;  3U2W A;  3CKV A;  1G93 A;  1GA8 A;  4FRE A;  1O7O A;  2OEG A;  2YC3 A;  5EJZ A;  1TVY A;  1H3M A;  2Z87 A;  2AEC A;  4ZDQ A;  2PGV A;  3ST8 A;  3DJ4 A;  3OH3 A;  1H5T B;  3QVB A;  4Y6U A;  1FRW A;  3U0X A;  2QKX A;  2WAW A;  2V0L A;  4AC3 A;  3E25 A;  1O0R A;  1FGG A;  1ZIZ A;  2Z86 A;  4ASY A;  2P72 A;  1INJ A;  1ZHJ A;  1ZI1 A;  2UX8 A;  1O7Q A;  2OI6 A;  1H7Q A;  1ZI4 A;  2VK9 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...