3IOJA

Crystal structure of the fucosylgalactoside alpha n-acetylgalactosaminyltransferase (gta, cisab mutant l266g, g268a) in complex with udp
Total Genus 94
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
94
sequence length
284
structure length
284
Chain Sequence
MVSLPRMVYPQPKVLTPCRKDVLVVTPWLAPIVWEGTFNIDILNEQFRLQNTTIGLTVFAIKKYVAFLKLFLETAEKHFMVGHRVHYYVFTDQPAAVPRVTLGTGRQLSVLEVRAYKRWQDVSMRRMEMISDFCERRFLSEVDYLVCVDVDMEFRDHVGVEILTPLFGTLHPGFYGSSREAFTYERRPQSQAYIPKDEGDFYYGGAFFGGSVQEVQRLTRACHQAMMVDQANGIEAVWHDESHLNKYLLRHKPTKVLSPEYLWDQQLLGWPAVLRKLRFTAVPK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords Histo-blood group ABO system transferase
publication title Structural and mechanistic basis for a new mode of glycosyltransferase inhibition.
pubmed doi rcsb
source organism Homo sapiens
total genus 94
structure length 284
sequence length 284
chains with identical sequence B
ec nomenclature ec 2.4.1.37: Fucosylgalactoside 3-alpha-galactosyltransferase.
pdb deposition date 2009-08-14
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.550.10 Alpha Beta Alpha-Beta Complex Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A 3iojA00
3PKQA 3I0KA 1FOAA 5C4CA 3CKVA 4NALA 4G87A 1FR8A 1R7TA 1ZDFA 4KXOA 1INIA 5CQOA 1WSZA 2NXVA 3SXEA 4B3UA 4M28A 3SX7A 2VSHA 1ZHJA 4FRDA 3SXAA 2D0JA 1H7TA 4KRVA 1LL3A 2GGQA 3U0YA 1OMXA 4IRQA 2V0JA 1TVYA 2XMHA 3K8EA 2OEFA 1R7VA 2VS4A 2E3DA 5C3DA 2W0VA 2JCLA 3V91A 3SX8A 4AC3A 2Y4MA 5C1LA 3USRA 2YCMA 1H5TB 2D7RA 4FRLA 4EVWA 1R80A 4HG6A 1PZYB 4G3SA 1NMMB 3R2WA 3USQA 1EZIA 1MP5A 1W55A 1XHBA 3BRKX 3CGXA 4KPXA 1G23A 3SXBA 4FRQA 1FXOA 1FWYA 1MP3A 2YESA 1OMZA 4YS8A 3CKQA 1H7HA 3I0FA 3U2XA 1ZI4A 1ZJ0A 3PKPA 3V0PA 4HO3A 4FRBA 2Y4LA 2OI6A 1PZTA 1ZJPA 3E25A 4KNXA 3OC9A 2JCKA 2A8UA 3OH2A 3FWWA 4HO5A 4AYJA 2OI5A 4CJCA 4M4KA 4Y7VA 1VICA 4FQWA 3SXDA 2X5SA 1XZ6A 3DJ4A 3V90A 3SX5A 4EEAA 1ZIZA 3I0JA 1R81A 3F1YA 1LL0A 3U2UA 4ARWA 2FFVA 1H3MA 1VGZA 5FV9A 2V0LA 3IOHA 4P00A 3SX3A 3D8VA 5C49A 2P72A 1FZWA 1MC3A 1VH1A 5FYEA 5C4BA 3OH1A 4ZDQA 2VS5A 3CKOA 1R7XA 2FFUA 2O1GA 3NGWA 1H5SB 1R7UA 4JD0A 5DDVA 5CMJA 4Y63A 3D5NA 4G3PA 1YP4A 2I5KA 3V0LA 2W0WA 1ZI5A 2XMEA 4MYBA 1JVDA 2ICXA 3CKNA 1S4OA 2O1FA 4D11A 1IINA 2PX7A 2RJ5A 3V0OA 2FYCB 4DDZA 3T7MA 2RIXA 4EEGA 4D11C 1H5RB 5BXCA 1YP3A 3OH3A 1WVCA 2WE9A 1ZI1A 4Y7TA 3RMVA 4KC1A 1V83A 3OAMA 4DECA 2RIZA 1JV1A 4Y7GA 2X5ZA 5IFYA 5IDTA 3I0HA 1S4PA 3RSBA 2BO8A 1KWSA 2APCA 1LL2A 5CQPA 5CMGX 3ST8A 1G8OA 4M2BA 1WT2A 1FGXA 2AE7A 2PGYA 1H7GA 1G3LA 1ZJOA 1I52A 2AESA 1GQ9A 2FYAA 3JTJA 5CQNX 1LZIA 5AJNA 2YQHA 2ICYA 2PGVA 5C1GA 2P6WA 1V82A 4D0TA 4KPZA 2RJ9A 4LW3A 2O1HA 2AM5A 1O23B 5J49A 3V0NA 2WVLA 1ZJ1A 4KT7A 1FXJA 3V8ZA 1H5SC 3OH4A 4LW6A 2QGIA 4R7PA 4MNDA 5FUHA 4CJBA 3U2WA 1FR9A 1JVGA 2Z87A 1S4NA 5CMIA 1IIMA 2OEGA 4K6RA 3SPTA 3N9WA 3TZTA 5C8RA 3E26A 1NHEB 1ZCYA 4HO9A 3DK5A 1W57A 3GUEA 1H7FA 4G3QA 1G2VA 5CQMX 1O7QA 4D48A 2Y7AA 3I0GA 1WT1A 1OQMB 5C3AA 1K4VA 4FRPA 3OKRA 1H4DA 5CMHA 4KC4A 3Q80A 4HO6A 3DUVA 2FYBA 3Q7UA 2ZU8A 1LZ0A 3CU0A 4JISA 2JCJA 2GGOA 2BO7A 4Y7UA 5C48A 4NAKA 1YP2A 4HCQA 2XWMA 3K8DA 4KC2A 2PA4A 1HJLA 2Y4KA 1ZJ3A 5C47A 3FOQA 3HL3A 3U0XA 2RJ4A 1Z90A 4M2AA 1G9RA 4FCEA 2Q4JA 1V84A 1H5TA 2V0KA 4GBPA 3I0DA 4Y6NA 1FO9A 2I7BA 1TW1A 5C3BA 2RJ6A 1VGWA 1JYKA 2DPWA 1H7QA 3TQDA 1G97A 3OH0A 2FYDB 2VFZA 2WVMA 2I5EA 1EYRA 4FROA 3T7OA 1QGSA 4CVHA 5C4FA 3LW6A 5CMFX 4Y9XA 2A8WA 4HOCA 1H5SD 4B2XA 1QGQA 4B4MA 2AM3A 4KNRA 4HO4A 3ZGFA 1HV9A 1FG5N 1NKHB 1HJJA 1VH3A 1G1LA 3SXGA 4B42A 2RJ8A 5FTVA 4ASJA 2RJ1A 4EE4A 3R3IA 5FTSA 2UX8A 1R7YA 5L6VA 1GQCA 5L6SA 1E5KA 1LVWA 2WGZA 5IDSA 1ZJ2A 2QH5A 2RJ0A 4L41C 1SS9A 4B2WA 1G93A 1JYLA 4BQHA 4ECMA 3F1CA 2AGDA 1FGGA 1VGUA 4P02A 2YQCA 3ZF8A 3RMWA 4ASYA 4J18A 1HM9A 3V8YA 1MP4A 1QWJA 2VS3A 2V0HA 4FRHA 1NQIB 5C4EA 1H5SA 1LZJA 5EIYA 5I1FA 1H7LA 3OGZA 4Y6UA 3SXCA 4AAWA 1FO8A 1YROB 5JQQA 4IRPA 3JUJA 4EEMA 1GA8A 3IOIA 3JUKA 1TZFA 2AECA 2Z86A 2RJ7A 4FRAA 1O7OA 1HM0A 2ZU7A 1H4EA 5CQLX 3V0QA 1H5RA 4Y64A 4Y7FA 2AH9A 1GWWA 2X65A 3QVBA 2WAWA 3PNNA 4Y62A 2RITA 2VXLA 2MZBA 2Y4JA 5AJPA 1H7EA 5EJ1A 3CKJA 2D7IA 4B4GA 3T7NA 2BO4A 2WVKA 4HO0A 1GX0A 2XWLA 1WT0A 2XWNA 4FREA 2YC3A 1H4CA 3I0CA 2YQJA 2QKXA 4B4BA 3I0IX 2FY7A 4HO2A 3D98A 2AM4A 2VXMA 1ZI3A 1VPAA 5FU8A 3U2TA 1ZCUA 3ZLLA 5FU0A 1GWVA 3ZLKA 5C36A 3I0EA 2WEEA 1ZCVA 4FRMA 2VSIA 3IOJA 1ON6A 1VM8A 4HO8A 2JCOA 2Y6PA 1HM8A 4FCUA 4EEOA 2P73A 3KIAA 3Q4SA 1LZ7A 4DE7A 2YQSA 3I0LA 1G0RA 3O3PA 1VZUA 2X60A 1WT3A 3V0MA 4NANA 1ON8A 5HS2A 5C1HA 4EE5A 1ZDGA 2YC5A 3U2VA 4UEGA 5C4DA 2VD4A 4NAIA 1JV3A 1FRWA 2CU2A 4AYLA 1ZCTA 4KQLA 5EJZA 1VGTA 1GX4A 4BMAA 4C2SA 2E8BA 4XWIA 5C38A 4D0ZA 1VZXA 5AJOA 4CJ8A 3POLA 1NWGB 2RIYA 2OI7A 2BO6A 1VZTA 4B5BA 4E1KA 1TW5A 3EE5A 1INJA 1QG8A 2ZU9A 1O0RA 1R82A 4EE3A 5DDTA 1W77A 3ZGGA 1G95A 1NF5B 2V0IA 3BCVA
chains in the Genus database with same CATH superfamily
3PKQA 3I0KA 1FOAA 5C4CA 3CKVA 4NALA 4G87A 1FR8A 1R7TA 1ZDFA 4KXOA 1INIA 5CQOA 1WSZA 2NXVA 3SXEA 4B3UA 4M28A 3SX7A 2VSHA 1ZHJA 4FRDA 3SXAA 2D0JA 1H7TA 4KRVA 1LL3A 2GGQA 3U0YA 1OMXA 4IRQA 2V0JA 1TVYA 2XMHA 3K8EA 2OEFA 1R7VA 2VS4A 2E3DA 5C3DA 2W0VA 2JCLA 3V91A 3SX8A 4AC3A 2Y4MA 5C1LA 3USRA 2YCMA 1H5TB 2D7RA 4FRLA 4EVWA 1R80A 4HG6A 1PZYB 4G3SA 1NMMB 3R2WA 3USQA 1EZIA 1MP5A 1W55A 1XHBA 3BRKX 3CGXA 4KPXA 1G23A 3SXBA 4FRQA 1FXOA 1FWYA 1MP3A 2YESA 1OMZA 4YS8A 3CKQA 1H7HA 3I0FA 3U2XA 1ZI4A 1ZJ0A 3PKPA 3V0PA 4HO3A 4FRBA 2Y4LA 2OI6A 1PZTA 1ZJPA 3E25A 4KNXA 3OC9A 2C0NA 2JCKA 2A8UA 3OH2A 3FWWA 4HO5A 4AYJA 2OI5A 4CJCA 4M4KA 4Y7VA 1VICA 4FQWA 3SXDA 2X5SA 1XZ6A 3DJ4A 3V90A 3SX5A 4EEAA 1ZIZA 3I0JA 1R81A 3F1YA 1LL0A 3U2UA 4ARWA 2FFVA 1H3MA 1VGZA 5FV9A 2V0LA 3IOHA 4P00A 3SX3A 3D8VA 5C49A 2P72A 1FZWA 1MC3A 1VH1A 5FYEA 5C4BA 3OH1A 4ZDQA 2VS5A 3CKOA 1R7XA 2FFUA 2O1GA 3NGWA 1H5SB 1R7UA 4JD0A 5DDVA 5CMJA 4Y63A 3D5NA 4G3PA 1YP4A 2I5KA 3V0LA 2W0WA 1ZI5A 2XMEA 4MYBA 1JVDA 2ICXA 3CKNA 1S4OA 2O1FA 4D11A 1IINA 2PX7A 2RJ5A 5D92A 3V0OA 2FYCB 4DDZA 3T7MA 2RIXA 4EEGA 4D11C 1H5RB 5BXCA 1YP3A 3OH3A 1WVCA 2WE9A 1ZI1A 4FIYA 4Y7TA 3RMVA 4KC1A 1V83A 3OAMA 4DECA 2RIZA 1JV1A 4Y7GA 2X5ZA 5IFYA 5IDTA 3I0HA 1S4PA 3RSBA 2BO8A 1KWSA 2APCA 1LL2A 5CQPA 5CMGX 3ST8A 1G8OA 4M2BA 1WT2A 1FGXA 2AE7A 2PGYA 1H7GA 1G3LA 1ZJOA 1I52A 2AESA 1GQ9A 2FYAA 3JTJA 5CQNX 1LZIA 5AJNA 2YQHA 2ICYA 2PGVA 5C1GA 2P6WA 2J0AA 1V82A 4Q7CA 4D0TA 4KPZA 2RJ9A 4LW3A 2O1HA 2AM5A 2VK9A 1O23B 5J49A 3V0NA 2WVLA 1ZJ1A 4KT7A 1FXJA 3V8ZA 1H5SC 3OH4A 4LW6A 2QGIA 4R7PA 4MNDA 5FUHA 4CJBA 3U2WA 1FR9A 1JVGA 2Z87A 1S4NA 5CMIA 1IIMA 2OEGA 4K6RA 3SPTA 3N9WA 3TZTA 2J0BA 5C8RA 3E26A 1NHEB 1ZCYA 4HO9A 3DK5A 1W57A 3GUEA 1H7FA 4G3QA 1G2VA 5CQMX 1O7QA 4D48A 2Y7AA 3I0GA 1WT1A 1OQMB 5C3AA 1K4VA 4FRPA 3OKRA 1H4DA 5CMHA 4MIXA 4KC4A 3Q80A 4HO6A 3DUVA 2FYBA 3Q7UA 2ZU8A 1LZ0A 3CU0A 4JISA 2JCJA 2GGOA 2BO7A 4Y7UA 5C48A 4NAKA 1YP2A 4HCQA 2XWMA 3K8DA 4KC2A 2PA4A 1HJLA 2Y4KA 1ZJ3A 5C47A 3FOQA 3HL3A 3U0XA 2RJ4A 1Z90A 4M2AA 1G9RA 4FCEA 2Q4JA 1V84A 1H5TA 2V0KA 4GBPA 3I0DA 4Y6NA 1FO9A 2I7BA 1TW1A 5C3BA 2RJ6A 1VGWA 1JYKA 2DPWA 4O6NA 1H7QA 3TQDA 1G97A 3OH0A 2FYDB 2VFZA 2WVMA 2I5EA 1EYRA 4FROA 3T7OA 1QGSA 4CVHA 5C4FA 3LW6A 5CMFX 4Y9XA 2A8WA 4HOCA 1H5SD 4B2XA 1QGQA 4B4MA 2AM3A 4KNRA 4HO4A 3ZGFA 1HV9A 1FG5N 1NKHB 1HJJA 1VH3A 1G1LA 3SXGA 4B42A 2RJ8A 5FTVA 4ASJA 2RJ1A 4EE4A 3R3IA 5FTSA 2UX8A 1R7YA 5L6VA 1GQCA 5L6SA 1E5KA 1LVWA 2WGZA 5IDSA 1ZJ2A 2QH5A 2RJ0A 4L41C 1SS9A 4B2WA 1G93A 1JYLA 4BQHA 4ECMA 3F1CA 2AGDA 1FGGA 1VGUA 4P02A 2YQCA 3ZF8A 3RMWA 4ASYA 4J18A 1HM9A 3V8YA 1MP4A 1QWJA 2VS3A 2V0HA 4FRHA 1NQIB 5C4EA 1H5SA 1LZJA 5EIYA 5I1FA 1H7LA 3OGZA 4Y6UA 3SXCA 5D91A 4AAWA 1FO8A 1YROB 5JQQA 4IRPA 3JUJA 4EEMA 1GA8A 3IOIA 3JUKA 1TZFA 2AECA 2Z86A 2RJ7A 4FRAA 1O7OA 1HM0A 2ZU7A 1H4EA 5CQLX 3V0QA 1H5RA 4Y64A 4Y7FA 2AH9A 1GWWA 2X65A 3QVBA 2WAWA 3PNNA 4Y62A 2RITA 2VXLA 2MZBA 2Y4JA 5AJPA 1H7EA 5EJ1A 3CKJA 4O6MA 2D7IA 4B4GA 3T7NA 2BO4A 2WVKA 4HO0A 1GX0A 2XWLA 1WT0A 2XWNA 4FREA 2YC3A 1H4CA 3I0CA 2YQJA 2QKXA 4B4BA 3I0IX 2FY7A 4HO2A 3D98A 2AM4A 2VXMA 1ZI3A 1VPAA 5FU8A 3U2TA 1ZCUA 4FIXA 3ZLLA 5FU0A 1GWVA 3ZLKA 5C36A 3I0EA 2WEEA 1ZCVA 4FRMA 2VSIA 3IOJA 1ON6A 1VM8A 4HO8A 2JCOA 2Y6PA 1HM8A 4FCUA 4EEOA 2P73A 3KIAA 3Q4SA 1LZ7A 4DE7A 2YQSA 3I0LA 1G0RA 3O3PA 1VZUA 2X60A 1WT3A 3V0MA 4NANA 1ON8A 5HS2A 5C1HA 4EE5A 1ZDGA 2YC5A 3U2VA 4UEGA 5C4DA 2VD4A 4NAIA 1JV3A 1FRWA 2CU2A 4AYLA 1ZCTA 4KQLA 5EJZA 1VGTA 1GX4A 4BMAA 4C2SA 2E8BA 4XWIA 5C38A 4D0ZA 1VZXA 5AJOA 4CJ8A 3POLA 1NWGB 2RIYA 2OI7A 2BO6A 1VZTA 4B5BA 4E1KA 1TW5A 3EE5A 1INJA 1QG8A 2ZU9A 1O0RA 1R82A 4EE3A 5DDTA 1W77A 3ZGGA 1G95A 1NF5B 2V0IA 3BCVA
chains in the Genus database with same CATH topology
3PKQA 3I0KA 1FOAA 5C4CA 3CKVA 4NALA 4G87A 1FR8A 1R7TA 1ZDFA 4KXOA 1INIA 5CQOA 1WSZA 2NXVA 3SXEA 4B3UA 4M28A 3SX7A 2VSHA 1ZHJA 4FRDA 3SXAA 2D0JA 1H7TA 4KRVA 1LL3A 2GGQA 3U0YA 1OMXA 4IRQA 2V0JA 1TVYA 2XMHA 3K8EA 2OEFA 1R7VA 2VS4A 2E3DA 5C3DA 2W0VA 2JCLA 3V91A 3SX8A 4AC3A 2Y4MA 5C1LA 3USRA 2YCMA 1H5TB 2D7RA 4FRLA 4EVWA 1R80A 4HG6A 1PZYB 4G3SA 1NMMB 3R2WA 3USQA 1EZIA 1MP5A 1W55A 1XHBA 3BRKX 3CGXA 4KPXA 1G23A 3SXBA 4FRQA 1FXOA 1FWYA 1MP3A 2YESA 1OMZA 4YS8A 3CKQA 1H7HA 3I0FA 3U2XA 1ZI4A 1ZJ0A 3PKPA 3V0PA 4HO3A 4FRBA 2Y4LA 2OI6A 1PZTA 1ZJPA 3E25A 4KNXA 3OC9A 2C0NA 2JCKA 2A8UA 3OH2A 3FWWA 4HO5A 4AYJA 2OI5A 4CJCA 4M4KA 4Y7VA 1VICA 4FQWA 3SXDA 2X5SA 1XZ6A 3DJ4A 3V90A 3SX5A 4EEAA 1ZIZA 3I0JA 1R81A 3F1YA 1LL0A 3U2UA 4ARWA 2FFVA 1H3MA 1VGZA 5FV9A 2V0LA 3IOHA 4P00A 3SX3A 3D8VA 5C49A 2P72A 1FZWA 1MC3A 1VH1A 5FYEA 5C4BA 3OH1A 4ZDQA 2VS5A 3CKOA 1R7XA 2FFUA 2O1GA 3NGWA 1H5SB 1R7UA 4JD0A 5DDVA 5CMJA 4Y63A 3D5NA 4G3PA 1YP4A 2I5KA 3V0LA 2W0WA 1ZI5A 2XMEA 4MYBA 1JVDA 2ICXA 3CKNA 1S4OA 2O1FA 4D11A 1IINA 2PX7A 2RJ5A 5D92A 3V0OA 2FYCB 4DDZA 3T7MA 2RIXA 4EEGA 4D11C 1H5RB 5BXCA 1YP3A 3OH3A 1WVCA 2WE9A 1ZI1A 4FIYA 4Y7TA 3RMVA 4KC1A 1V83A 3OAMA 4DECA 2RIZA 1JV1A 4Y7GA 2X5ZA 5IFYA 5IDTA 3I0HA 1S4PA 3RSBA 2BO8A 1KWSA 2APCA 1LL2A 5CQPA 5CMGX 3ST8A 1G8OA 4M2BA 1WT2A 1FGXA 2AE7A 2PGYA 1H7GA 1G3LA 1ZJOA 1I52A 2AESA 1GQ9A 2FYAA 3JTJA 5CQNX 1LZIA 5AJNA 2YQHA 2ICYA 2PGVA 5C1GA 2P6WA 2J0AA 1V82A 4Q7CA 4D0TA 4KPZA 2RJ9A 4LW3A 2O1HA 2AM5A 2VK9A 1O23B 5J49A 3V0NA 2WVLA 1ZJ1A 4KT7A 1FXJA 3V8ZA 1H5SC 3OH4A 4LW6A 2QGIA 4R7PA 4MNDA 5FUHA 4CJBA 3U2WA 1FR9A 1JVGA 2Z87A 1S4NA 5CMIA 1IIMA 2OEGA 4K6RA 3SPTA 3N9WA 3TZTA 2J0BA 5C8RA 3E26A 1NHEB 1ZCYA 4HO9A 3DK5A 1W57A 3GUEA 1H7FA 4G3QA 1G2VA 5CQMX 1O7QA 4D48A 2Y7AA 3I0GA 1WT1A 1OQMB 5C3AA 1K4VA 4FRPA 3OKRA 1H4DA 5CMHA 4MIXA 4KC4A 3Q80A 4HO6A 3DUVA 2FYBA 3Q7UA 2ZU8A 1LZ0A 3CU0A 4JISA 2JCJA 2GGOA 2BO7A 4Y7UA 5C48A 4NAKA 1YP2A 4HCQA 2XWMA 3K8DA 4KC2A 2PA4A 1HJLA 2Y4KA 1ZJ3A 5C47A 3FOQA 3HL3A 3U0XA 2RJ4A 1Z90A 4M2AA 1G9RA 4FCEA 2Q4JA 1V84A 1H5TA 2V0KA 4GBPA 3I0DA 4Y6NA 1FO9A 2I7BA 1TW1A 5C3BA 2RJ6A 1VGWA 1JYKA 2DPWA 4O6NA 1H7QA 3TQDA 1G97A 3OH0A 2FYDB 2VFZA 2WVMA 2I5EA 1EYRA 4FROA 3T7OA 1QGSA 4CVHA 5C4FA 3LW6A 5CMFX 4Y9XA 2A8WA 4HOCA 1H5SD 4B2XA 1QGQA 4B4MA 2AM3A 4KNRA 4HO4A 3ZGFA 1HV9A 1FG5N 1NKHB 1HJJA 1VH3A 1G1LA 3SXGA 4B42A 2RJ8A 5FTVA 4ASJA 2RJ1A 4EE4A 3R3IA 5FTSA 2UX8A 1R7YA 5L6VA 1GQCA 5L6SA 1E5KA 1LVWA 2WGZA 5IDSA 1ZJ2A 2QH5A 2RJ0A 4L41C 1SS9A 4B2WA 1G93A 1JYLA 4BQHA 4ECMA 3F1CA 2AGDA 1FGGA 1VGUA 4P02A 2YQCA 3ZF8A 3RMWA 4ASYA 4J18A 1HM9A 3V8YA 1MP4A 1QWJA 2VS3A 2V0HA 4FRHA 1NQIB 5C4EA 1H5SA 1LZJA 5EIYA 5I1FA 1H7LA 3OGZA 4Y6UA 3SXCA 5D91A 4AAWA 1FO8A 1YROB 5JQQA 4IRPA 3JUJA 4EEMA 1GA8A 3IOIA 3JUKA 1TZFA 2AECA 2Z86A 2RJ7A 4FRAA 1O7OA 1HM0A 2ZU7A 1H4EA 5CQLX 3V0QA 1H5RA 4Y64A 4Y7FA 2AH9A 1GWWA 2X65A 3QVBA 2WAWA 3PNNA 4Y62A 2RITA 2VXLA 2MZBA 2Y4JA 5AJPA 1H7EA 5EJ1A 3CKJA 4O6MA 2D7IA 4B4GA 3T7NA 2BO4A 2WVKA 4HO0A 1GX0A 2XWLA 1WT0A 2XWNA 4FREA 2YC3A 1H4CA 3I0CA 2YQJA 2QKXA 4B4BA 3I0IX 2FY7A 4HO2A 3D98A 2AM4A 2VXMA 1ZI3A 1VPAA 5FU8A 3U2TA 1ZCUA 4FIXA 3ZLLA 5FU0A 1GWVA 3ZLKA 5C36A 3I0EA 2WEEA 1ZCVA 4FRMA 2VSIA 3IOJA 1ON6A 1VM8A 4HO8A 2JCOA 2Y6PA 1HM8A 4FCUA 4EEOA 2P73A 3KIAA 3Q4SA 1LZ7A 4DE7A 2YQSA 3I0LA 1G0RA 3O3PA 1VZUA 2X60A 1WT3A 3V0MA 4NANA 1ON8A 5HS2A 5C1HA 4EE5A 1ZDGA 2YC5A 3U2VA 4UEGA 5C4DA 2VD4A 4NAIA 1JV3A 1FRWA 2CU2A 4AYLA 1ZCTA 4KQLA 5EJZA 1VGTA 1GX4A 4BMAA 4C2SA 2E8BA 4XWIA 5C38A 4D0ZA 1VZXA 5AJOA 4CJ8A 3POLA 1NWGB 2RIYA 2OI7A 2BO6A 1VZTA 4B5BA 4E1KA 1TW5A 3EE5A 1INJA 1QG8A 2ZU9A 1O0RA 1R82A 4EE3A 5DDTA 1W77A 3ZGGA 1G95A 1NF5B 2V0IA 3BCVA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3PKQ A;  3I0K A;  1FOA A;  5C4C A;  3CKV A;  4NAL A;  4G87 A;  1FR8 A;  1R7T A;  1ZDF A;  4KXO A;  1INI A;  5CQO A;  1WSZ A;  2NXV A;  3SXE A;  4B3U A;  4M28 A;  3SX7 A;  2VSH A;  1ZHJ A;  4FRD A;  3SXA A;  2D0J A;  1H7T A;  4KRV A;  1LL3 A;  2GGQ A;  3U0Y A;  1OMX A;  4IRQ A;  2V0J A;  1TVY A;  2XMH A;  3K8E A;  2OEF A;  1R7V A;  2VS4 A;  2E3D A;  5C3D A;  2W0V A;  2JCL A;  3V91 A;  3SX8 A;  4AC3 A;  2Y4M A;  5C1L A;  3USR A;  2YCM A;  1H5T B;  2D7R A;  4FRL A;  4EVW A;  1R80 A;  4HG6 A;  1PZY B;  4G3S A;  1NMM B;  3R2W A;  3USQ A;  1EZI A;  1MP5 A;  1W55 A;  1XHB A;  3BRK X;  3CGX A;  4KPX A;  1G23 A;  3SXB A;  4FRQ A;  1FXO A;  1FWY A;  1MP3 A;  2YES A;  1OMZ A;  4YS8 A;  3CKQ A;  1H7H A;  3I0F A;  3U2X A;  1ZI4 A;  1ZJ0 A;  3PKP A;  3V0P A;  4HO3 A;  4FRB A;  2Y4L A;  2OI6 A;  1PZT A;  1ZJP A;  3E25 A;  4KNX A;  3OC9 A;  2JCK A;  2A8U A;  3OH2 A;  3FWW A;  4HO5 A;  4AYJ A;  2OI5 A;  4CJC A;  4M4K A;  4Y7V A;  1VIC A;  4FQW A;  3SXD A;  2X5S A;  1XZ6 A;  3DJ4 A;  3V90 A;  3SX5 A;  4EEA A;  1ZIZ A;  3I0J A;  1R81 A;  3F1Y A;  1LL0 A;  3U2U A;  4ARW A;  2FFV A;  1H3M A;  1VGZ A;  5FV9 A;  2V0L A;  3IOH A;  4P00 A;  3SX3 A;  3D8V A;  5C49 A;  2P72 A;  1FZW A;  1MC3 A;  1VH1 A;  5FYE A;  5C4B A;  3OH1 A;  4ZDQ A;  2VS5 A;  3CKO A;  1R7X A;  2FFU A;  2O1G A;  3NGW A;  1H5S B;  1R7U A;  4JD0 A;  5DDV A;  5CMJ A;  4Y63 A;  3D5N A;  4G3P A;  1YP4 A;  2I5K A;  3V0L A;  2W0W A;  1ZI5 A;  2XME A;  4MYB A;  1JVD A;  2ICX A;  3CKN A;  1S4O A;  2O1F A;  4D11 A;  1IIN A;  2PX7 A;  2RJ5 A;  3V0O A;  2FYC B;  4DDZ A;  3T7M A;  2RIX A;  4EEG A;  4D11 C;  1H5R B;  5BXC A;  1YP3 A;  3OH3 A;  1WVC A;  2WE9 A;  1ZI1 A;  4Y7T A;  3RMV A;  4KC1 A;  1V83 A;  3OAM A;  4DEC A;  2RIZ A;  1JV1 A;  4Y7G A;  2X5Z A;  5IFY A;  5IDT A;  3I0H A;  1S4P A;  3RSB A;  2BO8 A;  1KWS A;  2APC A;  1LL2 A;  5CQP A;  5CMG X;  3ST8 A;  1G8O A;  4M2B A;  1WT2 A;  1FGX A;  2AE7 A;  2PGY A;  1H7G A;  1G3L A;  1ZJO A;  1I52 A;  2AES A;  1GQ9 A;  2FYA A;  3JTJ A;  5CQN X;  1LZI A;  5AJN A;  2YQH A;  2ICY A;  2PGV A;  5C1G A;  2P6W A;  1V82 A;  4D0T A;  4KPZ A;  2RJ9 A;  4LW3 A;  2O1H A;  2AM5 A;  1O23 B;  5J49 A;  3V0N A;  2WVL A;  1ZJ1 A;  4KT7 A;  1FXJ A;  3V8Z A;  1H5S C;  3OH4 A;  4LW6 A;  2QGI A;  4R7P A;  4MND A;  5FUH A;  4CJB A;  3U2W A;  1FR9 A;  1JVG A;  2Z87 A;  1S4N A;  5CMI A;  1IIM A;  2OEG A;  4K6R A;  3SPT A;  3N9W A;  3TZT A;  5C8R A;  3E26 A;  1NHE B;  1ZCY A;  4HO9 A;  3DK5 A;  1W57 A;  3GUE A;  1H7F A;  4G3Q A;  1G2V A;  5CQM X;  1O7Q A;  4D48 A;  2Y7A A;  3I0G A;  1WT1 A;  1OQM B;  5C3A A;  1K4V A;  4FRP A;  3OKR A;  1H4D A;  5CMH A;  4KC4 A;  3Q80 A;  4HO6 A;  3DUV A;  2FYB A;  3Q7U A;  2ZU8 A;  1LZ0 A;  3CU0 A;  4JIS A;  2JCJ A;  2GGO A;  2BO7 A;  4Y7U A;  5C48 A;  4NAK A;  1YP2 A;  4HCQ A;  2XWM A;  3K8D A;  4KC2 A;  2PA4 A;  1HJL A;  2Y4K A;  1ZJ3 A;  5C47 A;  3FOQ A;  3HL3 A;  3U0X A;  2RJ4 A;  1Z90 A;  4M2A A;  1G9R A;  4FCE A;  2Q4J A;  1V84 A;  1H5T A;  2V0K A;  4GBP A;  3I0D A;  4Y6N A;  1FO9 A;  2I7B A;  1TW1 A;  5C3B A;  2RJ6 A;  1VGW A;  1JYK A;  2DPW A;  1H7Q A;  3TQD A;  1G97 A;  3OH0 A;  2FYD B;  2VFZ A;  2WVM A;  2I5E A;  1EYR A;  4FRO A;  3T7O A;  1QGS A;  4CVH A;  5C4F A;  3LW6 A;  5CMF X;  4Y9X A;  2A8W A;  4HOC A;  1H5S D;  4B2X A;  1QGQ A;  4B4M A;  2AM3 A;  4KNR A;  4HO4 A;  3ZGF A;  1HV9 A;  1FG5 N;  1NKH B;  1HJJ A;  1VH3 A;  1G1L A;  3SXG A;  4B42 A;  2RJ8 A;  5FTV A;  4ASJ A;  2RJ1 A;  4EE4 A;  3R3I A;  5FTS A;  2UX8 A;  1R7Y A;  5L6V A;  1GQC A;  5L6S A;  1E5K A;  1LVW A;  2WGZ A;  5IDS A;  1ZJ2 A;  2QH5 A;  2RJ0 A;  4L41 C;  1SS9 A;  4B2W A;  1G93 A;  1JYL A;  4BQH A;  4ECM A;  3F1C A;  2AGD A;  1FGG A;  1VGU A;  4P02 A;  2YQC A;  3ZF8 A;  3RMW A;  4ASY A;  4J18 A;  1HM9 A;  3V8Y A;  1MP4 A;  1QWJ A;  2VS3 A;  2V0H A;  4FRH A;  1NQI B;  5C4E A;  1H5S A;  1LZJ A;  5EIY A;  5I1F A;  1H7L A;  3OGZ A;  4Y6U A;  3SXC A;  4AAW A;  1FO8 A;  1YRO B;  5JQQ A;  4IRP A;  3JUJ A;  4EEM A;  1GA8 A;  3IOI A;  3JUK A;  1TZF A;  2AEC A;  2Z86 A;  2RJ7 A;  4FRA A;  1O7O A;  1HM0 A;  2ZU7 A;  1H4E A;  5CQL X;  3V0Q A;  1H5R A;  4Y64 A;  4Y7F A;  2AH9 A;  1GWW A;  2X65 A;  3QVB A;  2WAW A;  3PNN A;  4Y62 A;  2RIT A;  2VXL A;  2MZB A;  2Y4J A;  5AJP A;  1H7E A;  5EJ1 A;  3CKJ A;  2D7I A;  4B4G A;  3T7N A;  2BO4 A;  2WVK A;  4HO0 A;  1GX0 A;  2XWL A;  1WT0 A;  2XWN A;  4FRE A;  2YC3 A;  1H4C A;  3I0C A;  2YQJ A;  2QKX A;  4B4B A;  3I0I X;  2FY7 A;  4HO2 A;  3D98 A;  2AM4 A;  2VXM A;  1ZI3 A;  1VPA A;  5FU8 A;  3U2T A;  1ZCU A;  3ZLL A;  5FU0 A;  1GWV A;  3ZLK A;  5C36 A;  3I0E A;  2WEE A;  1ZCV A;  4FRM A;  2VSI A;  3IOJ A;  1ON6 A;  1VM8 A;  4HO8 A;  2JCO A;  2Y6P A;  1HM8 A;  4FCU A;  4EEO A;  2P73 A;  3KIA A;  3Q4S A;  1LZ7 A;  4DE7 A;  2YQS A;  3I0L A;  1G0R A;  3O3P A;  1VZU A;  2X60 A;  1WT3 A;  3V0M A;  4NAN A;  1ON8 A;  5HS2 A;  5C1H A;  4EE5 A;  1ZDG A;  2YC5 A;  3U2V A;  4UEG A;  5C4D A;  2VD4 A;  4NAI A;  1JV3 A;  1FRW A;  2CU2 A;  4AYL A;  1ZCT A;  4KQL A;  5EJZ A;  1VGT A;  1GX4 A;  4BMA A;  4C2S A;  2E8B A;  4XWI A;  5C38 A;  4D0Z A;  1VZX A;  5AJO A;  4CJ8 A;  3POL A;  1NWG B;  2RIY A;  2OI7 A;  2BO6 A;  1VZT A;  4B5B A;  4E1K A;  1TW5 A;  3EE5 A;  1INJ A;  1QG8 A;  2ZU9 A;  1O0R A;  1R82 A;  4EE3 A;  5DDT A;  1W77 A;  3ZGG A;  1G95 A;  1NF5 B;  2V0I A;  3BCV A; 
#chains in the Genus database with same CATH topology
 3PKQ A;  3I0K A;  1FOA A;  5C4C A;  3CKV A;  4NAL A;  4G87 A;  1FR8 A;  1R7T A;  1ZDF A;  4KXO A;  1INI A;  5CQO A;  1WSZ A;  2NXV A;  3SXE A;  4B3U A;  4M28 A;  3SX7 A;  2VSH A;  1ZHJ A;  4FRD A;  3SXA A;  2D0J A;  1H7T A;  4KRV A;  1LL3 A;  2GGQ A;  3U0Y A;  1OMX A;  4IRQ A;  2V0J A;  1TVY A;  2XMH A;  3K8E A;  2OEF A;  1R7V A;  2VS4 A;  2E3D A;  5C3D A;  2W0V A;  2JCL A;  3V91 A;  3SX8 A;  4AC3 A;  2Y4M A;  5C1L A;  3USR A;  2YCM A;  1H5T B;  2D7R A;  4FRL A;  4EVW A;  1R80 A;  4HG6 A;  1PZY B;  4G3S A;  1NMM B;  3R2W A;  3USQ A;  1EZI A;  1MP5 A;  1W55 A;  1XHB A;  3BRK X;  3CGX A;  4KPX A;  1G23 A;  3SXB A;  4FRQ A;  1FXO A;  1FWY A;  1MP3 A;  2YES A;  1OMZ A;  4YS8 A;  3CKQ A;  1H7H A;  3I0F A;  3U2X A;  1ZI4 A;  1ZJ0 A;  3PKP A;  3V0P A;  4HO3 A;  4FRB A;  2Y4L A;  2OI6 A;  1PZT A;  1ZJP A;  3E25 A;  4KNX A;  3OC9 A;  2C0N A;  2JCK A;  2A8U A;  3OH2 A;  3FWW A;  4HO5 A;  4AYJ A;  2OI5 A;  4CJC A;  4M4K A;  4Y7V A;  1VIC A;  4FQW A;  3SXD A;  2X5S A;  1XZ6 A;  3DJ4 A;  3V90 A;  3SX5 A;  4EEA A;  1ZIZ A;  3I0J A;  1R81 A;  3F1Y A;  1LL0 A;  3U2U A;  4ARW A;  2FFV A;  1H3M A;  1VGZ A;  5FV9 A;  2V0L A;  3IOH A;  4P00 A;  3SX3 A;  3D8V A;  5C49 A;  2P72 A;  1FZW A;  1MC3 A;  1VH1 A;  5FYE A;  5C4B A;  3OH1 A;  4ZDQ A;  2VS5 A;  3CKO A;  1R7X A;  2FFU A;  2O1G A;  3NGW A;  1H5S B;  1R7U A;  4JD0 A;  5DDV A;  5CMJ A;  4Y63 A;  3D5N A;  4G3P A;  1YP4 A;  2I5K A;  3V0L A;  2W0W A;  1ZI5 A;  2XME A;  4MYB A;  1JVD A;  2ICX A;  3CKN A;  1S4O A;  2O1F A;  4D11 A;  1IIN A;  2PX7 A;  2RJ5 A;  5D92 A;  3V0O A;  2FYC B;  4DDZ A;  3T7M A;  2RIX A;  4EEG A;  4D11 C;  1H5R B;  5BXC A;  1YP3 A;  3OH3 A;  1WVC A;  2WE9 A;  1ZI1 A;  4FIY A;  4Y7T A;  3RMV A;  4KC1 A;  1V83 A;  3OAM A;  4DEC A;  2RIZ A;  1JV1 A;  4Y7G A;  2X5Z A;  5IFY A;  5IDT A;  3I0H A;  1S4P A;  3RSB A;  2BO8 A;  1KWS A;  2APC A;  1LL2 A;  5CQP A;  5CMG X;  3ST8 A;  1G8O A;  4M2B A;  1WT2 A;  1FGX A;  2AE7 A;  2PGY A;  1H7G A;  1G3L A;  1ZJO A;  1I52 A;  2AES A;  1GQ9 A;  2FYA A;  3JTJ A;  5CQN X;  1LZI A;  5AJN A;  2YQH A;  2ICY A;  2PGV A;  5C1G A;  2P6W A;  2J0A A;  1V82 A;  4Q7C A;  4D0T A;  4KPZ A;  2RJ9 A;  4LW3 A;  2O1H A;  2AM5 A;  2VK9 A;  1O23 B;  5J49 A;  3V0N A;  2WVL A;  1ZJ1 A;  4KT7 A;  1FXJ A;  3V8Z A;  1H5S C;  3OH4 A;  4LW6 A;  2QGI A;  4R7P A;  4MND A;  5FUH A;  4CJB A;  3U2W A;  1FR9 A;  1JVG A;  2Z87 A;  1S4N A;  5CMI A;  1IIM A;  2OEG A;  4K6R A;  3SPT A;  3N9W A;  3TZT A;  2J0B A;  5C8R A;  3E26 A;  1NHE B;  1ZCY A;  4HO9 A;  3DK5 A;  1W57 A;  3GUE A;  1H7F A;  4G3Q A;  1G2V A;  5CQM X;  1O7Q A;  4D48 A;  2Y7A A;  3I0G A;  1WT1 A;  1OQM B;  5C3A A;  1K4V A;  4FRP A;  3OKR A;  1H4D A;  5CMH A;  4MIX A;  4KC4 A;  3Q80 A;  4HO6 A;  3DUV A;  2FYB A;  3Q7U A;  2ZU8 A;  1LZ0 A;  3CU0 A;  4JIS A;  2JCJ A;  2GGO A;  2BO7 A;  4Y7U A;  5C48 A;  4NAK A;  1YP2 A;  4HCQ A;  2XWM A;  3K8D A;  4KC2 A;  2PA4 A;  1HJL A;  2Y4K A;  1ZJ3 A;  5C47 A;  3FOQ A;  3HL3 A;  3U0X A;  2RJ4 A;  1Z90 A;  4M2A A;  1G9R A;  4FCE A;  2Q4J A;  1V84 A;  1H5T A;  2V0K A;  4GBP A;  3I0D A;  4Y6N A;  1FO9 A;  2I7B A;  1TW1 A;  5C3B A;  2RJ6 A;  1VGW A;  1JYK A;  2DPW A;  4O6N A;  1H7Q A;  3TQD A;  1G97 A;  3OH0 A;  2FYD B;  2VFZ A;  2WVM A;  2I5E A;  1EYR A;  4FRO A;  3T7O A;  1QGS A;  4CVH A;  5C4F A;  3LW6 A;  5CMF X;  4Y9X A;  2A8W A;  4HOC A;  1H5S D;  4B2X A;  1QGQ A;  4B4M A;  2AM3 A;  4KNR A;  4HO4 A;  3ZGF A;  1HV9 A;  1FG5 N;  1NKH B;  1HJJ A;  1VH3 A;  1G1L A;  3SXG A;  4B42 A;  2RJ8 A;  5FTV A;  4ASJ A;  2RJ1 A;  4EE4 A;  3R3I A;  5FTS A;  2UX8 A;  1R7Y A;  5L6V A;  1GQC A;  5L6S A;  1E5K A;  1LVW A;  2WGZ A;  5IDS A;  1ZJ2 A;  2QH5 A;  2RJ0 A;  4L41 C;  1SS9 A;  4B2W A;  1G93 A;  1JYL A;  4BQH A;  4ECM A;  3F1C A;  2AGD A;  1FGG A;  1VGU A;  4P02 A;  2YQC A;  3ZF8 A;  3RMW A;  4ASY A;  4J18 A;  1HM9 A;  3V8Y A;  1MP4 A;  1QWJ A;  2VS3 A;  2V0H A;  4FRH A;  1NQI B;  5C4E A;  1H5S A;  1LZJ A;  5EIY A;  5I1F A;  1H7L A;  3OGZ A;  4Y6U A;  3SXC A;  5D91 A;  4AAW A;  1FO8 A;  1YRO B;  5JQQ A;  4IRP A;  3JUJ A;  4EEM A;  1GA8 A;  3IOI A;  3JUK A;  1TZF A;  2AEC A;  2Z86 A;  2RJ7 A;  4FRA A;  1O7O A;  1HM0 A;  2ZU7 A;  1H4E A;  5CQL X;  3V0Q A;  1H5R A;  4Y64 A;  4Y7F A;  2AH9 A;  1GWW A;  2X65 A;  3QVB A;  2WAW A;  3PNN A;  4Y62 A;  2RIT A;  2VXL A;  2MZB A;  2Y4J A;  5AJP A;  1H7E A;  5EJ1 A;  3CKJ A;  4O6M A;  2D7I A;  4B4G A;  3T7N A;  2BO4 A;  2WVK A;  4HO0 A;  1GX0 A;  2XWL A;  1WT0 A;  2XWN A;  4FRE A;  2YC3 A;  1H4C A;  3I0C A;  2YQJ A;  2QKX A;  4B4B A;  3I0I X;  2FY7 A;  4HO2 A;  3D98 A;  2AM4 A;  2VXM A;  1ZI3 A;  1VPA A;  5FU8 A;  3U2T A;  1ZCU A;  4FIX A;  3ZLL A;  5FU0 A;  1GWV A;  3ZLK A;  5C36 A;  3I0E A;  2WEE A;  1ZCV A;  4FRM A;  2VSI A;  3IOJ A;  1ON6 A;  1VM8 A;  4HO8 A;  2JCO A;  2Y6P A;  1HM8 A;  4FCU A;  4EEO A;  2P73 A;  3KIA A;  3Q4S A;  1LZ7 A;  4DE7 A;  2YQS A;  3I0L A;  1G0R A;  3O3P A;  1VZU A;  2X60 A;  1WT3 A;  3V0M A;  4NAN A;  1ON8 A;  5HS2 A;  5C1H A;  4EE5 A;  1ZDG A;  2YC5 A;  3U2V A;  4UEG A;  5C4D A;  2VD4 A;  4NAI A;  1JV3 A;  1FRW A;  2CU2 A;  4AYL A;  1ZCT A;  4KQL A;  5EJZ A;  1VGT A;  1GX4 A;  4BMA A;  4C2S A;  2E8B A;  4XWI A;  5C38 A;  4D0Z A;  1VZX A;  5AJO A;  4CJ8 A;  3POL A;  1NWG B;  2RIY A;  2OI7 A;  2BO6 A;  1VZT A;  4B5B A;  4E1K A;  1TW5 A;  3EE5 A;  1INJ A;  1QG8 A;  2ZU9 A;  1O0R A;  1R82 A;  4EE3 A;  5DDT A;  1W77 A;  3ZGG A;  1G95 A;  1NF5 B;  2V0I A;  3BCV A; 
#chains in the Genus database with same CATH homology
 3PKQ A;  3I0K A;  1FOA A;  5C4C A;  3CKV A;  4NAL A;  4G87 A;  1FR8 A;  1R7T A;  1ZDF A;  4KXO A;  1INI A;  5CQO A;  1WSZ A;  2NXV A;  3SXE A;  4B3U A;  4M28 A;  3SX7 A;  2VSH A;  1ZHJ A;  4FRD A;  3SXA A;  2D0J A;  1H7T A;  4KRV A;  1LL3 A;  2GGQ A;  3U0Y A;  1OMX A;  4IRQ A;  2V0J A;  1TVY A;  2XMH A;  3K8E A;  2OEF A;  1R7V A;  2VS4 A;  2E3D A;  5C3D A;  2W0V A;  2JCL A;  3V91 A;  3SX8 A;  4AC3 A;  2Y4M A;  5C1L A;  3USR A;  2YCM A;  1H5T B;  2D7R A;  4FRL A;  4EVW A;  1R80 A;  4HG6 A;  1PZY B;  4G3S A;  1NMM B;  3R2W A;  3USQ A;  1EZI A;  1MP5 A;  1W55 A;  1XHB A;  3BRK X;  3CGX A;  4KPX A;  1G23 A;  3SXB A;  4FRQ A;  1FXO A;  1FWY A;  1MP3 A;  2YES A;  1OMZ A;  4YS8 A;  3CKQ A;  1H7H A;  3I0F A;  3U2X A;  1ZI4 A;  1ZJ0 A;  3PKP A;  3V0P A;  4HO3 A;  4FRB A;  2Y4L A;  2OI6 A;  1PZT A;  1ZJP A;  3E25 A;  4KNX A;  3OC9 A;  2C0N A;  2JCK A;  2A8U A;  3OH2 A;  3FWW A;  4HO5 A;  4AYJ A;  2OI5 A;  4CJC A;  4M4K A;  4Y7V A;  1VIC A;  4FQW A;  3SXD A;  2X5S A;  1XZ6 A;  3DJ4 A;  3V90 A;  3SX5 A;  4EEA A;  1ZIZ A;  3I0J A;  1R81 A;  3F1Y A;  1LL0 A;  3U2U A;  4ARW A;  2FFV A;  1H3M A;  1VGZ A;  5FV9 A;  2V0L A;  3IOH A;  4P00 A;  3SX3 A;  3D8V A;  5C49 A;  2P72 A;  1FZW A;  1MC3 A;  1VH1 A;  5FYE A;  5C4B A;  3OH1 A;  4ZDQ A;  2VS5 A;  3CKO A;  1R7X A;  2FFU A;  2O1G A;  3NGW A;  1H5S B;  1R7U A;  4JD0 A;  5DDV A;  5CMJ A;  4Y63 A;  3D5N A;  4G3P A;  1YP4 A;  2I5K A;  3V0L A;  2W0W A;  1ZI5 A;  2XME A;  4MYB A;  1JVD A;  2ICX A;  3CKN A;  1S4O A;  2O1F A;  4D11 A;  1IIN A;  2PX7 A;  2RJ5 A;  5D92 A;  3V0O A;  2FYC B;  4DDZ A;  3T7M A;  2RIX A;  4EEG A;  4D11 C;  1H5R B;  5BXC A;  1YP3 A;  3OH3 A;  1WVC A;  2WE9 A;  1ZI1 A;  4FIY A;  4Y7T A;  3RMV A;  4KC1 A;  1V83 A;  3OAM A;  4DEC A;  2RIZ A;  1JV1 A;  4Y7G A;  2X5Z A;  5IFY A;  5IDT A;  3I0H A;  1S4P A;  3RSB A;  2BO8 A;  1KWS A;  2APC A;  1LL2 A;  5CQP A;  5CMG X;  3ST8 A;  1G8O A;  4M2B A;  1WT2 A;  1FGX A;  2AE7 A;  2PGY A;  1H7G A;  1G3L A;  1ZJO A;  1I52 A;  2AES A;  1GQ9 A;  2FYA A;  3JTJ A;  5CQN X;  1LZI A;  5AJN A;  2YQH A;  2ICY A;  2PGV A;  5C1G A;  2P6W A;  2J0A A;  1V82 A;  4Q7C A;  4D0T A;  4KPZ A;  2RJ9 A;  4LW3 A;  2O1H A;  2AM5 A;  2VK9 A;  1O23 B;  5J49 A;  3V0N A;  2WVL A;  1ZJ1 A;  4KT7 A;  1FXJ A;  3V8Z A;  1H5S C;  3OH4 A;  4LW6 A;  2QGI A;  4R7P A;  4MND A;  5FUH A;  4CJB A;  3U2W A;  1FR9 A;  1JVG A;  2Z87 A;  1S4N A;  5CMI A;  1IIM A;  2OEG A;  4K6R A;  3SPT A;  3N9W A;  3TZT A;  2J0B A;  5C8R A;  3E26 A;  1NHE B;  1ZCY A;  4HO9 A;  3DK5 A;  1W57 A;  3GUE A;  1H7F A;  4G3Q A;  1G2V A;  5CQM X;  1O7Q A;  4D48 A;  2Y7A A;  3I0G A;  1WT1 A;  1OQM B;  5C3A A;  1K4V A;  4FRP A;  3OKR A;  1H4D A;  5CMH A;  4MIX A;  4KC4 A;  3Q80 A;  4HO6 A;  3DUV A;  2FYB A;  3Q7U A;  2ZU8 A;  1LZ0 A;  3CU0 A;  4JIS A;  2JCJ A;  2GGO A;  2BO7 A;  4Y7U A;  5C48 A;  4NAK A;  1YP2 A;  4HCQ A;  2XWM A;  3K8D A;  4KC2 A;  2PA4 A;  1HJL A;  2Y4K A;  1ZJ3 A;  5C47 A;  3FOQ A;  3HL3 A;  3U0X A;  2RJ4 A;  1Z90 A;  4M2A A;  1G9R A;  4FCE A;  2Q4J A;  1V84 A;  1H5T A;  2V0K A;  4GBP A;  3I0D A;  4Y6N A;  1FO9 A;  2I7B A;  1TW1 A;  5C3B A;  2RJ6 A;  1VGW A;  1JYK A;  2DPW A;  4O6N A;  1H7Q A;  3TQD A;  1G97 A;  3OH0 A;  2FYD B;  2VFZ A;  2WVM A;  2I5E A;  1EYR A;  4FRO A;  3T7O A;  1QGS A;  4CVH A;  5C4F A;  3LW6 A;  5CMF X;  4Y9X A;  2A8W A;  4HOC A;  1H5S D;  4B2X A;  1QGQ A;  4B4M A;  2AM3 A;  4KNR A;  4HO4 A;  3ZGF A;  1HV9 A;  1FG5 N;  1NKH B;  1HJJ A;  1VH3 A;  1G1L A;  3SXG A;  4B42 A;  2RJ8 A;  5FTV A;  4ASJ A;  2RJ1 A;  4EE4 A;  3R3I A;  5FTS A;  2UX8 A;  1R7Y A;  5L6V A;  1GQC A;  5L6S A;  1E5K A;  1LVW A;  2WGZ A;  5IDS A;  1ZJ2 A;  2QH5 A;  2RJ0 A;  4L41 C;  1SS9 A;  4B2W A;  1G93 A;  1JYL A;  4BQH A;  4ECM A;  3F1C A;  2AGD A;  1FGG A;  1VGU A;  4P02 A;  2YQC A;  3ZF8 A;  3RMW A;  4ASY A;  4J18 A;  1HM9 A;  3V8Y A;  1MP4 A;  1QWJ A;  2VS3 A;  2V0H A;  4FRH A;  1NQI B;  5C4E A;  1H5S A;  1LZJ A;  5EIY A;  5I1F A;  1H7L A;  3OGZ A;  4Y6U A;  3SXC A;  5D91 A;  4AAW A;  1FO8 A;  1YRO B;  5JQQ A;  4IRP A;  3JUJ A;  4EEM A;  1GA8 A;  3IOI A;  3JUK A;  1TZF A;  2AEC A;  2Z86 A;  2RJ7 A;  4FRA A;  1O7O A;  1HM0 A;  2ZU7 A;  1H4E A;  5CQL X;  3V0Q A;  1H5R A;  4Y64 A;  4Y7F A;  2AH9 A;  1GWW A;  2X65 A;  3QVB A;  2WAW A;  3PNN A;  4Y62 A;  2RIT A;  2VXL A;  2MZB A;  2Y4J A;  5AJP A;  1H7E A;  5EJ1 A;  3CKJ A;  4O6M A;  2D7I A;  4B4G A;  3T7N A;  2BO4 A;  2WVK A;  4HO0 A;  1GX0 A;  2XWL A;  1WT0 A;  2XWN A;  4FRE A;  2YC3 A;  1H4C A;  3I0C A;  2YQJ A;  2QKX A;  4B4B A;  3I0I X;  2FY7 A;  4HO2 A;  3D98 A;  2AM4 A;  2VXM A;  1ZI3 A;  1VPA A;  5FU8 A;  3U2T A;  1ZCU A;  4FIX A;  3ZLL A;  5FU0 A;  1GWV A;  3ZLK A;  5C36 A;  3I0E A;  2WEE A;  1ZCV A;  4FRM A;  2VSI A;  3IOJ A;  1ON6 A;  1VM8 A;  4HO8 A;  2JCO A;  2Y6P A;  1HM8 A;  4FCU A;  4EEO A;  2P73 A;  3KIA A;  3Q4S A;  1LZ7 A;  4DE7 A;  2YQS A;  3I0L A;  1G0R A;  3O3P A;  1VZU A;  2X60 A;  1WT3 A;  3V0M A;  4NAN A;  1ON8 A;  5HS2 A;  5C1H A;  4EE5 A;  1ZDG A;  2YC5 A;  3U2V A;  4UEG A;  5C4D A;  2VD4 A;  4NAI A;  1JV3 A;  1FRW A;  2CU2 A;  4AYL A;  1ZCT A;  4KQL A;  5EJZ A;  1VGT A;  1GX4 A;  4BMA A;  4C2S A;  2E8B A;  4XWI A;  5C38 A;  4D0Z A;  1VZX A;  5AJO A;  4CJ8 A;  3POL A;  1NWG B;  2RIY A;  2OI7 A;  2BO6 A;  1VZT A;  4B5B A;  4E1K A;  1TW5 A;  3EE5 A;  1INJ A;  1QG8 A;  2ZU9 A;  1O0R A;  1R82 A;  4EE3 A;  5DDT A;  1W77 A;  3ZGG A;  1G95 A;  1NF5 B;  2V0I A;  3BCV A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...