4Y6UA

Mycobacterial protein
Total Genus 98
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
98
sequence length
304
structure length
280
Chain Sequence
ALPLDTTWHRPGWTIGELEAAKAGRTISVVLPALNEEATIESVIDSISPLVDGLVDELIVLDSGSTDDTEIRAIASGARVVSREQALPEVPVRPGKGEALWRSLAATSGDIVVFIDSDLINPHPLFVPWLVGPLLTGEGIQLVKSFYRGGRVTELVARPLLAALRPELGCVLQPLSGEYAASRELLTSLPFAPGYGVEIGLLIDTFDRLGLDAIAQVNLGVRAHRNRPLDELGAMSRQVIATLLSRCGIPDSGVGLTQFLYTRHTWPVSLVDRPPMKVMR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Glucosyl-3-phosphoglycerate synthase
publication title A Native Ternary Complex Trapped in a Crystal Reveals the Catalytic Mechanism of a Retaining Glycosyltransferase.
pubmed doi rcsb
source organism Mycobacterium tuberculosis (strain atcc 25618 / h37rv)
molecule tags Transferase
total genus 98
structure length 280
sequence length 304
ec nomenclature ec 2.4.1.266: Glucosyl-3-phosphoglycerate synthase.
pdb deposition date 2015-02-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00535 Glycos_transf_2 Glycosyl transferase family 2
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.550.10 Alpha Beta Alpha-Beta Complex Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A 4y6uA00
4IRQA 4FRBA 3SPTA 3PKQA 1EZIA 3U0XA 1WT1A 3F1YA 5C4FA 3FOQA 2VS5A 4Y7GA 5CMIA 3SX3A 2Y4MA 3ZLKA 1TW5A 2YCMA 4J18A 3R3IA 5FTVA 1H5TA 3QVBA 3D5NA 1ZHJA 1H7HA 3V8ZA 1NKHB 4KPZA 4Y7UA 5CQOA 4KXOA 1H7EA 1WT2A 3CKNA 1VH1A 1JYLA 1H4EA 4Y7FA 2AM3A 2BO4A 3D8VA 2ICYA 2RJ0A 2XWMA 3FWWA 2OI5A 1FXJA 1GQCA 2FFVA 1YP2A 2ZU9A 3PNNA 2VSIA 1K4VA 2PA4A 3OH2A 1FZWA 2RITA 5FYEA 4CVHA 5BXCA 1HJLA 1ZI1A 3SX5A 4D0TA 1ZCTA 2YESA 4JISA 4EE3A 5C48A 2VD4A 5I1FA 3V0OA 5C4BA 2A8WA 4KNRA 5EIYA 1H5SD 3SXDA 3I0JA 4Y6UA 4G3PA 3V0NA 1PZYB 1O0RA 1ZJ2A 2V0HA 2MZBA 1TZFA 4KC4A 3SXGA 2JCOA 4HO9A 3RSBA 1QG8A 2I5EA 1G93A 2VXMA 3NGWA 1O7OA 2WEEA 4FRHA 1HJJA 3TZTA 1VZTA 3O3PA 3IOIA 4FRLA 5AJPA 2RIXA 4FRDA 2Y4JA 2GGOA 2V0JA 2AESA 1ZCUA 2Y6PA 1GX0A 1V84A 1OMZA 4CJCA 1H5SA 4P02A 2OEGA 2RJ4A 3SXBA 1H7GA 3U2VA 4B4GA 4KNXA 4FRMA 4NALA 2ZU8A 4D0ZA 1MP3A 1MC3A 2AGDA 4E1KA 2RJ5A 1INJA 5C3DA 4NAKA 3I0LA 3RMWA 3I0HA 1ZI5A 3E26A 4Y63A 1HM9A 1ZI3A 4FRQA 1WSZA 3T7NA 3OAMA 2YQSA 1ZJ1A 2Z87A 3JUKA 4GBPA 1ZDFA 4L41C 1NWGB 2YC5A 4Y7TA 4CJBA 2V0LA 4EE5A 5CQPA 3RMVA 1YROB 2X60A 5C3BA 2QH5A 1H5SC 4KRVA 3ZGGA 1G3LA 1JV1A 4AAWA 2RIZA 1KWSA 2AE7A 1O7QA 3LW6A 2X5SA 2JCLA 1G0RA 1R7UA 1PZTA 2AH9A 3DUVA 3U2XA 2VSHA 3TQDA 4EEAA 4ECMA 2RJ8A 3I0CA 5EJ1A 3ZLLA 1I52A 1NHEB 3R2WA 4B3UA 1H3MA 2FFUA 2YC3A 1LZIA 3CGXA 1S4PA 5AJOA 3F1CA 3I0DA 3OH0A 2AM5A 1G23A 1WT3A 4C2SA 4LW3A 1NMMB 2D7IA 2W0VA 1FXOA 4B2XA 1H7TA 5C8RA 5L6SA 2D7RA 1XZ6A 3I0FA 1G9RA 5FV9A 4Y6NA 4BQHA 1V82A 3SXCA 1H7FA 4FRAA 3BRKX 2WVKA 3K8DA 1FR9A 1VZUA 1VH3A 1R7VA 5CQMX 5CMGX 1JVDA 4LW6A 3CU0A 1GX4A 5CMFX 2P73A 1W77A 2VS4A 3K8EA 1INIA 3I0IX 1G97A 4DECA 2BO6A 2WVLA 5C49A 5C1GA 2YQJA 2X5ZA 3SX7A 1ZJ0A 5C3AA 3V0LA 2RJ7A 4HCQA 2Y7AA 3PKPA 3ST8A 4KT7A 3HL3A 2NXVA 4ZDQA 4EEGA 4UEGA 3U0YA 3OKRA 4NAIA 5FU0A 4D11C 2Q4JA 5EJZA 2Y4LA 4AYLA 1YP4A 3OC9A 5FTSA 2P72A 4BMAA 1QWJA 2WGZA 5C4CA 4Y9XA 2E8BA 2VXLA 4FCEA 4MNDA 1GWWA 1LL0A 1VICA 4KPXA 1LVWA 2BO8A 2Y4KA 4Y62A 3SXAA 1R81A 1JV3A 1H4CA 4EVWA 1FRWA 4IRPA 1VGUA 4Y7VA 2OI7A 4AC3A 1ZCVA 2RJ1A 3E25A 4HO0A 1OQMB 1G2VA 4HO5A 2QKXA 2WE9A 2GGQA 2I5KA 4B42A 5CQLX 5C38A 4EE4A 3N9WA 4HO8A 2OEFA 5FUHA 3CKVA 5J49A 1SS9A 1NQIB 2JCJA 1TW1A 1FOAA 1ZI4A 1LL3A 5C1HA 3T7MA 5L6VA 1E5KA 3IOJA 3BCVA 4D48A 2WAWA 4K6RA 3Q80A 4JD0A 5IDSA 4M4KA 4AYJA 2RJ9A 4B4BA 1R7YA 1R7XA 2O1GA 3USQA 1VM8A 3V91A 1OMXA 5HS2A 2V0KA 3D98A 1NF5B 1GWVA 1H5RB 1FO9A 1ON8A 3T7OA 1VGTA 3CKOA 2FY7A 3CKQA 2XMHA 3V0PA 3IOHA 4B4MA 4DDZA 2ICXA 4KQLA 2RIYA 2RJ6A 2FYCB 4D11A 2OI6A 3Q4SA 1W55A 1ZIZA 3POLA 5IFYA 5FU8A 3U2WA 1HM0A 3OH4A 1H7QA 1QGSA 2E3DA 1LL2A 2FYAA 2O1HA 1ZJOA 2Z86A 1HM8A 1LZJA 2AM4A 4FROA 3ZF8A 5C36A 5C1LA 3OH1A 3KIAA 3V8YA 2FYBA 1JYKA 2I7BA 4KC2A 1WVCA 3DK5A 1H5TB 2APCA 4ASYA 3EE5A 2BO7A 1R7TA 4XWIA 4KC1A 3Q7UA 4FREA 3CKJA 4HO4A 5C4EA 1LZ0A 2CU2A 1IINA 1VPAA 1S4NA 2DPWA 4NANA 1WT0A 5DDVA 1VGZA 1FR8A 1R80A 4EEOA 1IIMA 1FGGA 5AJNA 1O23B 1G8OA 3JTJA 3V0QA 2XMEA 5JQQA 1H7LA 2WVMA 1QGQA 4ARWA 2JCKA 2A8UA 1ON6A 1VGWA 4HO3A 3V0MA 3U2UA 3USRA 1MP5A 1ZJPA 3I0KA 1VZXA 4YS8A 4DE7A 2PGYA 1YP3A 3I0EA 1V83A 3ZGFA 3SXEA 4G3QA 4G87A 5IDTA 5CMHA 3U2TA 2YQCA 4G3SA 3GUEA 1HV9A 1H4DA 1G1LA 5C47A 1GA8A 4P00A 4HOCA 2D0JA 4B5BA 2VFZA 1ZCYA 2O1FA 3OH3A 4FQWA 1ZDGA 1FO8A 4M28A 4FCUA 1H5SB 4Y64A 2V0IA 2YQHA 4ASJA 3I0GA 1FGXA 5CMJA 1EYRA 1S4OA 5CQNX 4HO2A 1G95A 2FYDB 1FWYA 2AECA 1TVYA 2UX8A 1H5RA 4M2BA 3OGZA 5C4DA 3V90A 4FRPA 1W57A 2XWLA 4B2WA 4HG6A 1ZJ3A 2P6WA 2ZU7A 2QGIA 1R82A 2XWNA 4M2AA 2PGVA 4CJ8A 1XHBA 3SX8A 2W0WA 2X65A 4HO6A 2VS3A 4EEMA 3DJ4A 1LZ7A 1Z90A 4MYBA 4R7PA 2PX7A 5DDTA 1JVGA 1FG5N 1GQ9A 1MP4A 3JUJA
chains in the Genus database with same CATH superfamily
4IRQA 4FRBA 3SPTA 2J0BA 3PKQA 1EZIA 3U0XA 1WT1A 3F1YA 5C4FA 3FOQA 2VS5A 4Y7GA 5CMIA 3SX3A 2Y4MA 3ZLKA 1TW5A 2YCMA 4J18A 3R3IA 5FTVA 1H5TA 3QVBA 3D5NA 1ZHJA 1H7HA 3V8ZA 1NKHB 4KPZA 4Y7UA 5CQOA 4KXOA 1H7EA 1WT2A 3CKNA 5D91A 1VH1A 1JYLA 1H4EA 4Y7FA 2AM3A 2BO4A 3D8VA 2ICYA 2RJ0A 2XWMA 3FWWA 2OI5A 1FXJA 1GQCA 2FFVA 1YP2A 2ZU9A 3PNNA 2VSIA 1K4VA 2PA4A 3OH2A 1FZWA 2RITA 5FYEA 4CVHA 5BXCA 1HJLA 1ZI1A 3SX5A 4D0TA 1ZCTA 2YESA 4JISA 4EE3A 5C48A 2VD4A 5I1FA 3V0OA 5C4BA 2A8WA 4KNRA 5EIYA 1H5SD 4Q7CA 3SXDA 3I0JA 4Y6UA 4G3PA 3V0NA 1PZYB 1O0RA 1ZJ2A 2V0HA 2MZBA 1TZFA 4KC4A 3SXGA 2JCOA 4HO9A 3RSBA 1QG8A 2I5EA 1G93A 2VXMA 3NGWA 1O7OA 2WEEA 4FRHA 1HJJA 3TZTA 1VZTA 3O3PA 3IOIA 4FRLA 5AJPA 2RIXA 4FRDA 2Y4JA 2GGOA 2V0JA 2AESA 1ZCUA 2Y6PA 1GX0A 1V84A 1OMZA 4CJCA 1H5SA 4P02A 2OEGA 2RJ4A 3SXBA 1H7GA 3U2VA 4B4GA 4KNXA 4FRMA 4NALA 2ZU8A 4D0ZA 1MP3A 1MC3A 2AGDA 4E1KA 2RJ5A 1INJA 5C3DA 4NAKA 3I0LA 3RMWA 3I0HA 1ZI5A 3E26A 4Y63A 1HM9A 1ZI3A 4FRQA 1WSZA 3T7NA 3OAMA 2YQSA 1ZJ1A 2Z87A 3JUKA 4GBPA 1ZDFA 4L41C 1NWGB 2YC5A 4Y7TA 4CJBA 2V0LA 4EE5A 5CQPA 4O6MA 3RMVA 1YROB 2X60A 5C3BA 2QH5A 1H5SC 4KRVA 3ZGGA 4FIXA 1G3LA 1JV1A 4AAWA 2RIZA 1KWSA 2AE7A 1O7QA 3LW6A 2X5SA 2JCLA 1G0RA 1R7UA 1PZTA 2AH9A 3DUVA 3U2XA 2VSHA 3TQDA 4EEAA 4ECMA 2RJ8A 3I0CA 5EJ1A 3ZLLA 1I52A 1NHEB 3R2WA 4B3UA 1H3MA 2FFUA 2YC3A 1LZIA 3CGXA 1S4PA 5AJOA 3F1CA 3I0DA 3OH0A 2AM5A 1G23A 1WT3A 4C2SA 4LW3A 1NMMB 2D7IA 2W0VA 1FXOA 4B2XA 1H7TA 5C8RA 5L6SA 2D7RA 1XZ6A 3I0FA 1G9RA 5FV9A 4Y6NA 4BQHA 1V82A 3SXCA 1H7FA 4FRAA 3BRKX 2WVKA 3K8DA 1FR9A 4O6NA 1VZUA 1VH3A 1R7VA 5CQMX 5CMGX 1JVDA 4LW6A 3CU0A 1GX4A 5CMFX 2P73A 1W77A 2VS4A 3K8EA 1INIA 3I0IX 1G97A 4DECA 2BO6A 2WVLA 5C49A 5C1GA 2YQJA 2X5ZA 3SX7A 1ZJ0A 5C3AA 3V0LA 2RJ7A 4HCQA 2Y7AA 3PKPA 3ST8A 4KT7A 3HL3A 2NXVA 4ZDQA 4EEGA 4UEGA 3U0YA 3OKRA 4NAIA 5FU0A 4D11C 2Q4JA 5EJZA 2Y4LA 2C0NA 4AYLA 1YP4A 3OC9A 5FTSA 2P72A 4BMAA 1QWJA 2WGZA 5C4CA 4Y9XA 2E8BA 2VXLA 4FCEA 4MNDA 1GWWA 1LL0A 1VICA 4KPXA 1LVWA 2BO8A 2Y4KA 4Y62A 3SXAA 1R81A 1JV3A 1H4CA 4EVWA 1FRWA 4IRPA 1VGUA 4Y7VA 2OI7A 4AC3A 1ZCVA 2RJ1A 3E25A 4HO0A 1OQMB 1G2VA 4HO5A 2QKXA 2WE9A 2GGQA 2I5KA 4B42A 5CQLX 5C38A 4EE4A 3N9WA 4HO8A 4MIXA 2OEFA 5FUHA 3CKVA 5J49A 1SS9A 1NQIB 2JCJA 1TW1A 1FOAA 1ZI4A 1LL3A 5C1HA 3T7MA 5L6VA 1E5KA 3IOJA 3BCVA 4D48A 2WAWA 4K6RA 3Q80A 4JD0A 5IDSA 4M4KA 4AYJA 2RJ9A 4B4BA 1R7YA 1R7XA 2O1GA 3USQA 1VM8A 3V91A 1OMXA 5HS2A 2V0KA 3D98A 1NF5B 1GWVA 1H5RB 1FO9A 1ON8A 3T7OA 1VGTA 3CKOA 2FY7A 3CKQA 2XMHA 3V0PA 3IOHA 4B4MA 4DDZA 2ICXA 4KQLA 2RIYA 2RJ6A 2FYCB 4D11A 2OI6A 3Q4SA 1W55A 1ZIZA 3POLA 5IFYA 5FU8A 3U2WA 1HM0A 3OH4A 1H7QA 1QGSA 2E3DA 1LL2A 2FYAA 2O1HA 1ZJOA 2Z86A 1HM8A 1LZJA 2AM4A 4FROA 3ZF8A 5C36A 5C1LA 3OH1A 3KIAA 3V8YA 2FYBA 1JYKA 2I7BA 4KC2A 1WVCA 3DK5A 1H5TB 2APCA 4ASYA 3EE5A 2BO7A 1R7TA 4XWIA 4KC1A 3Q7UA 4FREA 3CKJA 4HO4A 5C4EA 1LZ0A 2CU2A 1IINA 1VPAA 1S4NA 2DPWA 4NANA 1WT0A 5DDVA 1VGZA 1FR8A 1R80A 4EEOA 1IIMA 1FGGA 5AJNA 1O23B 1G8OA 3JTJA 3V0QA 2XMEA 5JQQA 1H7LA 2WVMA 1QGQA 4ARWA 2VK9A 2JCKA 2A8UA 1ON6A 1VGWA 4HO3A 3V0MA 3U2UA 3USRA 1MP5A 1ZJPA 3I0KA 1VZXA 4YS8A 4DE7A 2PGYA 1YP3A 3I0EA 1V83A 3ZGFA 3SXEA 4G3QA 4G87A 5IDTA 5CMHA 3U2TA 2YQCA 4G3SA 3GUEA 1HV9A 1H4DA 1G1LA 5C47A 1GA8A 4P00A 4HOCA 2D0JA 4B5BA 2VFZA 1ZCYA 2O1FA 3OH3A 4FQWA 1ZDGA 1FO8A 4M28A 4FCUA 1H5SB 2J0AA 4Y64A 2V0IA 2YQHA 4ASJA 4FIYA 3I0GA 1FGXA 5CMJA 1EYRA 1S4OA 5CQNX 4HO2A 1G95A 2FYDB 1FWYA 2AECA 1TVYA 2UX8A 1H5RA 4M2BA 3OGZA 5C4DA 3V90A 4FRPA 1W57A 5D92A 2XWLA 4B2WA 4HG6A 1ZJ3A 2P6WA 2ZU7A 2QGIA 1R82A 2XWNA 4M2AA 2PGVA 4CJ8A 1XHBA 3SX8A 2W0WA 2X65A 4HO6A 2VS3A 4EEMA 3DJ4A 1LZ7A 1Z90A 4MYBA 4R7PA 2PX7A 5DDTA 1JVGA 1FG5N 1GQ9A 1MP4A 3JUJA
chains in the Genus database with same CATH topology
4IRQA 4FRBA 3SPTA 2J0BA 3PKQA 1EZIA 3U0XA 1WT1A 3F1YA 5C4FA 3FOQA 2VS5A 4Y7GA 5CMIA 3SX3A 2Y4MA 3ZLKA 1TW5A 2YCMA 4J18A 3R3IA 5FTVA 1H5TA 3QVBA 3D5NA 1ZHJA 1H7HA 3V8ZA 1NKHB 4KPZA 4Y7UA 5CQOA 4KXOA 1H7EA 1WT2A 3CKNA 5D91A 1VH1A 1JYLA 1H4EA 4Y7FA 2AM3A 2BO4A 3D8VA 2ICYA 2RJ0A 2XWMA 3FWWA 2OI5A 1FXJA 1GQCA 2FFVA 1YP2A 2ZU9A 3PNNA 2VSIA 1K4VA 2PA4A 3OH2A 1FZWA 2RITA 5FYEA 4CVHA 5BXCA 1HJLA 1ZI1A 3SX5A 4D0TA 1ZCTA 2YESA 4JISA 4EE3A 5C48A 2VD4A 5I1FA 3V0OA 5C4BA 2A8WA 4KNRA 5EIYA 1H5SD 4Q7CA 3SXDA 3I0JA 4Y6UA 4G3PA 3V0NA 1PZYB 1O0RA 1ZJ2A 2V0HA 2MZBA 1TZFA 4KC4A 3SXGA 2JCOA 4HO9A 3RSBA 1QG8A 2I5EA 1G93A 2VXMA 3NGWA 1O7OA 2WEEA 4FRHA 1HJJA 3TZTA 1VZTA 3O3PA 3IOIA 4FRLA 5AJPA 2RIXA 4FRDA 2Y4JA 2GGOA 2V0JA 2AESA 1ZCUA 2Y6PA 1GX0A 1V84A 1OMZA 4CJCA 1H5SA 4P02A 2OEGA 2RJ4A 3SXBA 1H7GA 3U2VA 4B4GA 4KNXA 4FRMA 4NALA 2ZU8A 4D0ZA 1MP3A 1MC3A 2AGDA 4E1KA 2RJ5A 1INJA 5C3DA 4NAKA 3I0LA 3RMWA 3I0HA 1ZI5A 3E26A 4Y63A 1HM9A 1ZI3A 4FRQA 1WSZA 3T7NA 3OAMA 2YQSA 1ZJ1A 2Z87A 3JUKA 4GBPA 1ZDFA 4L41C 1NWGB 2YC5A 4Y7TA 4CJBA 2V0LA 4EE5A 5CQPA 4O6MA 3RMVA 1YROB 2X60A 5C3BA 2QH5A 1H5SC 4KRVA 3ZGGA 4FIXA 1G3LA 1JV1A 4AAWA 2RIZA 1KWSA 2AE7A 1O7QA 3LW6A 2X5SA 2JCLA 1G0RA 1R7UA 1PZTA 2AH9A 3DUVA 3U2XA 2VSHA 3TQDA 4EEAA 4ECMA 2RJ8A 3I0CA 5EJ1A 3ZLLA 1I52A 1NHEB 3R2WA 4B3UA 1H3MA 2FFUA 2YC3A 1LZIA 3CGXA 1S4PA 5AJOA 3F1CA 3I0DA 3OH0A 2AM5A 1G23A 1WT3A 4C2SA 4LW3A 1NMMB 2D7IA 2W0VA 1FXOA 4B2XA 1H7TA 5C8RA 5L6SA 2D7RA 1XZ6A 3I0FA 1G9RA 5FV9A 4Y6NA 4BQHA 1V82A 3SXCA 1H7FA 4FRAA 3BRKX 2WVKA 3K8DA 1FR9A 4O6NA 1VZUA 1VH3A 1R7VA 5CQMX 5CMGX 1JVDA 4LW6A 3CU0A 1GX4A 5CMFX 2P73A 1W77A 2VS4A 3K8EA 1INIA 3I0IX 1G97A 4DECA 2BO6A 2WVLA 5C49A 5C1GA 2YQJA 2X5ZA 3SX7A 1ZJ0A 5C3AA 3V0LA 2RJ7A 4HCQA 2Y7AA 3PKPA 3ST8A 4KT7A 3HL3A 2NXVA 4ZDQA 4EEGA 4UEGA 3U0YA 3OKRA 4NAIA 5FU0A 4D11C 2Q4JA 5EJZA 2Y4LA 2C0NA 4AYLA 1YP4A 3OC9A 5FTSA 2P72A 4BMAA 1QWJA 2WGZA 5C4CA 4Y9XA 2E8BA 2VXLA 4FCEA 4MNDA 1GWWA 1LL0A 1VICA 4KPXA 1LVWA 2BO8A 2Y4KA 4Y62A 3SXAA 1R81A 1JV3A 1H4CA 4EVWA 1FRWA 4IRPA 1VGUA 4Y7VA 2OI7A 4AC3A 1ZCVA 2RJ1A 3E25A 4HO0A 1OQMB 1G2VA 4HO5A 2QKXA 2WE9A 2GGQA 2I5KA 4B42A 5CQLX 5C38A 4EE4A 3N9WA 4HO8A 4MIXA 2OEFA 5FUHA 3CKVA 5J49A 1SS9A 1NQIB 2JCJA 1TW1A 1FOAA 1ZI4A 1LL3A 5C1HA 3T7MA 5L6VA 1E5KA 3IOJA 3BCVA 4D48A 2WAWA 4K6RA 3Q80A 4JD0A 5IDSA 4M4KA 4AYJA 2RJ9A 4B4BA 1R7YA 1R7XA 2O1GA 3USQA 1VM8A 3V91A 1OMXA 5HS2A 2V0KA 3D98A 1NF5B 1GWVA 1H5RB 1FO9A 1ON8A 3T7OA 1VGTA 3CKOA 2FY7A 3CKQA 2XMHA 3V0PA 3IOHA 4B4MA 4DDZA 2ICXA 4KQLA 2RIYA 2RJ6A 2FYCB 4D11A 2OI6A 3Q4SA 1W55A 1ZIZA 3POLA 5IFYA 5FU8A 3U2WA 1HM0A 3OH4A 1H7QA 1QGSA 2E3DA 1LL2A 2FYAA 2O1HA 1ZJOA 2Z86A 1HM8A 1LZJA 2AM4A 4FROA 3ZF8A 5C36A 5C1LA 3OH1A 3KIAA 3V8YA 2FYBA 1JYKA 2I7BA 4KC2A 1WVCA 3DK5A 1H5TB 2APCA 4ASYA 3EE5A 2BO7A 1R7TA 4XWIA 4KC1A 3Q7UA 4FREA 3CKJA 4HO4A 5C4EA 1LZ0A 2CU2A 1IINA 1VPAA 1S4NA 2DPWA 4NANA 1WT0A 5DDVA 1VGZA 1FR8A 1R80A 4EEOA 1IIMA 1FGGA 5AJNA 1O23B 1G8OA 3JTJA 3V0QA 2XMEA 5JQQA 1H7LA 2WVMA 1QGQA 4ARWA 2VK9A 2JCKA 2A8UA 1ON6A 1VGWA 4HO3A 3V0MA 3U2UA 3USRA 1MP5A 1ZJPA 3I0KA 1VZXA 4YS8A 4DE7A 2PGYA 1YP3A 3I0EA 1V83A 3ZGFA 3SXEA 4G3QA 4G87A 5IDTA 5CMHA 3U2TA 2YQCA 4G3SA 3GUEA 1HV9A 1H4DA 1G1LA 5C47A 1GA8A 4P00A 4HOCA 2D0JA 4B5BA 2VFZA 1ZCYA 2O1FA 3OH3A 4FQWA 1ZDGA 1FO8A 4M28A 4FCUA 1H5SB 2J0AA 4Y64A 2V0IA 2YQHA 4ASJA 4FIYA 3I0GA 1FGXA 5CMJA 1EYRA 1S4OA 5CQNX 4HO2A 1G95A 2FYDB 1FWYA 2AECA 1TVYA 2UX8A 1H5RA 4M2BA 3OGZA 5C4DA 3V90A 4FRPA 1W57A 5D92A 2XWLA 4B2WA 4HG6A 1ZJ3A 2P6WA 2ZU7A 2QGIA 1R82A 2XWNA 4M2AA 2PGVA 4CJ8A 1XHBA 3SX8A 2W0WA 2X65A 4HO6A 2VS3A 4EEMA 3DJ4A 1LZ7A 1Z90A 4MYBA 4R7PA 2PX7A 5DDTA 1JVGA 1FG5N 1GQ9A 1MP4A 3JUJA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4IRQ A;  4FRB A;  3SPT A;  3PKQ A;  1EZI A;  3U0X A;  1WT1 A;  3F1Y A;  5C4F A;  3FOQ A;  2VS5 A;  4Y7G A;  5CMI A;  3SX3 A;  2Y4M A;  3ZLK A;  1TW5 A;  2YCM A;  4J18 A;  3R3I A;  5FTV A;  1H5T A;  3QVB A;  3D5N A;  1ZHJ A;  1H7H A;  3V8Z A;  1NKH B;  4KPZ A;  4Y7U A;  5CQO A;  4KXO A;  1H7E A;  1WT2 A;  3CKN A;  1VH1 A;  1JYL A;  1H4E A;  4Y7F A;  2AM3 A;  2BO4 A;  3D8V A;  2ICY A;  2RJ0 A;  2XWM A;  3FWW A;  2OI5 A;  1FXJ A;  1GQC A;  2FFV A;  1YP2 A;  2ZU9 A;  3PNN A;  2VSI A;  1K4V A;  2PA4 A;  3OH2 A;  1FZW A;  2RIT A;  5FYE A;  4CVH A;  5BXC A;  1HJL A;  1ZI1 A;  3SX5 A;  4D0T A;  1ZCT A;  2YES A;  4JIS A;  4EE3 A;  5C48 A;  2VD4 A;  5I1F A;  3V0O A;  5C4B A;  2A8W A;  4KNR A;  5EIY A;  1H5S D;  3SXD A;  3I0J A;  4Y6U A;  4G3P A;  3V0N A;  1PZY B;  1O0R A;  1ZJ2 A;  2V0H A;  2MZB A;  1TZF A;  4KC4 A;  3SXG A;  2JCO A;  4HO9 A;  3RSB A;  1QG8 A;  2I5E A;  1G93 A;  2VXM A;  3NGW A;  1O7O A;  2WEE A;  4FRH A;  1HJJ A;  3TZT A;  1VZT A;  3O3P A;  3IOI A;  4FRL A;  5AJP A;  2RIX A;  4FRD A;  2Y4J A;  2GGO A;  2V0J A;  2AES A;  1ZCU A;  2Y6P A;  1GX0 A;  1V84 A;  1OMZ A;  4CJC A;  1H5S A;  4P02 A;  2OEG A;  2RJ4 A;  3SXB A;  1H7G A;  3U2V A;  4B4G A;  4KNX A;  4FRM A;  4NAL A;  2ZU8 A;  4D0Z A;  1MP3 A;  1MC3 A;  2AGD A;  4E1K A;  2RJ5 A;  1INJ A;  5C3D A;  4NAK A;  3I0L A;  3RMW A;  3I0H A;  1ZI5 A;  3E26 A;  4Y63 A;  1HM9 A;  1ZI3 A;  4FRQ A;  1WSZ A;  3T7N A;  3OAM A;  2YQS A;  1ZJ1 A;  2Z87 A;  3JUK A;  4GBP A;  1ZDF A;  4L41 C;  1NWG B;  2YC5 A;  4Y7T A;  4CJB A;  2V0L A;  4EE5 A;  5CQP A;  3RMV A;  1YRO B;  2X60 A;  5C3B A;  2QH5 A;  1H5S C;  4KRV A;  3ZGG A;  1G3L A;  1JV1 A;  4AAW A;  2RIZ A;  1KWS A;  2AE7 A;  1O7Q A;  3LW6 A;  2X5S A;  2JCL A;  1G0R A;  1R7U A;  1PZT A;  2AH9 A;  3DUV A;  3U2X A;  2VSH A;  3TQD A;  4EEA A;  4ECM A;  2RJ8 A;  3I0C A;  5EJ1 A;  3ZLL A;  1I52 A;  1NHE B;  3R2W A;  4B3U A;  1H3M A;  2FFU A;  2YC3 A;  1LZI A;  3CGX A;  1S4P A;  5AJO A;  3F1C A;  3I0D A;  3OH0 A;  2AM5 A;  1G23 A;  1WT3 A;  4C2S A;  4LW3 A;  1NMM B;  2D7I A;  2W0V A;  1FXO A;  4B2X A;  1H7T A;  5C8R A;  5L6S A;  2D7R A;  1XZ6 A;  3I0F A;  1G9R A;  5FV9 A;  4Y6N A;  4BQH A;  1V82 A;  3SXC A;  1H7F A;  4FRA A;  3BRK X;  2WVK A;  3K8D A;  1FR9 A;  1VZU A;  1VH3 A;  1R7V A;  5CQM X;  5CMG X;  1JVD A;  4LW6 A;  3CU0 A;  1GX4 A;  5CMF X;  2P73 A;  1W77 A;  2VS4 A;  3K8E A;  1INI A;  3I0I X;  1G97 A;  4DEC A;  2BO6 A;  2WVL A;  5C49 A;  5C1G A;  2YQJ A;  2X5Z A;  3SX7 A;  1ZJ0 A;  5C3A A;  3V0L A;  2RJ7 A;  4HCQ A;  2Y7A A;  3PKP A;  3ST8 A;  4KT7 A;  3HL3 A;  2NXV A;  4ZDQ A;  4EEG A;  4UEG A;  3U0Y A;  3OKR A;  4NAI A;  5FU0 A;  4D11 C;  2Q4J A;  5EJZ A;  2Y4L A;  4AYL A;  1YP4 A;  3OC9 A;  5FTS A;  2P72 A;  4BMA A;  1QWJ A;  2WGZ A;  5C4C A;  4Y9X A;  2E8B A;  2VXL A;  4FCE A;  4MND A;  1GWW A;  1LL0 A;  1VIC A;  4KPX A;  1LVW A;  2BO8 A;  2Y4K A;  4Y62 A;  3SXA A;  1R81 A;  1JV3 A;  1H4C A;  4EVW A;  1FRW A;  4IRP A;  1VGU A;  4Y7V A;  2OI7 A;  4AC3 A;  1ZCV A;  2RJ1 A;  3E25 A;  4HO0 A;  1OQM B;  1G2V A;  4HO5 A;  2QKX A;  2WE9 A;  2GGQ A;  2I5K A;  4B42 A;  5CQL X;  5C38 A;  4EE4 A;  3N9W A;  4HO8 A;  2OEF A;  5FUH A;  3CKV A;  5J49 A;  1SS9 A;  1NQI B;  2JCJ A;  1TW1 A;  1FOA A;  1ZI4 A;  1LL3 A;  5C1H A;  3T7M A;  5L6V A;  1E5K A;  3IOJ A;  3BCV A;  4D48 A;  2WAW A;  4K6R A;  3Q80 A;  4JD0 A;  5IDS A;  4M4K A;  4AYJ A;  2RJ9 A;  4B4B A;  1R7Y A;  1R7X A;  2O1G A;  3USQ A;  1VM8 A;  3V91 A;  1OMX A;  5HS2 A;  2V0K A;  3D98 A;  1NF5 B;  1GWV A;  1H5R B;  1FO9 A;  1ON8 A;  3T7O A;  1VGT A;  3CKO A;  2FY7 A;  3CKQ A;  2XMH A;  3V0P A;  3IOH A;  4B4M A;  4DDZ A;  2ICX A;  4KQL A;  2RIY A;  2RJ6 A;  2FYC B;  4D11 A;  2OI6 A;  3Q4S A;  1W55 A;  1ZIZ A;  3POL A;  5IFY A;  5FU8 A;  3U2W A;  1HM0 A;  3OH4 A;  1H7Q A;  1QGS A;  2E3D A;  1LL2 A;  2FYA A;  2O1H A;  1ZJO A;  2Z86 A;  1HM8 A;  1LZJ A;  2AM4 A;  4FRO A;  3ZF8 A;  5C36 A;  5C1L A;  3OH1 A;  3KIA A;  3V8Y A;  2FYB A;  1JYK A;  2I7B A;  4KC2 A;  1WVC A;  3DK5 A;  1H5T B;  2APC A;  4ASY A;  3EE5 A;  2BO7 A;  1R7T A;  4XWI A;  4KC1 A;  3Q7U A;  4FRE A;  3CKJ A;  4HO4 A;  5C4E A;  1LZ0 A;  2CU2 A;  1IIN A;  1VPA A;  1S4N A;  2DPW A;  4NAN A;  1WT0 A;  5DDV A;  1VGZ A;  1FR8 A;  1R80 A;  4EEO A;  1IIM A;  1FGG A;  5AJN A;  1O23 B;  1G8O A;  3JTJ A;  3V0Q A;  2XME A;  5JQQ A;  1H7L A;  2WVM A;  1QGQ A;  4ARW A;  2JCK A;  2A8U A;  1ON6 A;  1VGW A;  4HO3 A;  3V0M A;  3U2U A;  3USR A;  1MP5 A;  1ZJP A;  3I0K A;  1VZX A;  4YS8 A;  4DE7 A;  2PGY A;  1YP3 A;  3I0E A;  1V83 A;  3ZGF A;  3SXE A;  4G3Q A;  4G87 A;  5IDT A;  5CMH A;  3U2T A;  2YQC A;  4G3S A;  3GUE A;  1HV9 A;  1H4D A;  1G1L A;  5C47 A;  1GA8 A;  4P00 A;  4HOC A;  2D0J A;  4B5B A;  2VFZ A;  1ZCY A;  2O1F A;  3OH3 A;  4FQW A;  1ZDG A;  1FO8 A;  4M28 A;  4FCU A;  1H5S B;  4Y64 A;  2V0I A;  2YQH A;  4ASJ A;  3I0G A;  1FGX A;  5CMJ A;  1EYR A;  1S4O A;  5CQN X;  4HO2 A;  1G95 A;  2FYD B;  1FWY A;  2AEC A;  1TVY A;  2UX8 A;  1H5R A;  4M2B A;  3OGZ A;  5C4D A;  3V90 A;  4FRP A;  1W57 A;  2XWL A;  4B2W A;  4HG6 A;  1ZJ3 A;  2P6W A;  2ZU7 A;  2QGI A;  1R82 A;  2XWN A;  4M2A A;  2PGV A;  4CJ8 A;  1XHB A;  3SX8 A;  2W0W A;  2X65 A;  4HO6 A;  2VS3 A;  4EEM A;  3DJ4 A;  1LZ7 A;  1Z90 A;  4MYB A;  4R7P A;  2PX7 A;  5DDT A;  1JVG A;  1FG5 N;  1GQ9 A;  1MP4 A;  3JUJ A; 
#chains in the Genus database with same CATH topology
 4IRQ A;  4FRB A;  3SPT A;  2J0B A;  3PKQ A;  1EZI A;  3U0X A;  1WT1 A;  3F1Y A;  5C4F A;  3FOQ A;  2VS5 A;  4Y7G A;  5CMI A;  3SX3 A;  2Y4M A;  3ZLK A;  1TW5 A;  2YCM A;  4J18 A;  3R3I A;  5FTV A;  1H5T A;  3QVB A;  3D5N A;  1ZHJ A;  1H7H A;  3V8Z A;  1NKH B;  4KPZ A;  4Y7U A;  5CQO A;  4KXO A;  1H7E A;  1WT2 A;  3CKN A;  5D91 A;  1VH1 A;  1JYL A;  1H4E A;  4Y7F A;  2AM3 A;  2BO4 A;  3D8V A;  2ICY A;  2RJ0 A;  2XWM A;  3FWW A;  2OI5 A;  1FXJ A;  1GQC A;  2FFV A;  1YP2 A;  2ZU9 A;  3PNN A;  2VSI A;  1K4V A;  2PA4 A;  3OH2 A;  1FZW A;  2RIT A;  5FYE A;  4CVH A;  5BXC A;  1HJL A;  1ZI1 A;  3SX5 A;  4D0T A;  1ZCT A;  2YES A;  4JIS A;  4EE3 A;  5C48 A;  2VD4 A;  5I1F A;  3V0O A;  5C4B A;  2A8W A;  4KNR A;  5EIY A;  1H5S D;  4Q7C A;  3SXD A;  3I0J A;  4Y6U A;  4G3P A;  3V0N A;  1PZY B;  1O0R A;  1ZJ2 A;  2V0H A;  2MZB A;  1TZF A;  4KC4 A;  3SXG A;  2JCO A;  4HO9 A;  3RSB A;  1QG8 A;  2I5E A;  1G93 A;  2VXM A;  3NGW A;  1O7O A;  2WEE A;  4FRH A;  1HJJ A;  3TZT A;  1VZT A;  3O3P A;  3IOI A;  4FRL A;  5AJP A;  2RIX A;  4FRD A;  2Y4J A;  2GGO A;  2V0J A;  2AES A;  1ZCU A;  2Y6P A;  1GX0 A;  1V84 A;  1OMZ A;  4CJC A;  1H5S A;  4P02 A;  2OEG A;  2RJ4 A;  3SXB A;  1H7G A;  3U2V A;  4B4G A;  4KNX A;  4FRM A;  4NAL A;  2ZU8 A;  4D0Z A;  1MP3 A;  1MC3 A;  2AGD A;  4E1K A;  2RJ5 A;  1INJ A;  5C3D A;  4NAK A;  3I0L A;  3RMW A;  3I0H A;  1ZI5 A;  3E26 A;  4Y63 A;  1HM9 A;  1ZI3 A;  4FRQ A;  1WSZ A;  3T7N A;  3OAM A;  2YQS A;  1ZJ1 A;  2Z87 A;  3JUK A;  4GBP A;  1ZDF A;  4L41 C;  1NWG B;  2YC5 A;  4Y7T A;  4CJB A;  2V0L A;  4EE5 A;  5CQP A;  4O6M A;  3RMV A;  1YRO B;  2X60 A;  5C3B A;  2QH5 A;  1H5S C;  4KRV A;  3ZGG A;  4FIX A;  1G3L A;  1JV1 A;  4AAW A;  2RIZ A;  1KWS A;  2AE7 A;  1O7Q A;  3LW6 A;  2X5S A;  2JCL A;  1G0R A;  1R7U A;  1PZT A;  2AH9 A;  3DUV A;  3U2X A;  2VSH A;  3TQD A;  4EEA A;  4ECM A;  2RJ8 A;  3I0C A;  5EJ1 A;  3ZLL A;  1I52 A;  1NHE B;  3R2W A;  4B3U A;  1H3M A;  2FFU A;  2YC3 A;  1LZI A;  3CGX A;  1S4P A;  5AJO A;  3F1C A;  3I0D A;  3OH0 A;  2AM5 A;  1G23 A;  1WT3 A;  4C2S A;  4LW3 A;  1NMM B;  2D7I A;  2W0V A;  1FXO A;  4B2X A;  1H7T A;  5C8R A;  5L6S A;  2D7R A;  1XZ6 A;  3I0F A;  1G9R A;  5FV9 A;  4Y6N A;  4BQH A;  1V82 A;  3SXC A;  1H7F A;  4FRA A;  3BRK X;  2WVK A;  3K8D A;  1FR9 A;  4O6N A;  1VZU A;  1VH3 A;  1R7V A;  5CQM X;  5CMG X;  1JVD A;  4LW6 A;  3CU0 A;  1GX4 A;  5CMF X;  2P73 A;  1W77 A;  2VS4 A;  3K8E A;  1INI A;  3I0I X;  1G97 A;  4DEC A;  2BO6 A;  2WVL A;  5C49 A;  5C1G A;  2YQJ A;  2X5Z A;  3SX7 A;  1ZJ0 A;  5C3A A;  3V0L A;  2RJ7 A;  4HCQ A;  2Y7A A;  3PKP A;  3ST8 A;  4KT7 A;  3HL3 A;  2NXV A;  4ZDQ A;  4EEG A;  4UEG A;  3U0Y A;  3OKR A;  4NAI A;  5FU0 A;  4D11 C;  2Q4J A;  5EJZ A;  2Y4L A;  2C0N A;  4AYL A;  1YP4 A;  3OC9 A;  5FTS A;  2P72 A;  4BMA A;  1QWJ A;  2WGZ A;  5C4C A;  4Y9X A;  2E8B A;  2VXL A;  4FCE A;  4MND A;  1GWW A;  1LL0 A;  1VIC A;  4KPX A;  1LVW A;  2BO8 A;  2Y4K A;  4Y62 A;  3SXA A;  1R81 A;  1JV3 A;  1H4C A;  4EVW A;  1FRW A;  4IRP A;  1VGU A;  4Y7V A;  2OI7 A;  4AC3 A;  1ZCV A;  2RJ1 A;  3E25 A;  4HO0 A;  1OQM B;  1G2V A;  4HO5 A;  2QKX A;  2WE9 A;  2GGQ A;  2I5K A;  4B42 A;  5CQL X;  5C38 A;  4EE4 A;  3N9W A;  4HO8 A;  4MIX A;  2OEF A;  5FUH A;  3CKV A;  5J49 A;  1SS9 A;  1NQI B;  2JCJ A;  1TW1 A;  1FOA A;  1ZI4 A;  1LL3 A;  5C1H A;  3T7M A;  5L6V A;  1E5K A;  3IOJ A;  3BCV A;  4D48 A;  2WAW A;  4K6R A;  3Q80 A;  4JD0 A;  5IDS A;  4M4K A;  4AYJ A;  2RJ9 A;  4B4B A;  1R7Y A;  1R7X A;  2O1G A;  3USQ A;  1VM8 A;  3V91 A;  1OMX A;  5HS2 A;  2V0K A;  3D98 A;  1NF5 B;  1GWV A;  1H5R B;  1FO9 A;  1ON8 A;  3T7O A;  1VGT A;  3CKO A;  2FY7 A;  3CKQ A;  2XMH A;  3V0P A;  3IOH A;  4B4M A;  4DDZ A;  2ICX A;  4KQL A;  2RIY A;  2RJ6 A;  2FYC B;  4D11 A;  2OI6 A;  3Q4S A;  1W55 A;  1ZIZ A;  3POL A;  5IFY A;  5FU8 A;  3U2W A;  1HM0 A;  3OH4 A;  1H7Q A;  1QGS A;  2E3D A;  1LL2 A;  2FYA A;  2O1H A;  1ZJO A;  2Z86 A;  1HM8 A;  1LZJ A;  2AM4 A;  4FRO A;  3ZF8 A;  5C36 A;  5C1L A;  3OH1 A;  3KIA A;  3V8Y A;  2FYB A;  1JYK A;  2I7B A;  4KC2 A;  1WVC A;  3DK5 A;  1H5T B;  2APC A;  4ASY A;  3EE5 A;  2BO7 A;  1R7T A;  4XWI A;  4KC1 A;  3Q7U A;  4FRE A;  3CKJ A;  4HO4 A;  5C4E A;  1LZ0 A;  2CU2 A;  1IIN A;  1VPA A;  1S4N A;  2DPW A;  4NAN A;  1WT0 A;  5DDV A;  1VGZ A;  1FR8 A;  1R80 A;  4EEO A;  1IIM A;  1FGG A;  5AJN A;  1O23 B;  1G8O A;  3JTJ A;  3V0Q A;  2XME A;  5JQQ A;  1H7L A;  2WVM A;  1QGQ A;  4ARW A;  2VK9 A;  2JCK A;  2A8U A;  1ON6 A;  1VGW A;  4HO3 A;  3V0M A;  3U2U A;  3USR A;  1MP5 A;  1ZJP A;  3I0K A;  1VZX A;  4YS8 A;  4DE7 A;  2PGY A;  1YP3 A;  3I0E A;  1V83 A;  3ZGF A;  3SXE A;  4G3Q A;  4G87 A;  5IDT A;  5CMH A;  3U2T A;  2YQC A;  4G3S A;  3GUE A;  1HV9 A;  1H4D A;  1G1L A;  5C47 A;  1GA8 A;  4P00 A;  4HOC A;  2D0J A;  4B5B A;  2VFZ A;  1ZCY A;  2O1F A;  3OH3 A;  4FQW A;  1ZDG A;  1FO8 A;  4M28 A;  4FCU A;  1H5S B;  2J0A A;  4Y64 A;  2V0I A;  2YQH A;  4ASJ A;  4FIY A;  3I0G A;  1FGX A;  5CMJ A;  1EYR A;  1S4O A;  5CQN X;  4HO2 A;  1G95 A;  2FYD B;  1FWY A;  2AEC A;  1TVY A;  2UX8 A;  1H5R A;  4M2B A;  3OGZ A;  5C4D A;  3V90 A;  4FRP A;  1W57 A;  5D92 A;  2XWL A;  4B2W A;  4HG6 A;  1ZJ3 A;  2P6W A;  2ZU7 A;  2QGI A;  1R82 A;  2XWN A;  4M2A A;  2PGV A;  4CJ8 A;  1XHB A;  3SX8 A;  2W0W A;  2X65 A;  4HO6 A;  2VS3 A;  4EEM A;  3DJ4 A;  1LZ7 A;  1Z90 A;  4MYB A;  4R7P A;  2PX7 A;  5DDT A;  1JVG A;  1FG5 N;  1GQ9 A;  1MP4 A;  3JUJ A; 
#chains in the Genus database with same CATH homology
 4IRQ A;  4FRB A;  3SPT A;  2J0B A;  3PKQ A;  1EZI A;  3U0X A;  1WT1 A;  3F1Y A;  5C4F A;  3FOQ A;  2VS5 A;  4Y7G A;  5CMI A;  3SX3 A;  2Y4M A;  3ZLK A;  1TW5 A;  2YCM A;  4J18 A;  3R3I A;  5FTV A;  1H5T A;  3QVB A;  3D5N A;  1ZHJ A;  1H7H A;  3V8Z A;  1NKH B;  4KPZ A;  4Y7U A;  5CQO A;  4KXO A;  1H7E A;  1WT2 A;  3CKN A;  5D91 A;  1VH1 A;  1JYL A;  1H4E A;  4Y7F A;  2AM3 A;  2BO4 A;  3D8V A;  2ICY A;  2RJ0 A;  2XWM A;  3FWW A;  2OI5 A;  1FXJ A;  1GQC A;  2FFV A;  1YP2 A;  2ZU9 A;  3PNN A;  2VSI A;  1K4V A;  2PA4 A;  3OH2 A;  1FZW A;  2RIT A;  5FYE A;  4CVH A;  5BXC A;  1HJL A;  1ZI1 A;  3SX5 A;  4D0T A;  1ZCT A;  2YES A;  4JIS A;  4EE3 A;  5C48 A;  2VD4 A;  5I1F A;  3V0O A;  5C4B A;  2A8W A;  4KNR A;  5EIY A;  1H5S D;  4Q7C A;  3SXD A;  3I0J A;  4Y6U A;  4G3P A;  3V0N A;  1PZY B;  1O0R A;  1ZJ2 A;  2V0H A;  2MZB A;  1TZF A;  4KC4 A;  3SXG A;  2JCO A;  4HO9 A;  3RSB A;  1QG8 A;  2I5E A;  1G93 A;  2VXM A;  3NGW A;  1O7O A;  2WEE A;  4FRH A;  1HJJ A;  3TZT A;  1VZT A;  3O3P A;  3IOI A;  4FRL A;  5AJP A;  2RIX A;  4FRD A;  2Y4J A;  2GGO A;  2V0J A;  2AES A;  1ZCU A;  2Y6P A;  1GX0 A;  1V84 A;  1OMZ A;  4CJC A;  1H5S A;  4P02 A;  2OEG A;  2RJ4 A;  3SXB A;  1H7G A;  3U2V A;  4B4G A;  4KNX A;  4FRM A;  4NAL A;  2ZU8 A;  4D0Z A;  1MP3 A;  1MC3 A;  2AGD A;  4E1K A;  2RJ5 A;  1INJ A;  5C3D A;  4NAK A;  3I0L A;  3RMW A;  3I0H A;  1ZI5 A;  3E26 A;  4Y63 A;  1HM9 A;  1ZI3 A;  4FRQ A;  1WSZ A;  3T7N A;  3OAM A;  2YQS A;  1ZJ1 A;  2Z87 A;  3JUK A;  4GBP A;  1ZDF A;  4L41 C;  1NWG B;  2YC5 A;  4Y7T A;  4CJB A;  2V0L A;  4EE5 A;  5CQP A;  4O6M A;  3RMV A;  1YRO B;  2X60 A;  5C3B A;  2QH5 A;  1H5S C;  4KRV A;  3ZGG A;  4FIX A;  1G3L A;  1JV1 A;  4AAW A;  2RIZ A;  1KWS A;  2AE7 A;  1O7Q A;  3LW6 A;  2X5S A;  2JCL A;  1G0R A;  1R7U A;  1PZT A;  2AH9 A;  3DUV A;  3U2X A;  2VSH A;  3TQD A;  4EEA A;  4ECM A;  2RJ8 A;  3I0C A;  5EJ1 A;  3ZLL A;  1I52 A;  1NHE B;  3R2W A;  4B3U A;  1H3M A;  2FFU A;  2YC3 A;  1LZI A;  3CGX A;  1S4P A;  5AJO A;  3F1C A;  3I0D A;  3OH0 A;  2AM5 A;  1G23 A;  1WT3 A;  4C2S A;  4LW3 A;  1NMM B;  2D7I A;  2W0V A;  1FXO A;  4B2X A;  1H7T A;  5C8R A;  5L6S A;  2D7R A;  1XZ6 A;  3I0F A;  1G9R A;  5FV9 A;  4Y6N A;  4BQH A;  1V82 A;  3SXC A;  1H7F A;  4FRA A;  3BRK X;  2WVK A;  3K8D A;  1FR9 A;  4O6N A;  1VZU A;  1VH3 A;  1R7V A;  5CQM X;  5CMG X;  1JVD A;  4LW6 A;  3CU0 A;  1GX4 A;  5CMF X;  2P73 A;  1W77 A;  2VS4 A;  3K8E A;  1INI A;  3I0I X;  1G97 A;  4DEC A;  2BO6 A;  2WVL A;  5C49 A;  5C1G A;  2YQJ A;  2X5Z A;  3SX7 A;  1ZJ0 A;  5C3A A;  3V0L A;  2RJ7 A;  4HCQ A;  2Y7A A;  3PKP A;  3ST8 A;  4KT7 A;  3HL3 A;  2NXV A;  4ZDQ A;  4EEG A;  4UEG A;  3U0Y A;  3OKR A;  4NAI A;  5FU0 A;  4D11 C;  2Q4J A;  5EJZ A;  2Y4L A;  2C0N A;  4AYL A;  1YP4 A;  3OC9 A;  5FTS A;  2P72 A;  4BMA A;  1QWJ A;  2WGZ A;  5C4C A;  4Y9X A;  2E8B A;  2VXL A;  4FCE A;  4MND A;  1GWW A;  1LL0 A;  1VIC A;  4KPX A;  1LVW A;  2BO8 A;  2Y4K A;  4Y62 A;  3SXA A;  1R81 A;  1JV3 A;  1H4C A;  4EVW A;  1FRW A;  4IRP A;  1VGU A;  4Y7V A;  2OI7 A;  4AC3 A;  1ZCV A;  2RJ1 A;  3E25 A;  4HO0 A;  1OQM B;  1G2V A;  4HO5 A;  2QKX A;  2WE9 A;  2GGQ A;  2I5K A;  4B42 A;  5CQL X;  5C38 A;  4EE4 A;  3N9W A;  4HO8 A;  4MIX A;  2OEF A;  5FUH A;  3CKV A;  5J49 A;  1SS9 A;  1NQI B;  2JCJ A;  1TW1 A;  1FOA A;  1ZI4 A;  1LL3 A;  5C1H A;  3T7M A;  5L6V A;  1E5K A;  3IOJ A;  3BCV A;  4D48 A;  2WAW A;  4K6R A;  3Q80 A;  4JD0 A;  5IDS A;  4M4K A;  4AYJ A;  2RJ9 A;  4B4B A;  1R7Y A;  1R7X A;  2O1G A;  3USQ A;  1VM8 A;  3V91 A;  1OMX A;  5HS2 A;  2V0K A;  3D98 A;  1NF5 B;  1GWV A;  1H5R B;  1FO9 A;  1ON8 A;  3T7O A;  1VGT A;  3CKO A;  2FY7 A;  3CKQ A;  2XMH A;  3V0P A;  3IOH A;  4B4M A;  4DDZ A;  2ICX A;  4KQL A;  2RIY A;  2RJ6 A;  2FYC B;  4D11 A;  2OI6 A;  3Q4S A;  1W55 A;  1ZIZ A;  3POL A;  5IFY A;  5FU8 A;  3U2W A;  1HM0 A;  3OH4 A;  1H7Q A;  1QGS A;  2E3D A;  1LL2 A;  2FYA A;  2O1H A;  1ZJO A;  2Z86 A;  1HM8 A;  1LZJ A;  2AM4 A;  4FRO A;  3ZF8 A;  5C36 A;  5C1L A;  3OH1 A;  3KIA A;  3V8Y A;  2FYB A;  1JYK A;  2I7B A;  4KC2 A;  1WVC A;  3DK5 A;  1H5T B;  2APC A;  4ASY A;  3EE5 A;  2BO7 A;  1R7T A;  4XWI A;  4KC1 A;  3Q7U A;  4FRE A;  3CKJ A;  4HO4 A;  5C4E A;  1LZ0 A;  2CU2 A;  1IIN A;  1VPA A;  1S4N A;  2DPW A;  4NAN A;  1WT0 A;  5DDV A;  1VGZ A;  1FR8 A;  1R80 A;  4EEO A;  1IIM A;  1FGG A;  5AJN A;  1O23 B;  1G8O A;  3JTJ A;  3V0Q A;  2XME A;  5JQQ A;  1H7L A;  2WVM A;  1QGQ A;  4ARW A;  2VK9 A;  2JCK A;  2A8U A;  1ON6 A;  1VGW A;  4HO3 A;  3V0M A;  3U2U A;  3USR A;  1MP5 A;  1ZJP A;  3I0K A;  1VZX A;  4YS8 A;  4DE7 A;  2PGY A;  1YP3 A;  3I0E A;  1V83 A;  3ZGF A;  3SXE A;  4G3Q A;  4G87 A;  5IDT A;  5CMH A;  3U2T A;  2YQC A;  4G3S A;  3GUE A;  1HV9 A;  1H4D A;  1G1L A;  5C47 A;  1GA8 A;  4P00 A;  4HOC A;  2D0J A;  4B5B A;  2VFZ A;  1ZCY A;  2O1F A;  3OH3 A;  4FQW A;  1ZDG A;  1FO8 A;  4M28 A;  4FCU A;  1H5S B;  2J0A A;  4Y64 A;  2V0I A;  2YQH A;  4ASJ A;  4FIY A;  3I0G A;  1FGX A;  5CMJ A;  1EYR A;  1S4O A;  5CQN X;  4HO2 A;  1G95 A;  2FYD B;  1FWY A;  2AEC A;  1TVY A;  2UX8 A;  1H5R A;  4M2B A;  3OGZ A;  5C4D A;  3V90 A;  4FRP A;  1W57 A;  5D92 A;  2XWL A;  4B2W A;  4HG6 A;  1ZJ3 A;  2P6W A;  2ZU7 A;  2QGI A;  1R82 A;  2XWN A;  4M2A A;  2PGV A;  4CJ8 A;  1XHB A;  3SX8 A;  2W0W A;  2X65 A;  4HO6 A;  2VS3 A;  4EEM A;  3DJ4 A;  1LZ7 A;  1Z90 A;  4MYB A;  4R7P A;  2PX7 A;  5DDT A;  1JVG A;  1FG5 N;  1GQ9 A;  1MP4 A;  3JUJ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...