4Y6UA

Mycobacterial protein
Total Genus 98
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
98
sequence length
304
structure length
280
Chain Sequence
ALPLDTTWHRPGWTIGELEAAKAGRTISVVLPALNEEATIESVIDSISPLVDGLVDELIVLDSGSTDDTEIRAIASGARVVSREQALPEVPVRPGKGEALWRSLAATSGDIVVFIDSDLINPHPLFVPWLVGPLLTGEGIQLVKSFYRGGRVTELVARPLLAALRPELGCVLQPLSGEYAASRELLTSLPFAPGYGVEIGLLIDTFDRLGLDAIAQVNLGVRAHRNRPLDELGAMSRQVIATLLSRCGIPDSGVGLTQFLYTRHTWPVSLVDRPPMKVMR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords Glucosyl-3-phosphoglycerate synthase
publication title A Native Ternary Complex Trapped in a Crystal Reveals the Catalytic Mechanism of a Retaining Glycosyltransferase.
pubmed doi rcsb
source organism Mycobacterium tuberculosis (strain atcc 25618 / h37rv)
total genus 98
structure length 280
sequence length 304
ec nomenclature ec 2.4.1.266: Glucosyl-3-phosphoglycerate synthase.
pdb deposition date 2015-02-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00535 Glycos_transf_2 Glycosyl transferase family 2
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.550.10 Alpha Beta Alpha-Beta Complex Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A 4y6uA00
4GBPA 2D0JA 1O23B 3ZF8A 3V0NA 3U0YA 1GQ9A 5FUHA 1GX4A 2YQHA 2VSIA 4LW3A 2X60A 4UEGA 2PGYA 5CMGX 1ON6A 4EEGA 4HCQA 1GX0A 5AJOA 5DDVA 3V0LA 1FGXA 1ZCYA 1XHBA 3V0PA 2VXLA 1WT1A 4D48A 4G3PA 1MP3A 2AECA 1ZCUA 3CGXA 4KQLA 4JISA 1G93A 1QG8A 3V8YA 3FWWA 1WT0A 1FOAA 3ZLKA 3SX5A 2YQJA 2BO6A 1FG5N 1GWWA 3T7MA 4FRAA 1HM9A 3JTJA 3IOJA 1LZJA 3V91A 1H5RA 2YC3A 1HJJA 3DK5A 1H3MA 3V0OA 4C2SA 1H7GA 4LW6A 4EVWA 3SPTA 1VGWA 1VICA 1QWJA 1NF5B 3OKRA 2CU2A 1HM0A 1H7LA 4NAIA 2X5SA 1I52A 5C4EA 4FROA 4DE7A 2RJ1A 1JVDA 4FCEA 5J49A 5L6VA 1G9RA 3ZGGA 4BQHA 2OI5A 2FY7A 2ZU8A 5C3BA 4NALA 3R3IA 4HO5A 1G3LA 1LL0A 5CQOA 2RJ5A 1R7UA 5EJ1A 2RJ7A 3T7NA 1JVGA 4Y7UA 5C4DA 2VS5A 2WVKA 3SXDA 1G23A 1O7QA 5CMIA 1GA8A 4ZDQA 1R82A 1ZDGA 4Y64A 3LW6A 5L6SA 4HO2A 1JV1A 3KIAA 3DUVA 1ZJ1A 1VM8A 5C3AA 4B2XA 4B2WA 2RJ9A 4XWIA 5I1FA 3E25A 2YQSA 4M2AA 1ZI5A 2OEFA 2WVMA 4ARWA 1YP2A 2GGOA 4YS8A 3RMVA 4KPZA 1VZUA 2P72A 4FRBA 5CMJA 1FXOA 1INIA 4CJCA 4D11C 4R7PA 1O7OA 5FTSA 4IRQA 1ZHJA 1KWSA 1NKHB 3OH1A 1R81A 1R7VA 2E3DA 3CKOA 1LL2A 1WT2A 2W0WA 5AJPA 3I0GA 2V0KA 2O1GA 2FYCB 1VZTA 4IRPA 4FRDA 4FREA 2WVLA 1ZI4A 4KC4A 2Y6PA 2VS3A 2MZBA 2RJ0A 2V0HA 4CVHA 5C36A 1H7HA 1ZJ3A 2XWMA 1MP4A 2JCLA 1FO8A 1WVCA 3SXCA 2Z86A 1SS9A 4J18A 1ON8A 2Z87A 2W0VA 4BMAA 4FRPA 1W55A 1LZIA 2Y7AA 1O0RA 1H5SB 1VH3A 2ICXA 1HJLA 2APCA 4G87A 3FOQA 2AM5A 5C49A 4EEAA 3O3PA 4FRHA 1W57A 3U2UA 4FRQA 1FZWA 1G0RA 2VSHA 1VGTA 3U2WA 4HO3A 2VD4A 3Q4SA 3BRKX 3U2XA 5DDTA 3ZGFA 5C47A 2BO7A 3USRA 3RMWA 4DDZA 3POLA 3EE5A 1FRWA 2O1HA 3R2WA 3I0JA 1FGGA 2D7IA 4NANA 2QGIA 1H7FA 2Y4MA 2FYAA 4KNXA 2NXVA 2AESA 2VFZA 5CQMX 4HO9A 2RJ4A 1JV3A 3F1CA 1ZCTA 4HOCA 2YQCA 2YC5A 1YP4A 4HO8A 2WGZA 1EZIA 1NMMB 4Y6UA 2I5EA 1OQMB 1H5TB 4Y62A 2FYBA 2O1FA 2ICYA 4NAKA 3HL3A 2RJ8A 1VZXA 5FYEA 2OEGA 3OC9A 3PKPA 2I5KA 4DECA 1HM8A 1LL3A 4Y7FA 5C1GA 4ECMA 4FCUA 4KT7A 3D98A 4EEMA 3V0MA 1VPAA 4B42A 2GGQA 3I0LA 1NWGB 3BCVA 3OH4A 4K6RA 5IFYA 2V0JA 4KC1A 1XZ6A 5C4CA 1OMZA 1ZI1A 1TW1A 5CQNX 3Q80A 3QVBA 3OAMA 4MNDA 4M2BA 1FR8A 3JUJA 1ZJ0A 2VS4A 5FU8A 3OH2A 4EEOA 4EE3A 3SX7A 3V90A 3I0IX 4JD0A 1S4NA 1GWVA 4Y7VA 2A8UA 1H7EA 5C4FA 1GQCA 2JCJA 2Y4KA 5FV9A 4Y9XA 3RSBA 1G2VA 2YESA 2QH5A 4HO0A 4HG6A 3K8DA 1H4CA 4L41C 3USQA 1ZCVA 3CKJA 5C1LA 2PX7A 2ZU7A 4D0ZA 4Y7GA 5HS2A 2A8WA 2V0IA 1FXJA 2JCKA 3I0CA 4G3SA 1H5SC 3SXGA 5CQLX 4D11A 4P00A 1ZJ2A 3SXEA 3TQDA 1MP5A 2BO4A 2ZU9A 3U0XA 1ZJPA 1OMXA 4FQWA 4HO6A 2WEEA 3I0EA 5FTVA 1VGUA 5C48A 2JCOA 1R7YA 1ZJOA 3SXAA 3T7OA 2V0LA 1INJA 1HV9A 1NQIB 2RJ6A 4KXOA 2XWNA 1TZFA 4B4MA 2X65A 1G97A 1ZIZA 2FFUA 2P73A 4AYLA 2RITA 3CKNA 2QKXA 2Y4JA 2Y4LA 1W77A 5AJNA 1LZ7A 2VXMA 3I0DA 1LZ0A 1YP3A 1S4OA 4B3UA 3CKVA 4M28A 2XMEA 4AAWA 2AM4A 4G3QA 4ASYA 1EYRA 3F1YA 2AGDA 2E8BA 1TW5A 5CQPA 5C1HA 1R80A 1H4DA 4Y7TA 1LVWA 4B4GA 1H5TA 4B4BA 1V82A 4AYJA 1R7TA 1WT3A 4KC2A 4Y6NA 3DJ4A 4KPXA 4KNRA 3CKQA 3OH0A 3V8ZA 3CU0A 2XWLA 3I0KA 1QGQA 1IINA 1H5RB 1IIMA 3OH3A 5CMFX 4B5BA 2FFVA 2UX8A 4KRVA 5BXCA 1VH1A 5CMHA 1FO9A 2RIZA 5C38A 3GUEA 3U2TA 2OI7A 2RIXA 4E1KA 2RIYA 3N9WA 4AC3A 1K4VA 4CJ8A 5C4BA 4D0TA 4M4KA 4Y63A 3PNNA 1ZDFA 3NGWA 3ST8A 5C8RA 3IOIA 3ZLLA 2YCMA 1TVYA 2AM3A 1H7QA 1MC3A 3PKQA 3E26A 2DPWA 2PA4A 4EE4A 1H5SD 1YROB 1V84A 2FYDB 1G8OA 5EJZA 3I0FA 5EIYA 3TZTA 1E5KA 5JQQA 1JYKA 2AH9A 4ASJA 4FRLA 2D7RA 3SXBA 1ZI3A 2I7BA 1H7TA 2PGVA 3SX3A 3Q7UA 2WAWA 1PZTA 1G1LA 5IDTA 5C3DA 1JYLA 1VGZA 1WSZA 1G95A 4MYBA 4P02A 4EE5A 2OI6A 2X5ZA 2XMHA 1R7XA 3SX8A 2P6WA 3D5NA 2Q4JA 1FR9A 5FU0A 3JUKA 3K8EA 1QGSA 1H4EA 2AE7A 3OGZA 5IDSA 4CJBA 1S4PA 1Z90A 1NHEB 3V0QA 2WE9A 1H5SA 3I0HA 1V83A 1PZYB 3IOHA 2BO8A 4FRMA 3U2VA 4HO4A 1FWYA 3D8VA
chains in the Genus database with same CATH superfamily
4GBPA 2D0JA 1O23B 3ZF8A 3V0NA 3U0YA 1GQ9A 5FUHA 1GX4A 2YQHA 2VSIA 4LW3A 2X60A 4UEGA 2PGYA 5CMGX 1ON6A 4EEGA 4HCQA 1GX0A 5AJOA 5DDVA 3V0LA 1FGXA 1ZCYA 1XHBA 3V0PA 2VXLA 1WT1A 4D48A 4G3PA 1MP3A 2AECA 1ZCUA 3CGXA 4KQLA 4JISA 1G93A 1QG8A 3V8YA 3FWWA 1WT0A 1FOAA 3ZLKA 3SX5A 2C0NA 2YQJA 2BO6A 1FG5N 1GWWA 3T7MA 4FRAA 1HM9A 3JTJA 3IOJA 1LZJA 3V91A 1H5RA 2YC3A 1HJJA 3DK5A 1H3MA 3V0OA 4C2SA 1H7GA 4LW6A 4EVWA 3SPTA 1VGWA 1VICA 1QWJA 1NF5B 3OKRA 2CU2A 1HM0A 1H7LA 4NAIA 2X5SA 1I52A 5C4EA 4FROA 4DE7A 2RJ1A 1JVDA 4FCEA 5J49A 5L6VA 1G9RA 3ZGGA 4BQHA 2OI5A 2FY7A 2ZU8A 5C3BA 4NALA 3R3IA 4HO5A 1G3LA 1LL0A 5CQOA 2RJ5A 1R7UA 5EJ1A 2RJ7A 3T7NA 1JVGA 4Y7UA 5C4DA 2VS5A 2WVKA 3SXDA 1G23A 1O7QA 5CMIA 1GA8A 4ZDQA 1R82A 1ZDGA 4O6NA 4Y64A 3LW6A 5L6SA 4HO2A 1JV1A 3KIAA 3DUVA 1ZJ1A 1VM8A 5C3AA 4B2XA 4B2WA 2RJ9A 4XWIA 5I1FA 3E25A 2YQSA 4M2AA 1ZI5A 2OEFA 2WVMA 4ARWA 4MIXA 1YP2A 2GGOA 4YS8A 3RMVA 4KPZA 1VZUA 2P72A 4FRBA 5CMJA 1FXOA 1INIA 4CJCA 4D11C 4R7PA 1O7OA 5FTSA 4IRQA 2J0AA 1ZHJA 1KWSA 1NKHB 3OH1A 1R81A 1R7VA 2E3DA 3CKOA 1LL2A 1WT2A 2W0WA 5AJPA 4FIYA 3I0GA 2V0KA 2O1GA 2FYCB 1VZTA 4IRPA 4FRDA 4FREA 2WVLA 1ZI4A 4KC4A 2VK9A 2Y6PA 2VS3A 2MZBA 2RJ0A 2V0HA 4CVHA 5C36A 1H7HA 1ZJ3A 2XWMA 1MP4A 2JCLA 1FO8A 1WVCA 3SXCA 2Z86A 1SS9A 4J18A 1ON8A 2Z87A 2W0VA 4BMAA 4FRPA 1W55A 1LZIA 2Y7AA 4FIXA 1O0RA 1H5SB 1VH3A 2ICXA 1HJLA 2APCA 4G87A 3FOQA 2AM5A 5C49A 4EEAA 3O3PA 4FRHA 1W57A 3U2UA 4FRQA 1FZWA 1G0RA 2VSHA 1VGTA 3U2WA 4HO3A 2VD4A 3Q4SA 3BRKX 3U2XA 5DDTA 3ZGFA 5C47A 2BO7A 3USRA 3RMWA 4DDZA 3POLA 3EE5A 1FRWA 2O1HA 3R2WA 3I0JA 1FGGA 2D7IA 4NANA 2QGIA 1H7FA 2Y4MA 2FYAA 4KNXA 2NXVA 2AESA 2VFZA 5CQMX 4HO9A 2RJ4A 1JV3A 3F1CA 1ZCTA 4HOCA 2YQCA 2YC5A 1YP4A 4HO8A 2WGZA 1EZIA 1NMMB 4Y6UA 2I5EA 1OQMB 1H5TB 4Y62A 2FYBA 2O1FA 2ICYA 4NAKA 3HL3A 2RJ8A 1VZXA 5FYEA 2OEGA 3OC9A 3PKPA 2I5KA 4DECA 1HM8A 1LL3A 4Y7FA 5C1GA 4ECMA 4FCUA 4KT7A 3D98A 4EEMA 3V0MA 1VPAA 4B42A 2GGQA 3I0LA 1NWGB 3BCVA 3OH4A 4K6RA 5IFYA 2V0JA 4KC1A 1XZ6A 5C4CA 1OMZA 1ZI1A 1TW1A 5CQNX 3Q80A 3QVBA 3OAMA 4MNDA 4M2BA 1FR8A 3JUJA 1ZJ0A 2VS4A 5FU8A 3OH2A 4EEOA 4EE3A 3SX7A 3V90A 3I0IX 4JD0A 1S4NA 1GWVA 4Y7VA 2A8UA 1H7EA 4Q7CA 5C4FA 1GQCA 2JCJA 2Y4KA 5FV9A 4Y9XA 3RSBA 1G2VA 2YESA 2QH5A 4HO0A 4HG6A 3K8DA 1H4CA 4L41C 3USQA 1ZCVA 3CKJA 5C1LA 2PX7A 2ZU7A 4D0ZA 4Y7GA 5HS2A 2A8WA 2V0IA 1FXJA 2JCKA 3I0CA 4G3SA 1H5SC 3SXGA 5CQLX 4D11A 4P00A 1ZJ2A 3SXEA 3TQDA 1MP5A 2BO4A 2ZU9A 3U0XA 1ZJPA 1OMXA 4FQWA 4HO6A 2WEEA 3I0EA 5FTVA 1VGUA 5C48A 2JCOA 1R7YA 1ZJOA 3SXAA 3T7OA 2V0LA 1INJA 1HV9A 1NQIB 2RJ6A 4KXOA 2XWNA 1TZFA 4B4MA 2X65A 1G97A 1ZIZA 2FFUA 2P73A 4AYLA 2RITA 3CKNA 2QKXA 2Y4JA 2Y4LA 1W77A 5AJNA 1LZ7A 2VXMA 3I0DA 1LZ0A 1YP3A 1S4OA 4B3UA 3CKVA 4M28A 2XMEA 4AAWA 2AM4A 4G3QA 5D92A 4ASYA 1EYRA 3F1YA 2AGDA 2E8BA 1TW5A 5CQPA 5C1HA 1R80A 1H4DA 4Y7TA 1LVWA 4B4GA 1H5TA 4B4BA 1V82A 4AYJA 1R7TA 1WT3A 4KC2A 4Y6NA 3DJ4A 4KPXA 4KNRA 3CKQA 3OH0A 3V8ZA 3CU0A 2XWLA 3I0KA 1QGQA 1IINA 1H5RB 1IIMA 3OH3A 5CMFX 4B5BA 2FFVA 2UX8A 4KRVA 5BXCA 1VH1A 5CMHA 1FO9A 2RIZA 5C38A 3GUEA 3U2TA 2OI7A 2RIXA 4E1KA 2RIYA 3N9WA 4AC3A 1K4VA 4CJ8A 5C4BA 4D0TA 4M4KA 4Y63A 3PNNA 1ZDFA 3NGWA 3ST8A 5C8RA 3IOIA 3ZLLA 2YCMA 1TVYA 2AM3A 1H7QA 1MC3A 3PKQA 4O6MA 3E26A 2DPWA 2PA4A 4EE4A 1H5SD 1YROB 1V84A 2FYDB 1G8OA 5EJZA 3I0FA 5EIYA 3TZTA 1E5KA 5JQQA 1JYKA 2AH9A 4ASJA 4FRLA 2D7RA 3SXBA 1ZI3A 2I7BA 1H7TA 2PGVA 3SX3A 3Q7UA 2WAWA 1PZTA 1G1LA 5IDTA 5C3DA 1JYLA 1VGZA 1WSZA 1G95A 4MYBA 4P02A 4EE5A 2OI6A 2X5ZA 2XMHA 1R7XA 2J0BA 3SX8A 5D91A 2P6WA 3D5NA 2Q4JA 1FR9A 5FU0A 3JUKA 3K8EA 1QGSA 1H4EA 2AE7A 3OGZA 5IDSA 4CJBA 1S4PA 1Z90A 1NHEB 3V0QA 2WE9A 1H5SA 3I0HA 1V83A 1PZYB 3IOHA 2BO8A 4FRMA 3U2VA 4HO4A 1FWYA 3D8VA
chains in the Genus database with same CATH topology
4GBPA 2D0JA 1O23B 3ZF8A 3V0NA 3U0YA 1GQ9A 5FUHA 1GX4A 2YQHA 2VSIA 4LW3A 2X60A 4UEGA 2PGYA 5CMGX 1ON6A 4EEGA 4HCQA 1GX0A 5AJOA 5DDVA 3V0LA 1FGXA 1ZCYA 1XHBA 3V0PA 2VXLA 1WT1A 4D48A 4G3PA 1MP3A 2AECA 1ZCUA 3CGXA 4KQLA 4JISA 1G93A 1QG8A 3V8YA 3FWWA 1WT0A 1FOAA 3ZLKA 3SX5A 2C0NA 2YQJA 2BO6A 1FG5N 1GWWA 3T7MA 4FRAA 1HM9A 3JTJA 3IOJA 1LZJA 3V91A 1H5RA 2YC3A 1HJJA 3DK5A 1H3MA 3V0OA 4C2SA 1H7GA 4LW6A 4EVWA 3SPTA 1VGWA 1VICA 1QWJA 1NF5B 3OKRA 2CU2A 1HM0A 1H7LA 4NAIA 2X5SA 1I52A 5C4EA 4FROA 4DE7A 2RJ1A 1JVDA 4FCEA 5J49A 5L6VA 1G9RA 3ZGGA 4BQHA 2OI5A 2FY7A 2ZU8A 5C3BA 4NALA 3R3IA 4HO5A 1G3LA 1LL0A 5CQOA 2RJ5A 1R7UA 5EJ1A 2RJ7A 3T7NA 1JVGA 4Y7UA 5C4DA 2VS5A 2WVKA 3SXDA 1G23A 1O7QA 5CMIA 1GA8A 4ZDQA 1R82A 1ZDGA 4O6NA 4Y64A 3LW6A 5L6SA 4HO2A 1JV1A 3KIAA 3DUVA 1ZJ1A 1VM8A 5C3AA 4B2XA 4B2WA 2RJ9A 4XWIA 5I1FA 3E25A 2YQSA 4M2AA 1ZI5A 2OEFA 2WVMA 4ARWA 4MIXA 1YP2A 2GGOA 4YS8A 3RMVA 4KPZA 1VZUA 2P72A 4FRBA 5CMJA 1FXOA 1INIA 4CJCA 4D11C 4R7PA 1O7OA 5FTSA 4IRQA 2J0AA 1ZHJA 1KWSA 1NKHB 3OH1A 1R81A 1R7VA 2E3DA 3CKOA 1LL2A 1WT2A 2W0WA 5AJPA 4FIYA 3I0GA 2V0KA 2O1GA 2FYCB 1VZTA 4IRPA 4FRDA 4FREA 2WVLA 1ZI4A 4KC4A 2VK9A 2Y6PA 2VS3A 2MZBA 2RJ0A 2V0HA 4CVHA 5C36A 1H7HA 1ZJ3A 2XWMA 1MP4A 2JCLA 1FO8A 1WVCA 3SXCA 2Z86A 1SS9A 4J18A 1ON8A 2Z87A 2W0VA 4BMAA 4FRPA 1W55A 1LZIA 2Y7AA 4FIXA 1O0RA 1H5SB 1VH3A 2ICXA 1HJLA 2APCA 4G87A 3FOQA 2AM5A 5C49A 4EEAA 3O3PA 4FRHA 1W57A 3U2UA 4FRQA 1FZWA 1G0RA 2VSHA 1VGTA 3U2WA 4HO3A 2VD4A 3Q4SA 3BRKX 3U2XA 5DDTA 3ZGFA 5C47A 2BO7A 3USRA 3RMWA 4DDZA 3POLA 3EE5A 1FRWA 2O1HA 3R2WA 3I0JA 1FGGA 2D7IA 4NANA 2QGIA 1H7FA 2Y4MA 2FYAA 4KNXA 2NXVA 2AESA 2VFZA 5CQMX 4HO9A 2RJ4A 1JV3A 3F1CA 1ZCTA 4HOCA 2YQCA 2YC5A 1YP4A 4HO8A 2WGZA 1EZIA 1NMMB 4Y6UA 2I5EA 1OQMB 1H5TB 4Y62A 2FYBA 2O1FA 2ICYA 4NAKA 3HL3A 2RJ8A 1VZXA 5FYEA 2OEGA 3OC9A 3PKPA 2I5KA 4DECA 1HM8A 1LL3A 4Y7FA 5C1GA 4ECMA 4FCUA 4KT7A 3D98A 4EEMA 3V0MA 1VPAA 4B42A 2GGQA 3I0LA 1NWGB 3BCVA 3OH4A 4K6RA 5IFYA 2V0JA 4KC1A 1XZ6A 5C4CA 1OMZA 1ZI1A 1TW1A 5CQNX 3Q80A 3QVBA 3OAMA 4MNDA 4M2BA 1FR8A 3JUJA 1ZJ0A 2VS4A 5FU8A 3OH2A 4EEOA 4EE3A 3SX7A 3V90A 3I0IX 4JD0A 1S4NA 1GWVA 4Y7VA 2A8UA 1H7EA 4Q7CA 5C4FA 1GQCA 2JCJA 2Y4KA 5FV9A 4Y9XA 3RSBA 1G2VA 2YESA 2QH5A 4HO0A 4HG6A 3K8DA 1H4CA 4L41C 3USQA 1ZCVA 3CKJA 5C1LA 2PX7A 2ZU7A 4D0ZA 4Y7GA 5HS2A 2A8WA 2V0IA 1FXJA 2JCKA 3I0CA 4G3SA 1H5SC 3SXGA 5CQLX 4D11A 4P00A 1ZJ2A 3SXEA 3TQDA 1MP5A 2BO4A 2ZU9A 3U0XA 1ZJPA 1OMXA 4FQWA 4HO6A 2WEEA 3I0EA 5FTVA 1VGUA 5C48A 2JCOA 1R7YA 1ZJOA 3SXAA 3T7OA 2V0LA 1INJA 1HV9A 1NQIB 2RJ6A 4KXOA 2XWNA 1TZFA 4B4MA 2X65A 1G97A 1ZIZA 2FFUA 2P73A 4AYLA 2RITA 3CKNA 2QKXA 2Y4JA 2Y4LA 1W77A 5AJNA 1LZ7A 2VXMA 3I0DA 1LZ0A 1YP3A 1S4OA 4B3UA 3CKVA 4M28A 2XMEA 4AAWA 2AM4A 4G3QA 5D92A 4ASYA 1EYRA 3F1YA 2AGDA 2E8BA 1TW5A 5CQPA 5C1HA 1R80A 1H4DA 4Y7TA 1LVWA 4B4GA 1H5TA 4B4BA 1V82A 4AYJA 1R7TA 1WT3A 4KC2A 4Y6NA 3DJ4A 4KPXA 4KNRA 3CKQA 3OH0A 3V8ZA 3CU0A 2XWLA 3I0KA 1QGQA 1IINA 1H5RB 1IIMA 3OH3A 5CMFX 4B5BA 2FFVA 2UX8A 4KRVA 5BXCA 1VH1A 5CMHA 1FO9A 2RIZA 5C38A 3GUEA 3U2TA 2OI7A 2RIXA 4E1KA 2RIYA 3N9WA 4AC3A 1K4VA 4CJ8A 5C4BA 4D0TA 4M4KA 4Y63A 3PNNA 1ZDFA 3NGWA 3ST8A 5C8RA 3IOIA 3ZLLA 2YCMA 1TVYA 2AM3A 1H7QA 1MC3A 3PKQA 4O6MA 3E26A 2DPWA 2PA4A 4EE4A 1H5SD 1YROB 1V84A 2FYDB 1G8OA 5EJZA 3I0FA 5EIYA 3TZTA 1E5KA 5JQQA 1JYKA 2AH9A 4ASJA 4FRLA 2D7RA 3SXBA 1ZI3A 2I7BA 1H7TA 2PGVA 3SX3A 3Q7UA 2WAWA 1PZTA 1G1LA 5IDTA 5C3DA 1JYLA 1VGZA 1WSZA 1G95A 4MYBA 4P02A 4EE5A 2OI6A 2X5ZA 2XMHA 1R7XA 2J0BA 3SX8A 5D91A 2P6WA 3D5NA 2Q4JA 1FR9A 5FU0A 3JUKA 3K8EA 1QGSA 1H4EA 2AE7A 3OGZA 5IDSA 4CJBA 1S4PA 1Z90A 1NHEB 3V0QA 2WE9A 1H5SA 3I0HA 1V83A 1PZYB 3IOHA 2BO8A 4FRMA 3U2VA 4HO4A 1FWYA 3D8VA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4GBP A;  2D0J A;  1O23 B;  3ZF8 A;  3V0N A;  3U0Y A;  1GQ9 A;  5FUH A;  1GX4 A;  2YQH A;  2VSI A;  4LW3 A;  2X60 A;  4UEG A;  2PGY A;  5CMG X;  1ON6 A;  4EEG A;  4HCQ A;  1GX0 A;  5AJO A;  5DDV A;  3V0L A;  1FGX A;  1ZCY A;  1XHB A;  3V0P A;  2VXL A;  1WT1 A;  4D48 A;  4G3P A;  1MP3 A;  2AEC A;  1ZCU A;  3CGX A;  4KQL A;  4JIS A;  1G93 A;  1QG8 A;  3V8Y A;  3FWW A;  1WT0 A;  1FOA A;  3ZLK A;  3SX5 A;  2YQJ A;  2BO6 A;  1FG5 N;  1GWW A;  3T7M A;  4FRA A;  1HM9 A;  3JTJ A;  3IOJ A;  1LZJ A;  3V91 A;  1H5R A;  2YC3 A;  1HJJ A;  3DK5 A;  1H3M A;  3V0O A;  4C2S A;  1H7G A;  4LW6 A;  4EVW A;  3SPT A;  1VGW A;  1VIC A;  1QWJ A;  1NF5 B;  3OKR A;  2CU2 A;  1HM0 A;  1H7L A;  4NAI A;  2X5S A;  1I52 A;  5C4E A;  4FRO A;  4DE7 A;  2RJ1 A;  1JVD A;  4FCE A;  5J49 A;  5L6V A;  1G9R A;  3ZGG A;  4BQH A;  2OI5 A;  2FY7 A;  2ZU8 A;  5C3B A;  4NAL A;  3R3I A;  4HO5 A;  1G3L A;  1LL0 A;  5CQO A;  2RJ5 A;  1R7U A;  5EJ1 A;  2RJ7 A;  3T7N A;  1JVG A;  4Y7U A;  5C4D A;  2VS5 A;  2WVK A;  3SXD A;  1G23 A;  1O7Q A;  5CMI A;  1GA8 A;  4ZDQ A;  1R82 A;  1ZDG A;  4Y64 A;  3LW6 A;  5L6S A;  4HO2 A;  1JV1 A;  3KIA A;  3DUV A;  1ZJ1 A;  1VM8 A;  5C3A A;  4B2X A;  4B2W A;  2RJ9 A;  4XWI A;  5I1F A;  3E25 A;  2YQS A;  4M2A A;  1ZI5 A;  2OEF A;  2WVM A;  4ARW A;  1YP2 A;  2GGO A;  4YS8 A;  3RMV A;  4KPZ A;  1VZU A;  2P72 A;  4FRB A;  5CMJ A;  1FXO A;  1INI A;  4CJC A;  4D11 C;  4R7P A;  1O7O A;  5FTS A;  4IRQ A;  1ZHJ A;  1KWS A;  1NKH B;  3OH1 A;  1R81 A;  1R7V A;  2E3D A;  3CKO A;  1LL2 A;  1WT2 A;  2W0W A;  5AJP A;  3I0G A;  2V0K A;  2O1G A;  2FYC B;  1VZT A;  4IRP A;  4FRD A;  4FRE A;  2WVL A;  1ZI4 A;  4KC4 A;  2Y6P A;  2VS3 A;  2MZB A;  2RJ0 A;  2V0H A;  4CVH A;  5C36 A;  1H7H A;  1ZJ3 A;  2XWM A;  1MP4 A;  2JCL A;  1FO8 A;  1WVC A;  3SXC A;  2Z86 A;  1SS9 A;  4J18 A;  1ON8 A;  2Z87 A;  2W0V A;  4BMA A;  4FRP A;  1W55 A;  1LZI A;  2Y7A A;  1O0R A;  1H5S B;  1VH3 A;  2ICX A;  1HJL A;  2APC A;  4G87 A;  3FOQ A;  2AM5 A;  5C49 A;  4EEA A;  3O3P A;  4FRH A;  1W57 A;  3U2U A;  4FRQ A;  1FZW A;  1G0R A;  2VSH A;  1VGT A;  3U2W A;  4HO3 A;  2VD4 A;  3Q4S A;  3BRK X;  3U2X A;  5DDT A;  3ZGF A;  5C47 A;  2BO7 A;  3USR A;  3RMW A;  4DDZ A;  3POL A;  3EE5 A;  1FRW A;  2O1H A;  3R2W A;  3I0J A;  1FGG A;  2D7I A;  4NAN A;  2QGI A;  1H7F A;  2Y4M A;  2FYA A;  4KNX A;  2NXV A;  2AES A;  2VFZ A;  5CQM X;  4HO9 A;  2RJ4 A;  1JV3 A;  3F1C A;  1ZCT A;  4HOC A;  2YQC A;  2YC5 A;  1YP4 A;  4HO8 A;  2WGZ A;  1EZI A;  1NMM B;  4Y6U A;  2I5E A;  1OQM B;  1H5T B;  4Y62 A;  2FYB A;  2O1F A;  2ICY A;  4NAK A;  3HL3 A;  2RJ8 A;  1VZX A;  5FYE A;  2OEG A;  3OC9 A;  3PKP A;  2I5K A;  4DEC A;  1HM8 A;  1LL3 A;  4Y7F A;  5C1G A;  4ECM A;  4FCU A;  4KT7 A;  3D98 A;  4EEM A;  3V0M A;  1VPA A;  4B42 A;  2GGQ A;  3I0L A;  1NWG B;  3BCV A;  3OH4 A;  4K6R A;  5IFY A;  2V0J A;  4KC1 A;  1XZ6 A;  5C4C A;  1OMZ A;  1ZI1 A;  1TW1 A;  5CQN X;  3Q80 A;  3QVB A;  3OAM A;  4MND A;  4M2B A;  1FR8 A;  3JUJ A;  1ZJ0 A;  2VS4 A;  5FU8 A;  3OH2 A;  4EEO A;  4EE3 A;  3SX7 A;  3V90 A;  3I0I X;  4JD0 A;  1S4N A;  1GWV A;  4Y7V A;  2A8U A;  1H7E A;  5C4F A;  1GQC A;  2JCJ A;  2Y4K A;  5FV9 A;  4Y9X A;  3RSB A;  1G2V A;  2YES A;  2QH5 A;  4HO0 A;  4HG6 A;  3K8D A;  1H4C A;  4L41 C;  3USQ A;  1ZCV A;  3CKJ A;  5C1L A;  2PX7 A;  2ZU7 A;  4D0Z A;  4Y7G A;  5HS2 A;  2A8W A;  2V0I A;  1FXJ A;  2JCK A;  3I0C A;  4G3S A;  1H5S C;  3SXG A;  5CQL X;  4D11 A;  4P00 A;  1ZJ2 A;  3SXE A;  3TQD A;  1MP5 A;  2BO4 A;  2ZU9 A;  3U0X A;  1ZJP A;  1OMX A;  4FQW A;  4HO6 A;  2WEE A;  3I0E A;  5FTV A;  1VGU A;  5C48 A;  2JCO A;  1R7Y A;  1ZJO A;  3SXA A;  3T7O A;  2V0L A;  1INJ A;  1HV9 A;  1NQI B;  2RJ6 A;  4KXO A;  2XWN A;  1TZF A;  4B4M A;  2X65 A;  1G97 A;  1ZIZ A;  2FFU A;  2P73 A;  4AYL A;  2RIT A;  3CKN A;  2QKX A;  2Y4J A;  2Y4L A;  1W77 A;  5AJN A;  1LZ7 A;  2VXM A;  3I0D A;  1LZ0 A;  1YP3 A;  1S4O A;  4B3U A;  3CKV A;  4M28 A;  2XME A;  4AAW A;  2AM4 A;  4G3Q A;  4ASY A;  1EYR A;  3F1Y A;  2AGD A;  2E8B A;  1TW5 A;  5CQP A;  5C1H A;  1R80 A;  1H4D A;  4Y7T A;  1LVW A;  4B4G A;  1H5T A;  4B4B A;  1V82 A;  4AYJ A;  1R7T A;  1WT3 A;  4KC2 A;  4Y6N A;  3DJ4 A;  4KPX A;  4KNR A;  3CKQ A;  3OH0 A;  3V8Z A;  3CU0 A;  2XWL A;  3I0K A;  1QGQ A;  1IIN A;  1H5R B;  1IIM A;  3OH3 A;  5CMF X;  4B5B A;  2FFV A;  2UX8 A;  4KRV A;  5BXC A;  1VH1 A;  5CMH A;  1FO9 A;  2RIZ A;  5C38 A;  3GUE A;  3U2T A;  2OI7 A;  2RIX A;  4E1K A;  2RIY A;  3N9W A;  4AC3 A;  1K4V A;  4CJ8 A;  5C4B A;  4D0T A;  4M4K A;  4Y63 A;  3PNN A;  1ZDF A;  3NGW A;  3ST8 A;  5C8R A;  3IOI A;  3ZLL A;  2YCM A;  1TVY A;  2AM3 A;  1H7Q A;  1MC3 A;  3PKQ A;  3E26 A;  2DPW A;  2PA4 A;  4EE4 A;  1H5S D;  1YRO B;  1V84 A;  2FYD B;  1G8O A;  5EJZ A;  3I0F A;  5EIY A;  3TZT A;  1E5K A;  5JQQ A;  1JYK A;  2AH9 A;  4ASJ A;  4FRL A;  2D7R A;  3SXB A;  1ZI3 A;  2I7B A;  1H7T A;  2PGV A;  3SX3 A;  3Q7U A;  2WAW A;  1PZT A;  1G1L A;  5IDT A;  5C3D A;  1JYL A;  1VGZ A;  1WSZ A;  1G95 A;  4MYB A;  4P02 A;  4EE5 A;  2OI6 A;  2X5Z A;  2XMH A;  1R7X A;  3SX8 A;  2P6W A;  3D5N A;  2Q4J A;  1FR9 A;  5FU0 A;  3JUK A;  3K8E A;  1QGS A;  1H4E A;  2AE7 A;  3OGZ A;  5IDS A;  4CJB A;  1S4P A;  1Z90 A;  1NHE B;  3V0Q A;  2WE9 A;  1H5S A;  3I0H A;  1V83 A;  1PZY B;  3IOH A;  2BO8 A;  4FRM A;  3U2V A;  4HO4 A;  1FWY A;  3D8V A; 
#chains in the Genus database with same CATH topology
 4GBP A;  2D0J A;  1O23 B;  3ZF8 A;  3V0N A;  3U0Y A;  1GQ9 A;  5FUH A;  1GX4 A;  2YQH A;  2VSI A;  4LW3 A;  2X60 A;  4UEG A;  2PGY A;  5CMG X;  1ON6 A;  4EEG A;  4HCQ A;  1GX0 A;  5AJO A;  5DDV A;  3V0L A;  1FGX A;  1ZCY A;  1XHB A;  3V0P A;  2VXL A;  1WT1 A;  4D48 A;  4G3P A;  1MP3 A;  2AEC A;  1ZCU A;  3CGX A;  4KQL A;  4JIS A;  1G93 A;  1QG8 A;  3V8Y A;  3FWW A;  1WT0 A;  1FOA A;  3ZLK A;  3SX5 A;  2C0N A;  2YQJ A;  2BO6 A;  1FG5 N;  1GWW A;  3T7M A;  4FRA A;  1HM9 A;  3JTJ A;  3IOJ A;  1LZJ A;  3V91 A;  1H5R A;  2YC3 A;  1HJJ A;  3DK5 A;  1H3M A;  3V0O A;  4C2S A;  1H7G A;  4LW6 A;  4EVW A;  3SPT A;  1VGW A;  1VIC A;  1QWJ A;  1NF5 B;  3OKR A;  2CU2 A;  1HM0 A;  1H7L A;  4NAI A;  2X5S A;  1I52 A;  5C4E A;  4FRO A;  4DE7 A;  2RJ1 A;  1JVD A;  4FCE A;  5J49 A;  5L6V A;  1G9R A;  3ZGG A;  4BQH A;  2OI5 A;  2FY7 A;  2ZU8 A;  5C3B A;  4NAL A;  3R3I A;  4HO5 A;  1G3L A;  1LL0 A;  5CQO A;  2RJ5 A;  1R7U A;  5EJ1 A;  2RJ7 A;  3T7N A;  1JVG A;  4Y7U A;  5C4D A;  2VS5 A;  2WVK A;  3SXD A;  1G23 A;  1O7Q A;  5CMI A;  1GA8 A;  4ZDQ A;  1R82 A;  1ZDG A;  4O6N A;  4Y64 A;  3LW6 A;  5L6S A;  4HO2 A;  1JV1 A;  3KIA A;  3DUV A;  1ZJ1 A;  1VM8 A;  5C3A A;  4B2X A;  4B2W A;  2RJ9 A;  4XWI A;  5I1F A;  3E25 A;  2YQS A;  4M2A A;  1ZI5 A;  2OEF A;  2WVM A;  4ARW A;  4MIX A;  1YP2 A;  2GGO A;  4YS8 A;  3RMV A;  4KPZ A;  1VZU A;  2P72 A;  4FRB A;  5CMJ A;  1FXO A;  1INI A;  4CJC A;  4D11 C;  4R7P A;  1O7O A;  5FTS A;  4IRQ A;  2J0A A;  1ZHJ A;  1KWS A;  1NKH B;  3OH1 A;  1R81 A;  1R7V A;  2E3D A;  3CKO A;  1LL2 A;  1WT2 A;  2W0W A;  5AJP A;  4FIY A;  3I0G A;  2V0K A;  2O1G A;  2FYC B;  1VZT A;  4IRP A;  4FRD A;  4FRE A;  2WVL A;  1ZI4 A;  4KC4 A;  2VK9 A;  2Y6P A;  2VS3 A;  2MZB A;  2RJ0 A;  2V0H A;  4CVH A;  5C36 A;  1H7H A;  1ZJ3 A;  2XWM A;  1MP4 A;  2JCL A;  1FO8 A;  1WVC A;  3SXC A;  2Z86 A;  1SS9 A;  4J18 A;  1ON8 A;  2Z87 A;  2W0V A;  4BMA A;  4FRP A;  1W55 A;  1LZI A;  2Y7A A;  4FIX A;  1O0R A;  1H5S B;  1VH3 A;  2ICX A;  1HJL A;  2APC A;  4G87 A;  3FOQ A;  2AM5 A;  5C49 A;  4EEA A;  3O3P A;  4FRH A;  1W57 A;  3U2U A;  4FRQ A;  1FZW A;  1G0R A;  2VSH A;  1VGT A;  3U2W A;  4HO3 A;  2VD4 A;  3Q4S A;  3BRK X;  3U2X A;  5DDT A;  3ZGF A;  5C47 A;  2BO7 A;  3USR A;  3RMW A;  4DDZ A;  3POL A;  3EE5 A;  1FRW A;  2O1H A;  3R2W A;  3I0J A;  1FGG A;  2D7I A;  4NAN A;  2QGI A;  1H7F A;  2Y4M A;  2FYA A;  4KNX A;  2NXV A;  2AES A;  2VFZ A;  5CQM X;  4HO9 A;  2RJ4 A;  1JV3 A;  3F1C A;  1ZCT A;  4HOC A;  2YQC A;  2YC5 A;  1YP4 A;  4HO8 A;  2WGZ A;  1EZI A;  1NMM B;  4Y6U A;  2I5E A;  1OQM B;  1H5T B;  4Y62 A;  2FYB A;  2O1F A;  2ICY A;  4NAK A;  3HL3 A;  2RJ8 A;  1VZX A;  5FYE A;  2OEG A;  3OC9 A;  3PKP A;  2I5K A;  4DEC A;  1HM8 A;  1LL3 A;  4Y7F A;  5C1G A;  4ECM A;  4FCU A;  4KT7 A;  3D98 A;  4EEM A;  3V0M A;  1VPA A;  4B42 A;  2GGQ A;  3I0L A;  1NWG B;  3BCV A;  3OH4 A;  4K6R A;  5IFY A;  2V0J A;  4KC1 A;  1XZ6 A;  5C4C A;  1OMZ A;  1ZI1 A;  1TW1 A;  5CQN X;  3Q80 A;  3QVB A;  3OAM A;  4MND A;  4M2B A;  1FR8 A;  3JUJ A;  1ZJ0 A;  2VS4 A;  5FU8 A;  3OH2 A;  4EEO A;  4EE3 A;  3SX7 A;  3V90 A;  3I0I X;  4JD0 A;  1S4N A;  1GWV A;  4Y7V A;  2A8U A;  1H7E A;  4Q7C A;  5C4F A;  1GQC A;  2JCJ A;  2Y4K A;  5FV9 A;  4Y9X A;  3RSB A;  1G2V A;  2YES A;  2QH5 A;  4HO0 A;  4HG6 A;  3K8D A;  1H4C A;  4L41 C;  3USQ A;  1ZCV A;  3CKJ A;  5C1L A;  2PX7 A;  2ZU7 A;  4D0Z A;  4Y7G A;  5HS2 A;  2A8W A;  2V0I A;  1FXJ A;  2JCK A;  3I0C A;  4G3S A;  1H5S C;  3SXG A;  5CQL X;  4D11 A;  4P00 A;  1ZJ2 A;  3SXE A;  3TQD A;  1MP5 A;  2BO4 A;  2ZU9 A;  3U0X A;  1ZJP A;  1OMX A;  4FQW A;  4HO6 A;  2WEE A;  3I0E A;  5FTV A;  1VGU A;  5C48 A;  2JCO A;  1R7Y A;  1ZJO A;  3SXA A;  3T7O A;  2V0L A;  1INJ A;  1HV9 A;  1NQI B;  2RJ6 A;  4KXO A;  2XWN A;  1TZF A;  4B4M A;  2X65 A;  1G97 A;  1ZIZ A;  2FFU A;  2P73 A;  4AYL A;  2RIT A;  3CKN A;  2QKX A;  2Y4J A;  2Y4L A;  1W77 A;  5AJN A;  1LZ7 A;  2VXM A;  3I0D A;  1LZ0 A;  1YP3 A;  1S4O A;  4B3U A;  3CKV A;  4M28 A;  2XME A;  4AAW A;  2AM4 A;  4G3Q A;  5D92 A;  4ASY A;  1EYR A;  3F1Y A;  2AGD A;  2E8B A;  1TW5 A;  5CQP A;  5C1H A;  1R80 A;  1H4D A;  4Y7T A;  1LVW A;  4B4G A;  1H5T A;  4B4B A;  1V82 A;  4AYJ A;  1R7T A;  1WT3 A;  4KC2 A;  4Y6N A;  3DJ4 A;  4KPX A;  4KNR A;  3CKQ A;  3OH0 A;  3V8Z A;  3CU0 A;  2XWL A;  3I0K A;  1QGQ A;  1IIN A;  1H5R B;  1IIM A;  3OH3 A;  5CMF X;  4B5B A;  2FFV A;  2UX8 A;  4KRV A;  5BXC A;  1VH1 A;  5CMH A;  1FO9 A;  2RIZ A;  5C38 A;  3GUE A;  3U2T A;  2OI7 A;  2RIX A;  4E1K A;  2RIY A;  3N9W A;  4AC3 A;  1K4V A;  4CJ8 A;  5C4B A;  4D0T A;  4M4K A;  4Y63 A;  3PNN A;  1ZDF A;  3NGW A;  3ST8 A;  5C8R A;  3IOI A;  3ZLL A;  2YCM A;  1TVY A;  2AM3 A;  1H7Q A;  1MC3 A;  3PKQ A;  4O6M A;  3E26 A;  2DPW A;  2PA4 A;  4EE4 A;  1H5S D;  1YRO B;  1V84 A;  2FYD B;  1G8O A;  5EJZ A;  3I0F A;  5EIY A;  3TZT A;  1E5K A;  5JQQ A;  1JYK A;  2AH9 A;  4ASJ A;  4FRL A;  2D7R A;  3SXB A;  1ZI3 A;  2I7B A;  1H7T A;  2PGV A;  3SX3 A;  3Q7U A;  2WAW A;  1PZT A;  1G1L A;  5IDT A;  5C3D A;  1JYL A;  1VGZ A;  1WSZ A;  1G95 A;  4MYB A;  4P02 A;  4EE5 A;  2OI6 A;  2X5Z A;  2XMH A;  1R7X A;  2J0B A;  3SX8 A;  5D91 A;  2P6W A;  3D5N A;  2Q4J A;  1FR9 A;  5FU0 A;  3JUK A;  3K8E A;  1QGS A;  1H4E A;  2AE7 A;  3OGZ A;  5IDS A;  4CJB A;  1S4P A;  1Z90 A;  1NHE B;  3V0Q A;  2WE9 A;  1H5S A;  3I0H A;  1V83 A;  1PZY B;  3IOH A;  2BO8 A;  4FRM A;  3U2V A;  4HO4 A;  1FWY A;  3D8V A; 
#chains in the Genus database with same CATH homology
 4GBP A;  2D0J A;  1O23 B;  3ZF8 A;  3V0N A;  3U0Y A;  1GQ9 A;  5FUH A;  1GX4 A;  2YQH A;  2VSI A;  4LW3 A;  2X60 A;  4UEG A;  2PGY A;  5CMG X;  1ON6 A;  4EEG A;  4HCQ A;  1GX0 A;  5AJO A;  5DDV A;  3V0L A;  1FGX A;  1ZCY A;  1XHB A;  3V0P A;  2VXL A;  1WT1 A;  4D48 A;  4G3P A;  1MP3 A;  2AEC A;  1ZCU A;  3CGX A;  4KQL A;  4JIS A;  1G93 A;  1QG8 A;  3V8Y A;  3FWW A;  1WT0 A;  1FOA A;  3ZLK A;  3SX5 A;  2C0N A;  2YQJ A;  2BO6 A;  1FG5 N;  1GWW A;  3T7M A;  4FRA A;  1HM9 A;  3JTJ A;  3IOJ A;  1LZJ A;  3V91 A;  1H5R A;  2YC3 A;  1HJJ A;  3DK5 A;  1H3M A;  3V0O A;  4C2S A;  1H7G A;  4LW6 A;  4EVW A;  3SPT A;  1VGW A;  1VIC A;  1QWJ A;  1NF5 B;  3OKR A;  2CU2 A;  1HM0 A;  1H7L A;  4NAI A;  2X5S A;  1I52 A;  5C4E A;  4FRO A;  4DE7 A;  2RJ1 A;  1JVD A;  4FCE A;  5J49 A;  5L6V A;  1G9R A;  3ZGG A;  4BQH A;  2OI5 A;  2FY7 A;  2ZU8 A;  5C3B A;  4NAL A;  3R3I A;  4HO5 A;  1G3L A;  1LL0 A;  5CQO A;  2RJ5 A;  1R7U A;  5EJ1 A;  2RJ7 A;  3T7N A;  1JVG A;  4Y7U A;  5C4D A;  2VS5 A;  2WVK A;  3SXD A;  1G23 A;  1O7Q A;  5CMI A;  1GA8 A;  4ZDQ A;  1R82 A;  1ZDG A;  4O6N A;  4Y64 A;  3LW6 A;  5L6S A;  4HO2 A;  1JV1 A;  3KIA A;  3DUV A;  1ZJ1 A;  1VM8 A;  5C3A A;  4B2X A;  4B2W A;  2RJ9 A;  4XWI A;  5I1F A;  3E25 A;  2YQS A;  4M2A A;  1ZI5 A;  2OEF A;  2WVM A;  4ARW A;  4MIX A;  1YP2 A;  2GGO A;  4YS8 A;  3RMV A;  4KPZ A;  1VZU A;  2P72 A;  4FRB A;  5CMJ A;  1FXO A;  1INI A;  4CJC A;  4D11 C;  4R7P A;  1O7O A;  5FTS A;  4IRQ A;  2J0A A;  1ZHJ A;  1KWS A;  1NKH B;  3OH1 A;  1R81 A;  1R7V A;  2E3D A;  3CKO A;  1LL2 A;  1WT2 A;  2W0W A;  5AJP A;  4FIY A;  3I0G A;  2V0K A;  2O1G A;  2FYC B;  1VZT A;  4IRP A;  4FRD A;  4FRE A;  2WVL A;  1ZI4 A;  4KC4 A;  2VK9 A;  2Y6P A;  2VS3 A;  2MZB A;  2RJ0 A;  2V0H A;  4CVH A;  5C36 A;  1H7H A;  1ZJ3 A;  2XWM A;  1MP4 A;  2JCL A;  1FO8 A;  1WVC A;  3SXC A;  2Z86 A;  1SS9 A;  4J18 A;  1ON8 A;  2Z87 A;  2W0V A;  4BMA A;  4FRP A;  1W55 A;  1LZI A;  2Y7A A;  4FIX A;  1O0R A;  1H5S B;  1VH3 A;  2ICX A;  1HJL A;  2APC A;  4G87 A;  3FOQ A;  2AM5 A;  5C49 A;  4EEA A;  3O3P A;  4FRH A;  1W57 A;  3U2U A;  4FRQ A;  1FZW A;  1G0R A;  2VSH A;  1VGT A;  3U2W A;  4HO3 A;  2VD4 A;  3Q4S A;  3BRK X;  3U2X A;  5DDT A;  3ZGF A;  5C47 A;  2BO7 A;  3USR A;  3RMW A;  4DDZ A;  3POL A;  3EE5 A;  1FRW A;  2O1H A;  3R2W A;  3I0J A;  1FGG A;  2D7I A;  4NAN A;  2QGI A;  1H7F A;  2Y4M A;  2FYA A;  4KNX A;  2NXV A;  2AES A;  2VFZ A;  5CQM X;  4HO9 A;  2RJ4 A;  1JV3 A;  3F1C A;  1ZCT A;  4HOC A;  2YQC A;  2YC5 A;  1YP4 A;  4HO8 A;  2WGZ A;  1EZI A;  1NMM B;  4Y6U A;  2I5E A;  1OQM B;  1H5T B;  4Y62 A;  2FYB A;  2O1F A;  2ICY A;  4NAK A;  3HL3 A;  2RJ8 A;  1VZX A;  5FYE A;  2OEG A;  3OC9 A;  3PKP A;  2I5K A;  4DEC A;  1HM8 A;  1LL3 A;  4Y7F A;  5C1G A;  4ECM A;  4FCU A;  4KT7 A;  3D98 A;  4EEM A;  3V0M A;  1VPA A;  4B42 A;  2GGQ A;  3I0L A;  1NWG B;  3BCV A;  3OH4 A;  4K6R A;  5IFY A;  2V0J A;  4KC1 A;  1XZ6 A;  5C4C A;  1OMZ A;  1ZI1 A;  1TW1 A;  5CQN X;  3Q80 A;  3QVB A;  3OAM A;  4MND A;  4M2B A;  1FR8 A;  3JUJ A;  1ZJ0 A;  2VS4 A;  5FU8 A;  3OH2 A;  4EEO A;  4EE3 A;  3SX7 A;  3V90 A;  3I0I X;  4JD0 A;  1S4N A;  1GWV A;  4Y7V A;  2A8U A;  1H7E A;  4Q7C A;  5C4F A;  1GQC A;  2JCJ A;  2Y4K A;  5FV9 A;  4Y9X A;  3RSB A;  1G2V A;  2YES A;  2QH5 A;  4HO0 A;  4HG6 A;  3K8D A;  1H4C A;  4L41 C;  3USQ A;  1ZCV A;  3CKJ A;  5C1L A;  2PX7 A;  2ZU7 A;  4D0Z A;  4Y7G A;  5HS2 A;  2A8W A;  2V0I A;  1FXJ A;  2JCK A;  3I0C A;  4G3S A;  1H5S C;  3SXG A;  5CQL X;  4D11 A;  4P00 A;  1ZJ2 A;  3SXE A;  3TQD A;  1MP5 A;  2BO4 A;  2ZU9 A;  3U0X A;  1ZJP A;  1OMX A;  4FQW A;  4HO6 A;  2WEE A;  3I0E A;  5FTV A;  1VGU A;  5C48 A;  2JCO A;  1R7Y A;  1ZJO A;  3SXA A;  3T7O A;  2V0L A;  1INJ A;  1HV9 A;  1NQI B;  2RJ6 A;  4KXO A;  2XWN A;  1TZF A;  4B4M A;  2X65 A;  1G97 A;  1ZIZ A;  2FFU A;  2P73 A;  4AYL A;  2RIT A;  3CKN A;  2QKX A;  2Y4J A;  2Y4L A;  1W77 A;  5AJN A;  1LZ7 A;  2VXM A;  3I0D A;  1LZ0 A;  1YP3 A;  1S4O A;  4B3U A;  3CKV A;  4M28 A;  2XME A;  4AAW A;  2AM4 A;  4G3Q A;  5D92 A;  4ASY A;  1EYR A;  3F1Y A;  2AGD A;  2E8B A;  1TW5 A;  5CQP A;  5C1H A;  1R80 A;  1H4D A;  4Y7T A;  1LVW A;  4B4G A;  1H5T A;  4B4B A;  1V82 A;  4AYJ A;  1R7T A;  1WT3 A;  4KC2 A;  4Y6N A;  3DJ4 A;  4KPX A;  4KNR A;  3CKQ A;  3OH0 A;  3V8Z A;  3CU0 A;  2XWL A;  3I0K A;  1QGQ A;  1IIN A;  1H5R B;  1IIM A;  3OH3 A;  5CMF X;  4B5B A;  2FFV A;  2UX8 A;  4KRV A;  5BXC A;  1VH1 A;  5CMH A;  1FO9 A;  2RIZ A;  5C38 A;  3GUE A;  3U2T A;  2OI7 A;  2RIX A;  4E1K A;  2RIY A;  3N9W A;  4AC3 A;  1K4V A;  4CJ8 A;  5C4B A;  4D0T A;  4M4K A;  4Y63 A;  3PNN A;  1ZDF A;  3NGW A;  3ST8 A;  5C8R A;  3IOI A;  3ZLL A;  2YCM A;  1TVY A;  2AM3 A;  1H7Q A;  1MC3 A;  3PKQ A;  4O6M A;  3E26 A;  2DPW A;  2PA4 A;  4EE4 A;  1H5S D;  1YRO B;  1V84 A;  2FYD B;  1G8O A;  5EJZ A;  3I0F A;  5EIY A;  3TZT A;  1E5K A;  5JQQ A;  1JYK A;  2AH9 A;  4ASJ A;  4FRL A;  2D7R A;  3SXB A;  1ZI3 A;  2I7B A;  1H7T A;  2PGV A;  3SX3 A;  3Q7U A;  2WAW A;  1PZT A;  1G1L A;  5IDT A;  5C3D A;  1JYL A;  1VGZ A;  1WSZ A;  1G95 A;  4MYB A;  4P02 A;  4EE5 A;  2OI6 A;  2X5Z A;  2XMH A;  1R7X A;  2J0B A;  3SX8 A;  5D91 A;  2P6W A;  3D5N A;  2Q4J A;  1FR9 A;  5FU0 A;  3JUK A;  3K8E A;  1QGS A;  1H4E A;  2AE7 A;  3OGZ A;  5IDS A;  4CJB A;  1S4P A;  1Z90 A;  1NHE B;  3V0Q A;  2WE9 A;  1H5S A;  3I0H A;  1V83 A;  1PZY B;  3IOH A;  2BO8 A;  4FRM A;  3U2V A;  4HO4 A;  1FWY A;  3D8V A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...