3ZF8A

Crystal structure of saccharomyces cerevisiae mnn9 in complex with gdp and mn.
Total Genus 93
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
93
sequence length
300
structure length
288
Chain Sequence
HIAHYDLNKLHSTSEAAVNKEHILILTPMQTFHQQYWDNLLQLNYPRELIELGFITPRTATGDLALKKLENAIKKVQTDKKTQRFSKITILRQNSALDVQKERRAAMALARNELLFSTIGPHTSWVLWLNADIIETPPSLIQDMTKHNKAILAANIYQRFYDEEKKQPSIRPYDFNNWQESDTGLEIASQMGDDEIIVEGYAEIATYRPLMAHFYDANGVPGEEMALDGVGGGCTLVKAEVHRDGAMFPNFPFYHLIETEGFAKMAKRLNYDVFGLPNYLVYHIEEEN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords MANNAN POLYMERASE COMPLEXES SUBUNIT MNN9
publication title Yeast Mnn9 is Both a Priming Glycosyltransferase and an Allosteric Activator of Mannan Biosynthesis.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
total genus 93
structure length 288
sequence length 300
ec nomenclature
pdb deposition date 2012-12-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03452 Anp1 Anp1
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.550.10 Alpha Beta Alpha-Beta Complex Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A 3zf8A00
3F1YA 3V0LA 2I5EA 4KC2A 1SS9A 4R7PA 4P02A 1H7TA 4EEAA 4ECMA 4NALA 2O1GA 3IOHA 1G93A 2A8UA 2FY7A 1FR8A 3V0PA 1LL3A 4C2SA 3N9WA 3U2WA 2VFZA 4KT7A 1O7QA 4G3PA 4HG6A 3OAMA 3TZTA 4D0TA 2RITA 1HV9A 3T7OA 1TW1A 4B4MA 2YCMA 5FYEA 4M2AA 1TVYA 5C38A 1LL2A 5IFYA 2RIYA 2UX8A 4FRMA 4LW6A 3CKNA 3PKPA 4KQLA 4EE3A 3FWWA 3BCVA 3JUJA 4Y6NA 1FGGA 3I0DA 4KC4A 1ZI5A 3PNNA 2BO8A 4B5BA 2W0VA 4HO5A 2I5KA 2ICXA 1ZCTA 2XWLA 1ZJ0A 4GBPA 3USRA 1OMZA 2WEEA 1H4CA 4DDZA 1NWGB 4FRDA 4HOCA 2BO7A 5C3DA 3ZGFA 4K6RA 2JCLA 3SXAA 1LZ0A 3DJ4A 2V0HA 1H5RB 5FU8A 1FO9A 2RJ4A 4Y7FA 3OH4A 1H7LA 1LL0A 1WT1A 2WVKA 2YESA 5DDTA 1H3MA 1PZYB 5FV9A 1H7FA 5IDTA 2RJ9A 2XMHA 1QWJA 5C4DA 1XZ6A 1ON6A 4KPZA 1VICA 1ZIZA 1R80A 4XWIA 3I0GA 1FOAA 4EEOA 1G1LA 1QG8A 1ZI4A 4AAWA 3U2UA 2V0JA 1VH1A 3ZLLA 2X60A 5EJZA 2JCJA 2ICYA 4G3QA 1GQCA 4L41C 1PZTA 2APCA 1R7UA 3T7MA 4KNXA 3T7NA 1EYRA 4D11C 5EJ1A 5DDVA 3LW6A 2P72A 2Y4MA 2WVMA 1ZJ2A 5C4EA 4EE4A 1H7GA 2P73A 1R82A 5J49A 3CKQA 4Y63A 3U0YA 5CMJA 1HM8A 4AYLA 1O0RA 2YC5A 3BRKX 3RMVA 4AYJA 2Z87A 2GGOA 3R3IA 1GQ9A 1H4EA 2WGZA 5FTSA 1INIA 2XMEA 3SX7A 1JYLA 2D7RA 2JCOA 3I0JA 3V90A 1GA8A 3ST8A 3ZGGA 2VXLA 3HL3A 3CKJA 1S4OA 1R7VA 5CQNX 4DECA 3CKVA 2VSIA 4B3UA 5C4BA 1HM9A 1ZJOA 4EEGA 2O1FA 4E1KA 1VPAA 1NKHB 1Z90A 4P00A 4B4GA 4D11A 3SXDA 1GWWA 1H7EA 3CGXA 1V84A 2I7BA 3D5NA 4KXOA 2FFVA 4CJCA 3V8ZA 4JD0A 2W0WA 1LVWA 1FWYA 1ZJ1A 3DK5A 3OGZA 5CQPA 2VS4A 4B2WA 1NMMB 4Y7VA 3GUEA 3PKQA 2MZBA 1VGTA 3U2TA 2VS3A 2OI6A 2GGQA 2RJ5A 1VGUA 4EE5A 3I0KA 4D48A 5C48A 5HS2A 2AE7A 2CU2A 5C1HA 2PX7A 2VS5A 1HJJA 4HO6A 1VZUA 1I52A 3OC9A 3EE5A 2RJ6A 4EEMA 1ZHJA 5CQMX 2QGIA 2OEFA 1ZDFA 3Q7UA 1TW5A 1YP3A 4FCUA 1KWSA 4AC3A 3I0HA 2FYAA 1ZCUA 1GWVA 2ZU9A 4KPXA 3V91A 1W55A 4FRQA 3OH3A 1E5KA 1S4PA 4B2XA 4HO2A 4HO0A 4Y9XA 3V0OA 5FTVA 1H7HA 1HM0A 2JCKA 1V82A 2AGDA 1W77A 1FRWA 4Y7UA 4FRPA 5L6VA 3F1CA 3K8DA 1JYKA 2QKXA 3IOIA 4Y62A 3K8EA 1H5TB 4ARWA 3CKOA 1O7OA 3JUKA 5C49A 2XWNA 2RIXA 3RMWA 4G87A 3JTJA 1R7XA 4G3SA 4MNDA 1H5SD 2QH5A 3V0MA 5EIYA 1WT0A 4B42A 4FROA 5C4CA 1O23B 1NHEB 3RSBA 1H5SA 4CVHA 1JVDA 2FFUA 4CJBA 5FUHA 1LZJA 1ZI3A 3O3PA 1EZIA 1VGWA 1FZWA 1GX4A 1ZJPA 3I0CA 1ZI1A 2WE9A 1JV1A 4KC1A 2YQCA 5AJOA 2D0JA 1TZFA 2AH9A 3CU0A 3V0NA 5FU0A 4Y7GA 3SXGA 1OQMB 2Y4LA 1ON8A 4LW3A 4J18A 4ASYA 5CQOA 2YQJA 3ZLKA 1HJLA 1G2VA 3SXBA 1H5TA 4IRPA 1V83A 4NAIA 3NGWA 2PGVA 1W57A 3V0QA 2AESA 3IOJA 2WAWA 3SPTA 3SXCA 2PA4A 3DUVA 1XHBA 4M4KA 4Y7TA 4FREA 2RJ7A 5C1GA 2O1HA 1G3LA 3D98A 1G97A 3ZF8A 4YS8A 4KRVA 5JQQA 1LZIA 1VGZA 2AM5A 1K4VA 5CMFX 1INJA 1WT3A 1G0RA 4ASJA 5C1LA 5C47A 4MYBA 5C36A 5I1FA 1S4NA 2WVLA 1G8OA 2Z86A 1WSZA 3I0FA 4HO4A 1MC3A 2OEGA 4FRLA 4HO3A 1QGSA 5AJNA 2DPWA 4Y64A 4M2BA 1FXOA 2RJ0A 2BO6A 5L6SA 1MP3A 2VD4A 4D0ZA 5C3AA 1QGQA 1JV3A 1FXJA 2OI7A 3SX5A 5C4FA 4M28A 2Y4JA 1H4DA 2FYCB 1H5SB 2Y4KA 3I0IX 1IINA 5AJPA 1H5SC 2D7IA 4BMAA 1ZCYA 2RJ1A 5IDSA 3OH1A 2RJ8A 2YQSA 3E26A 4NANA 4CJ8A 3U0XA 4FCEA 3Q80A 1H7QA 3USQA 4B4BA 1WT2A 1VZTA 2BO4A 1WVCA 1VZXA 4HO9A 1R81A 1YP4A 3I0EA 4FRBA 2ZU8A 3Q4SA 2PGYA 3OH2A 2A8WA 2Y6PA 2Y7AA 3D8VA 4Y6UA 1OMXA 3SXEA 1G9RA 3U2XA 2ZU7A 1NQIB 2OI5A 2XWMA 3V8YA 2P6WA 2NXVA 4FRHA 3QVBA 4ZDQA 3FOQA 4EVWA 3E25A 2AM4A 4HO8A 1R7TA 4DE7A 2V0KA 2E3DA 1FR9A 2YC3A 3U2VA 2E8BA 1G95A 1IIMA 1VM8A 2X5SA 4KNRA 2FYDB 1ZCVA 5CMHA 4FQWA 2YQHA 2V0LA 2AECA 1GX0A 1MP4A 4HCQA 2X5ZA 1FGXA 5BXCA 1G23A 4NAKA 3KIAA 2FYBA 3SX8A 2Q4JA 3OH0A 4UEGA 1VH3A 1JVGA 2X65A 1LZ7A 1ZDGA 1FO8A 5CMGX 1MP5A 3I0LA 3R2WA 1NF5B 3OKRA 2AM3A 2RIZA 1YROB 5CQLX 5C3BA 1FG5N 1R7YA 4JISA 4BQHA 4FRAA 1H5RA 3POLA 4IRQA 2V0IA 3SX3A 5CMIA 2VSHA 5C8RA 1YP2A 1ZJ3A 3TQDA 2VXMA
chains in the Genus database with same CATH superfamily
3F1YA 3V0LA 2I5EA 4KC2A 1SS9A 4R7PA 4P02A 1H7TA 4EEAA 4ECMA 4NALA 2O1GA 3IOHA 1G93A 2A8UA 2FY7A 1FR8A 3V0PA 1LL3A 4C2SA 3N9WA 3U2WA 2VFZA 4KT7A 1O7QA 4G3PA 4HG6A 3OAMA 3TZTA 4D0TA 2RITA 1HV9A 3T7OA 1TW1A 4B4MA 2YCMA 5FYEA 4M2AA 1TVYA 5C38A 1LL2A 5IFYA 2RIYA 2UX8A 4FRMA 4LW6A 3CKNA 3PKPA 4KQLA 4EE3A 3FWWA 3BCVA 3JUJA 4Y6NA 1FGGA 3I0DA 4KC4A 1ZI5A 3PNNA 2BO8A 4B5BA 2W0VA 4HO5A 2I5KA 2ICXA 1ZCTA 2XWLA 1ZJ0A 4GBPA 3USRA 1OMZA 2WEEA 1H4CA 4DDZA 1NWGB 4FRDA 4HOCA 4MIXA 2BO7A 5C3DA 3ZGFA 4K6RA 2JCLA 3SXAA 1LZ0A 2J0AA 3DJ4A 2V0HA 1H5RB 5FU8A 1FO9A 2RJ4A 4Y7FA 3OH4A 1H7LA 1LL0A 1WT1A 2WVKA 2YESA 5DDTA 1H3MA 1PZYB 5FV9A 1H7FA 5IDTA 2RJ9A 2XMHA 1QWJA 5C4DA 1XZ6A 1ON6A 4KPZA 1VICA 1ZIZA 1R80A 4XWIA 3I0GA 1FOAA 4EEOA 1G1LA 1QG8A 1ZI4A 4AAWA 3U2UA 2V0JA 1VH1A 3ZLLA 2X60A 5EJZA 2JCJA 2ICYA 4G3QA 1GQCA 4L41C 1PZTA 2APCA 1R7UA 3T7MA 4KNXA 3T7NA 1EYRA 4D11C 5EJ1A 5DDVA 3LW6A 2P72A 2Y4MA 2WVMA 1ZJ2A 5C4EA 4EE4A 1H7GA 2P73A 1R82A 5J49A 3CKQA 4Y63A 3U0YA 2VK9A 5CMJA 1HM8A 4AYLA 1O0RA 2YC5A 3BRKX 3RMVA 4AYJA 2Z87A 2GGOA 3R3IA 1GQ9A 1H4EA 2WGZA 5FTSA 1INIA 2XMEA 3SX7A 1JYLA 2D7RA 2JCOA 3I0JA 3V90A 1GA8A 3ST8A 3ZGGA 2VXLA 3HL3A 3CKJA 1S4OA 1R7VA 5CQNX 4DECA 3CKVA 2VSIA 4B3UA 5C4BA 1HM9A 1ZJOA 4EEGA 2O1FA 4E1KA 1VPAA 1NKHB 1Z90A 4P00A 4B4GA 4D11A 3SXDA 1GWWA 1H7EA 3CGXA 1V84A 2I7BA 3D5NA 4KXOA 2FFVA 4CJCA 3V8ZA 4JD0A 2W0WA 1LVWA 1FWYA 1ZJ1A 3DK5A 3OGZA 5CQPA 2VS4A 4B2WA 1NMMB 4Y7VA 3GUEA 3PKQA 2MZBA 1VGTA 3U2TA 2VS3A 2OI6A 2GGQA 2RJ5A 1VGUA 4EE5A 3I0KA 4D48A 5C48A 5HS2A 2AE7A 2CU2A 5C1HA 2PX7A 2VS5A 1HJJA 4HO6A 1VZUA 1I52A 3OC9A 3EE5A 2RJ6A 4EEMA 1ZHJA 5CQMX 2QGIA 2OEFA 1ZDFA 3Q7UA 1TW5A 1YP3A 4FCUA 1KWSA 4AC3A 3I0HA 2FYAA 1ZCUA 1GWVA 2ZU9A 4KPXA 3V91A 1W55A 4FRQA 3OH3A 1E5KA 1S4PA 4B2XA 4HO2A 4HO0A 5D92A 4Y9XA 3V0OA 5FTVA 1H7HA 1HM0A 2JCKA 1V82A 2AGDA 1W77A 1FRWA 4Y7UA 4FRPA 5L6VA 3F1CA 3K8DA 1JYKA 2QKXA 3IOIA 4Y62A 3K8EA 1H5TB 4ARWA 3CKOA 1O7OA 3JUKA 5C49A 2XWNA 2C0NA 2RIXA 3RMWA 4G87A 3JTJA 1R7XA 4G3SA 4MNDA 1H5SD 2QH5A 3V0MA 5EIYA 1WT0A 4B42A 4FROA 5C4CA 1O23B 1NHEB 3RSBA 1H5SA 4CVHA 1JVDA 2FFUA 4CJBA 5FUHA 1LZJA 1ZI3A 4Q7CA 5D91A 3O3PA 1EZIA 1VGWA 1FZWA 1GX4A 1ZJPA 3I0CA 1ZI1A 2WE9A 1JV1A 4KC1A 2YQCA 5AJOA 2D0JA 1TZFA 2AH9A 3CU0A 3V0NA 5FU0A 4Y7GA 3SXGA 1OQMB 2Y4LA 1ON8A 4LW3A 4J18A 4ASYA 5CQOA 2YQJA 3ZLKA 1HJLA 1G2VA 3SXBA 1H5TA 4IRPA 1V83A 2J0BA 4NAIA 3NGWA 2PGVA 1W57A 3V0QA 2AESA 3IOJA 2WAWA 3SPTA 3SXCA 2PA4A 3DUVA 1XHBA 4M4KA 4Y7TA 4FREA 2RJ7A 5C1GA 2O1HA 1G3LA 3D98A 1G97A 3ZF8A 4YS8A 4KRVA 5JQQA 1LZIA 1VGZA 2AM5A 1K4VA 5CMFX 1INJA 1WT3A 1G0RA 4ASJA 5C1LA 5C47A 4MYBA 5C36A 5I1FA 1S4NA 2WVLA 1G8OA 2Z86A 1WSZA 3I0FA 4HO4A 1MC3A 2OEGA 4FRLA 4HO3A 1QGSA 5AJNA 2DPWA 4Y64A 4M2BA 1FXOA 2RJ0A 2BO6A 5L6SA 1MP3A 2VD4A 4D0ZA 5C3AA 1QGQA 1JV3A 1FXJA 2OI7A 4FIYA 3SX5A 5C4FA 4M28A 2Y4JA 1H4DA 2FYCB 1H5SB 2Y4KA 3I0IX 1IINA 5AJPA 1H5SC 2D7IA 4FIXA 4BMAA 1ZCYA 2RJ1A 5IDSA 3OH1A 2RJ8A 2YQSA 3E26A 4NANA 4CJ8A 3U0XA 4FCEA 3Q80A 1H7QA 3USQA 4B4BA 1WT2A 1VZTA 2BO4A 1WVCA 1VZXA 4HO9A 1R81A 1YP4A 3I0EA 4FRBA 2ZU8A 3Q4SA 2PGYA 3OH2A 2A8WA 2Y6PA 2Y7AA 3D8VA 4Y6UA 4O6NA 1OMXA 3SXEA 1G9RA 3U2XA 2ZU7A 1NQIB 2OI5A 2XWMA 3V8YA 2P6WA 2NXVA 4FRHA 3QVBA 4ZDQA 3FOQA 4EVWA 3E25A 2AM4A 4HO8A 1R7TA 4DE7A 2V0KA 2E3DA 1FR9A 2YC3A 3U2VA 2E8BA 1G95A 1IIMA 2X5SA 1VM8A 4KNRA 2FYDB 1ZCVA 5CMHA 4FQWA 2YQHA 2V0LA 2AECA 1GX0A 1MP4A 4HCQA 2X5ZA 1FGXA 5BXCA 1G23A 4NAKA 3KIAA 2FYBA 3SX8A 2Q4JA 3OH0A 4UEGA 1VH3A 1JVGA 2X65A 1LZ7A 4O6MA 1ZDGA 1FO8A 5CMGX 1MP5A 3I0LA 3R2WA 1NF5B 3OKRA 2AM3A 2RIZA 1YROB 5CQLX 5C3BA 1FG5N 1R7YA 4JISA 4BQHA 4FRAA 1H5RA 3POLA 4IRQA 2V0IA 3SX3A 5CMIA 2VSHA 5C8RA 1YP2A 1ZJ3A 3TQDA 2VXMA
chains in the Genus database with same CATH topology
3F1YA 3V0LA 2I5EA 4KC2A 1SS9A 4R7PA 4P02A 1H7TA 4EEAA 4ECMA 4NALA 2O1GA 3IOHA 1G93A 2A8UA 2FY7A 1FR8A 3V0PA 1LL3A 4C2SA 3N9WA 3U2WA 2VFZA 4KT7A 1O7QA 4G3PA 4HG6A 3OAMA 3TZTA 4D0TA 2RITA 1HV9A 3T7OA 1TW1A 4B4MA 2YCMA 5FYEA 4M2AA 1TVYA 5C38A 1LL2A 5IFYA 2RIYA 2UX8A 4FRMA 4LW6A 3CKNA 3PKPA 4KQLA 4EE3A 3FWWA 3BCVA 3JUJA 4Y6NA 1FGGA 3I0DA 4KC4A 1ZI5A 3PNNA 2BO8A 4B5BA 2W0VA 4HO5A 2I5KA 2ICXA 1ZCTA 2XWLA 1ZJ0A 4GBPA 3USRA 1OMZA 2WEEA 1H4CA 4DDZA 1NWGB 4FRDA 4HOCA 4MIXA 2BO7A 5C3DA 3ZGFA 4K6RA 2JCLA 3SXAA 1LZ0A 2J0AA 3DJ4A 2V0HA 1H5RB 5FU8A 1FO9A 2RJ4A 4Y7FA 3OH4A 1H7LA 1LL0A 1WT1A 2WVKA 2YESA 5DDTA 1H3MA 1PZYB 5FV9A 1H7FA 5IDTA 2RJ9A 2XMHA 1QWJA 5C4DA 1XZ6A 1ON6A 4KPZA 1VICA 1ZIZA 1R80A 4XWIA 3I0GA 1FOAA 4EEOA 1G1LA 1QG8A 1ZI4A 4AAWA 3U2UA 2V0JA 1VH1A 3ZLLA 2X60A 5EJZA 2JCJA 2ICYA 4G3QA 1GQCA 4L41C 1PZTA 2APCA 1R7UA 3T7MA 4KNXA 3T7NA 1EYRA 4D11C 5EJ1A 5DDVA 3LW6A 2P72A 2Y4MA 2WVMA 1ZJ2A 5C4EA 4EE4A 1H7GA 2P73A 1R82A 5J49A 3CKQA 4Y63A 3U0YA 2VK9A 5CMJA 1HM8A 4AYLA 1O0RA 2YC5A 3BRKX 3RMVA 4AYJA 2Z87A 2GGOA 3R3IA 1GQ9A 1H4EA 2WGZA 5FTSA 1INIA 2XMEA 3SX7A 1JYLA 2D7RA 2JCOA 3I0JA 3V90A 1GA8A 3ST8A 3ZGGA 2VXLA 3HL3A 3CKJA 1S4OA 1R7VA 5CQNX 4DECA 3CKVA 2VSIA 4B3UA 5C4BA 1HM9A 1ZJOA 4EEGA 2O1FA 4E1KA 1VPAA 1NKHB 1Z90A 4P00A 4B4GA 4D11A 3SXDA 1GWWA 1H7EA 3CGXA 1V84A 2I7BA 3D5NA 4KXOA 2FFVA 4CJCA 3V8ZA 4JD0A 2W0WA 1LVWA 1FWYA 1ZJ1A 3DK5A 3OGZA 5CQPA 2VS4A 4B2WA 1NMMB 4Y7VA 3GUEA 3PKQA 2MZBA 1VGTA 3U2TA 2VS3A 2OI6A 2GGQA 2RJ5A 1VGUA 4EE5A 3I0KA 4D48A 5C48A 5HS2A 2AE7A 2CU2A 5C1HA 2PX7A 2VS5A 1HJJA 4HO6A 1VZUA 1I52A 3OC9A 3EE5A 2RJ6A 4EEMA 1ZHJA 5CQMX 2QGIA 2OEFA 1ZDFA 3Q7UA 1TW5A 1YP3A 4FCUA 1KWSA 4AC3A 3I0HA 2FYAA 1ZCUA 1GWVA 2ZU9A 4KPXA 3V91A 1W55A 4FRQA 3OH3A 1E5KA 1S4PA 4B2XA 4HO2A 4HO0A 5D92A 4Y9XA 3V0OA 5FTVA 1H7HA 1HM0A 2JCKA 1V82A 2AGDA 1W77A 1FRWA 4Y7UA 4FRPA 5L6VA 3F1CA 3K8DA 1JYKA 2QKXA 3IOIA 4Y62A 3K8EA 1H5TB 4ARWA 3CKOA 1O7OA 3JUKA 5C49A 2XWNA 2C0NA 2RIXA 3RMWA 4G87A 3JTJA 1R7XA 4G3SA 4MNDA 1H5SD 2QH5A 3V0MA 5EIYA 1WT0A 4B42A 4FROA 5C4CA 1O23B 1NHEB 3RSBA 1H5SA 4CVHA 1JVDA 2FFUA 4CJBA 5FUHA 1LZJA 1ZI3A 4Q7CA 5D91A 3O3PA 1EZIA 1VGWA 1FZWA 1GX4A 1ZJPA 3I0CA 1ZI1A 2WE9A 1JV1A 4KC1A 2YQCA 5AJOA 2D0JA 1TZFA 2AH9A 3CU0A 3V0NA 5FU0A 4Y7GA 3SXGA 1OQMB 2Y4LA 1ON8A 4LW3A 4J18A 4ASYA 5CQOA 2YQJA 3ZLKA 1HJLA 1G2VA 3SXBA 1H5TA 4IRPA 1V83A 2J0BA 4NAIA 3NGWA 2PGVA 1W57A 3V0QA 2AESA 3IOJA 2WAWA 3SPTA 3SXCA 2PA4A 3DUVA 1XHBA 4M4KA 4Y7TA 4FREA 2RJ7A 5C1GA 2O1HA 1G3LA 3D98A 1G97A 3ZF8A 4YS8A 4KRVA 5JQQA 1LZIA 1VGZA 2AM5A 1K4VA 5CMFX 1INJA 1WT3A 1G0RA 4ASJA 5C1LA 5C47A 4MYBA 5C36A 5I1FA 1S4NA 2WVLA 1G8OA 2Z86A 1WSZA 3I0FA 4HO4A 1MC3A 2OEGA 4FRLA 4HO3A 1QGSA 5AJNA 2DPWA 4Y64A 4M2BA 1FXOA 2RJ0A 2BO6A 5L6SA 1MP3A 2VD4A 4D0ZA 5C3AA 1QGQA 1JV3A 1FXJA 2OI7A 4FIYA 3SX5A 5C4FA 4M28A 2Y4JA 1H4DA 2FYCB 1H5SB 2Y4KA 3I0IX 1IINA 5AJPA 1H5SC 2D7IA 4FIXA 4BMAA 1ZCYA 2RJ1A 5IDSA 3OH1A 2RJ8A 2YQSA 3E26A 4NANA 4CJ8A 3U0XA 4FCEA 3Q80A 1H7QA 3USQA 4B4BA 1WT2A 1VZTA 2BO4A 1WVCA 1VZXA 4HO9A 1R81A 1YP4A 3I0EA 4FRBA 2ZU8A 3Q4SA 2PGYA 3OH2A 2A8WA 2Y6PA 2Y7AA 3D8VA 4Y6UA 4O6NA 1OMXA 3SXEA 1G9RA 3U2XA 2ZU7A 1NQIB 2OI5A 2XWMA 3V8YA 2P6WA 2NXVA 4FRHA 3QVBA 4ZDQA 3FOQA 4EVWA 3E25A 2AM4A 4HO8A 1R7TA 4DE7A 2V0KA 2E3DA 1FR9A 2YC3A 3U2VA 2E8BA 1G95A 1IIMA 2X5SA 1VM8A 4KNRA 2FYDB 1ZCVA 5CMHA 4FQWA 2YQHA 2V0LA 2AECA 1GX0A 1MP4A 4HCQA 2X5ZA 1FGXA 5BXCA 1G23A 4NAKA 3KIAA 2FYBA 3SX8A 2Q4JA 3OH0A 4UEGA 1VH3A 1JVGA 2X65A 1LZ7A 4O6MA 1ZDGA 1FO8A 5CMGX 1MP5A 3I0LA 3R2WA 1NF5B 3OKRA 2AM3A 2RIZA 1YROB 5CQLX 5C3BA 1FG5N 1R7YA 4JISA 4BQHA 4FRAA 1H5RA 3POLA 4IRQA 2V0IA 3SX3A 5CMIA 2VSHA 5C8RA 1YP2A 1ZJ3A 3TQDA 2VXMA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3F1Y A;  3V0L A;  2I5E A;  4KC2 A;  1SS9 A;  4R7P A;  4P02 A;  1H7T A;  4EEA A;  4ECM A;  4NAL A;  2O1G A;  3IOH A;  1G93 A;  2A8U A;  2FY7 A;  1FR8 A;  3V0P A;  1LL3 A;  4C2S A;  3N9W A;  3U2W A;  2VFZ A;  4KT7 A;  1O7Q A;  4G3P A;  4HG6 A;  3OAM A;  3TZT A;  4D0T A;  2RIT A;  1HV9 A;  3T7O A;  1TW1 A;  4B4M A;  2YCM A;  5FYE A;  4M2A A;  1TVY A;  5C38 A;  1LL2 A;  5IFY A;  2RIY A;  2UX8 A;  4FRM A;  4LW6 A;  3CKN A;  3PKP A;  4KQL A;  4EE3 A;  3FWW A;  3BCV A;  3JUJ A;  4Y6N A;  1FGG A;  3I0D A;  4KC4 A;  1ZI5 A;  3PNN A;  2BO8 A;  4B5B A;  2W0V A;  4HO5 A;  2I5K A;  2ICX A;  1ZCT A;  2XWL A;  1ZJ0 A;  4GBP A;  3USR A;  1OMZ A;  2WEE A;  1H4C A;  4DDZ A;  1NWG B;  4FRD A;  4HOC A;  2BO7 A;  5C3D A;  3ZGF A;  4K6R A;  2JCL A;  3SXA A;  1LZ0 A;  3DJ4 A;  2V0H A;  1H5R B;  5FU8 A;  1FO9 A;  2RJ4 A;  4Y7F A;  3OH4 A;  1H7L A;  1LL0 A;  1WT1 A;  2WVK A;  2YES A;  5DDT A;  1H3M A;  1PZY B;  5FV9 A;  1H7F A;  5IDT A;  2RJ9 A;  2XMH A;  1QWJ A;  5C4D A;  1XZ6 A;  1ON6 A;  4KPZ A;  1VIC A;  1ZIZ A;  1R80 A;  4XWI A;  3I0G A;  1FOA A;  4EEO A;  1G1L A;  1QG8 A;  1ZI4 A;  4AAW A;  3U2U A;  2V0J A;  1VH1 A;  3ZLL A;  2X60 A;  5EJZ A;  2JCJ A;  2ICY A;  4G3Q A;  1GQC A;  4L41 C;  1PZT A;  2APC A;  1R7U A;  3T7M A;  4KNX A;  3T7N A;  1EYR A;  4D11 C;  5EJ1 A;  5DDV A;  3LW6 A;  2P72 A;  2Y4M A;  2WVM A;  1ZJ2 A;  5C4E A;  4EE4 A;  1H7G A;  2P73 A;  1R82 A;  5J49 A;  3CKQ A;  4Y63 A;  3U0Y A;  5CMJ A;  1HM8 A;  4AYL A;  1O0R A;  2YC5 A;  3BRK X;  3RMV A;  4AYJ A;  2Z87 A;  2GGO A;  3R3I A;  1GQ9 A;  1H4E A;  2WGZ A;  5FTS A;  1INI A;  2XME A;  3SX7 A;  1JYL A;  2D7R A;  2JCO A;  3I0J A;  3V90 A;  1GA8 A;  3ST8 A;  3ZGG A;  2VXL A;  3HL3 A;  3CKJ A;  1S4O A;  1R7V A;  5CQN X;  4DEC A;  3CKV A;  2VSI A;  4B3U A;  5C4B A;  1HM9 A;  1ZJO A;  4EEG A;  2O1F A;  4E1K A;  1VPA A;  1NKH B;  1Z90 A;  4P00 A;  4B4G A;  4D11 A;  3SXD A;  1GWW A;  1H7E A;  3CGX A;  1V84 A;  2I7B A;  3D5N A;  4KXO A;  2FFV A;  4CJC A;  3V8Z A;  4JD0 A;  2W0W A;  1LVW A;  1FWY A;  1ZJ1 A;  3DK5 A;  3OGZ A;  5CQP A;  2VS4 A;  4B2W A;  1NMM B;  4Y7V A;  3GUE A;  3PKQ A;  2MZB A;  1VGT A;  3U2T A;  2VS3 A;  2OI6 A;  2GGQ A;  2RJ5 A;  1VGU A;  4EE5 A;  3I0K A;  4D48 A;  5C48 A;  5HS2 A;  2AE7 A;  2CU2 A;  5C1H A;  2PX7 A;  2VS5 A;  1HJJ A;  4HO6 A;  1VZU A;  1I52 A;  3OC9 A;  3EE5 A;  2RJ6 A;  4EEM A;  1ZHJ A;  5CQM X;  2QGI A;  2OEF A;  1ZDF A;  3Q7U A;  1TW5 A;  1YP3 A;  4FCU A;  1KWS A;  4AC3 A;  3I0H A;  2FYA A;  1ZCU A;  1GWV A;  2ZU9 A;  4KPX A;  3V91 A;  1W55 A;  4FRQ A;  3OH3 A;  1E5K A;  1S4P A;  4B2X A;  4HO2 A;  4HO0 A;  4Y9X A;  3V0O A;  5FTV A;  1H7H A;  1HM0 A;  2JCK A;  1V82 A;  2AGD A;  1W77 A;  1FRW A;  4Y7U A;  4FRP A;  5L6V A;  3F1C A;  3K8D A;  1JYK A;  2QKX A;  3IOI A;  4Y62 A;  3K8E A;  1H5T B;  4ARW A;  3CKO A;  1O7O A;  3JUK A;  5C49 A;  2XWN A;  2RIX A;  3RMW A;  4G87 A;  3JTJ A;  1R7X A;  4G3S A;  4MND A;  1H5S D;  2QH5 A;  3V0M A;  5EIY A;  1WT0 A;  4B42 A;  4FRO A;  5C4C A;  1O23 B;  1NHE B;  3RSB A;  1H5S A;  4CVH A;  1JVD A;  2FFU A;  4CJB A;  5FUH A;  1LZJ A;  1ZI3 A;  3O3P A;  1EZI A;  1VGW A;  1FZW A;  1GX4 A;  1ZJP A;  3I0C A;  1ZI1 A;  2WE9 A;  1JV1 A;  4KC1 A;  2YQC A;  5AJO A;  2D0J A;  1TZF A;  2AH9 A;  3CU0 A;  3V0N A;  5FU0 A;  4Y7G A;  3SXG A;  1OQM B;  2Y4L A;  1ON8 A;  4LW3 A;  4J18 A;  4ASY A;  5CQO A;  2YQJ A;  3ZLK A;  1HJL A;  1G2V A;  3SXB A;  1H5T A;  4IRP A;  1V83 A;  4NAI A;  3NGW A;  2PGV A;  1W57 A;  3V0Q A;  2AES A;  3IOJ A;  2WAW A;  3SPT A;  3SXC A;  2PA4 A;  3DUV A;  1XHB A;  4M4K A;  4Y7T A;  4FRE A;  2RJ7 A;  5C1G A;  2O1H A;  1G3L A;  3D98 A;  1G97 A;  3ZF8 A;  4YS8 A;  4KRV A;  5JQQ A;  1LZI A;  1VGZ A;  2AM5 A;  1K4V A;  5CMF X;  1INJ A;  1WT3 A;  1G0R A;  4ASJ A;  5C1L A;  5C47 A;  4MYB A;  5C36 A;  5I1F A;  1S4N A;  2WVL A;  1G8O A;  2Z86 A;  1WSZ A;  3I0F A;  4HO4 A;  1MC3 A;  2OEG A;  4FRL A;  4HO3 A;  1QGS A;  5AJN A;  2DPW A;  4Y64 A;  4M2B A;  1FXO A;  2RJ0 A;  2BO6 A;  5L6S A;  1MP3 A;  2VD4 A;  4D0Z A;  5C3A A;  1QGQ A;  1JV3 A;  1FXJ A;  2OI7 A;  3SX5 A;  5C4F A;  4M28 A;  2Y4J A;  1H4D A;  2FYC B;  1H5S B;  2Y4K A;  3I0I X;  1IIN A;  5AJP A;  1H5S C;  2D7I A;  4BMA A;  1ZCY A;  2RJ1 A;  5IDS A;  3OH1 A;  2RJ8 A;  2YQS A;  3E26 A;  4NAN A;  4CJ8 A;  3U0X A;  4FCE A;  3Q80 A;  1H7Q A;  3USQ A;  4B4B A;  1WT2 A;  1VZT A;  2BO4 A;  1WVC A;  1VZX A;  4HO9 A;  1R81 A;  1YP4 A;  3I0E A;  4FRB A;  2ZU8 A;  3Q4S A;  2PGY A;  3OH2 A;  2A8W A;  2Y6P A;  2Y7A A;  3D8V A;  4Y6U A;  1OMX A;  3SXE A;  1G9R A;  3U2X A;  2ZU7 A;  1NQI B;  2OI5 A;  2XWM A;  3V8Y A;  2P6W A;  2NXV A;  4FRH A;  3QVB A;  4ZDQ A;  3FOQ A;  4EVW A;  3E25 A;  2AM4 A;  4HO8 A;  1R7T A;  4DE7 A;  2V0K A;  2E3D A;  1FR9 A;  2YC3 A;  3U2V A;  2E8B A;  1G95 A;  1IIM A;  1VM8 A;  2X5S A;  4KNR A;  2FYD B;  1ZCV A;  5CMH A;  4FQW A;  2YQH A;  2V0L A;  2AEC A;  1GX0 A;  1MP4 A;  4HCQ A;  2X5Z A;  1FGX A;  5BXC A;  1G23 A;  4NAK A;  3KIA A;  2FYB A;  3SX8 A;  2Q4J A;  3OH0 A;  4UEG A;  1VH3 A;  1JVG A;  2X65 A;  1LZ7 A;  1ZDG A;  1FO8 A;  5CMG X;  1MP5 A;  3I0L A;  3R2W A;  1NF5 B;  3OKR A;  2AM3 A;  2RIZ A;  1YRO B;  5CQL X;  5C3B A;  1FG5 N;  1R7Y A;  4JIS A;  4BQH A;  4FRA A;  1H5R A;  3POL A;  4IRQ A;  2V0I A;  3SX3 A;  5CMI A;  2VSH A;  5C8R A;  1YP2 A;  1ZJ3 A;  3TQD A;  2VXM A; 
#chains in the Genus database with same CATH topology
 3F1Y A;  3V0L A;  2I5E A;  4KC2 A;  1SS9 A;  4R7P A;  4P02 A;  1H7T A;  4EEA A;  4ECM A;  4NAL A;  2O1G A;  3IOH A;  1G93 A;  2A8U A;  2FY7 A;  1FR8 A;  3V0P A;  1LL3 A;  4C2S A;  3N9W A;  3U2W A;  2VFZ A;  4KT7 A;  1O7Q A;  4G3P A;  4HG6 A;  3OAM A;  3TZT A;  4D0T A;  2RIT A;  1HV9 A;  3T7O A;  1TW1 A;  4B4M A;  2YCM A;  5FYE A;  4M2A A;  1TVY A;  5C38 A;  1LL2 A;  5IFY A;  2RIY A;  2UX8 A;  4FRM A;  4LW6 A;  3CKN A;  3PKP A;  4KQL A;  4EE3 A;  3FWW A;  3BCV A;  3JUJ A;  4Y6N A;  1FGG A;  3I0D A;  4KC4 A;  1ZI5 A;  3PNN A;  2BO8 A;  4B5B A;  2W0V A;  4HO5 A;  2I5K A;  2ICX A;  1ZCT A;  2XWL A;  1ZJ0 A;  4GBP A;  3USR A;  1OMZ A;  2WEE A;  1H4C A;  4DDZ A;  1NWG B;  4FRD A;  4HOC A;  4MIX A;  2BO7 A;  5C3D A;  3ZGF A;  4K6R A;  2JCL A;  3SXA A;  1LZ0 A;  2J0A A;  3DJ4 A;  2V0H A;  1H5R B;  5FU8 A;  1FO9 A;  2RJ4 A;  4Y7F A;  3OH4 A;  1H7L A;  1LL0 A;  1WT1 A;  2WVK A;  2YES A;  5DDT A;  1H3M A;  1PZY B;  5FV9 A;  1H7F A;  5IDT A;  2RJ9 A;  2XMH A;  1QWJ A;  5C4D A;  1XZ6 A;  1ON6 A;  4KPZ A;  1VIC A;  1ZIZ A;  1R80 A;  4XWI A;  3I0G A;  1FOA A;  4EEO A;  1G1L A;  1QG8 A;  1ZI4 A;  4AAW A;  3U2U A;  2V0J A;  1VH1 A;  3ZLL A;  2X60 A;  5EJZ A;  2JCJ A;  2ICY A;  4G3Q A;  1GQC A;  4L41 C;  1PZT A;  2APC A;  1R7U A;  3T7M A;  4KNX A;  3T7N A;  1EYR A;  4D11 C;  5EJ1 A;  5DDV A;  3LW6 A;  2P72 A;  2Y4M A;  2WVM A;  1ZJ2 A;  5C4E A;  4EE4 A;  1H7G A;  2P73 A;  1R82 A;  5J49 A;  3CKQ A;  4Y63 A;  3U0Y A;  2VK9 A;  5CMJ A;  1HM8 A;  4AYL A;  1O0R A;  2YC5 A;  3BRK X;  3RMV A;  4AYJ A;  2Z87 A;  2GGO A;  3R3I A;  1GQ9 A;  1H4E A;  2WGZ A;  5FTS A;  1INI A;  2XME A;  3SX7 A;  1JYL A;  2D7R A;  2JCO A;  3I0J A;  3V90 A;  1GA8 A;  3ST8 A;  3ZGG A;  2VXL A;  3HL3 A;  3CKJ A;  1S4O A;  1R7V A;  5CQN X;  4DEC A;  3CKV A;  2VSI A;  4B3U A;  5C4B A;  1HM9 A;  1ZJO A;  4EEG A;  2O1F A;  4E1K A;  1VPA A;  1NKH B;  1Z90 A;  4P00 A;  4B4G A;  4D11 A;  3SXD A;  1GWW A;  1H7E A;  3CGX A;  1V84 A;  2I7B A;  3D5N A;  4KXO A;  2FFV A;  4CJC A;  3V8Z A;  4JD0 A;  2W0W A;  1LVW A;  1FWY A;  1ZJ1 A;  3DK5 A;  3OGZ A;  5CQP A;  2VS4 A;  4B2W A;  1NMM B;  4Y7V A;  3GUE A;  3PKQ A;  2MZB A;  1VGT A;  3U2T A;  2VS3 A;  2OI6 A;  2GGQ A;  2RJ5 A;  1VGU A;  4EE5 A;  3I0K A;  4D48 A;  5C48 A;  5HS2 A;  2AE7 A;  2CU2 A;  5C1H A;  2PX7 A;  2VS5 A;  1HJJ A;  4HO6 A;  1VZU A;  1I52 A;  3OC9 A;  3EE5 A;  2RJ6 A;  4EEM A;  1ZHJ A;  5CQM X;  2QGI A;  2OEF A;  1ZDF A;  3Q7U A;  1TW5 A;  1YP3 A;  4FCU A;  1KWS A;  4AC3 A;  3I0H A;  2FYA A;  1ZCU A;  1GWV A;  2ZU9 A;  4KPX A;  3V91 A;  1W55 A;  4FRQ A;  3OH3 A;  1E5K A;  1S4P A;  4B2X A;  4HO2 A;  4HO0 A;  5D92 A;  4Y9X A;  3V0O A;  5FTV A;  1H7H A;  1HM0 A;  2JCK A;  1V82 A;  2AGD A;  1W77 A;  1FRW A;  4Y7U A;  4FRP A;  5L6V A;  3F1C A;  3K8D A;  1JYK A;  2QKX A;  3IOI A;  4Y62 A;  3K8E A;  1H5T B;  4ARW A;  3CKO A;  1O7O A;  3JUK A;  5C49 A;  2XWN A;  2C0N A;  2RIX A;  3RMW A;  4G87 A;  3JTJ A;  1R7X A;  4G3S A;  4MND A;  1H5S D;  2QH5 A;  3V0M A;  5EIY A;  1WT0 A;  4B42 A;  4FRO A;  5C4C A;  1O23 B;  1NHE B;  3RSB A;  1H5S A;  4CVH A;  1JVD A;  2FFU A;  4CJB A;  5FUH A;  1LZJ A;  1ZI3 A;  4Q7C A;  5D91 A;  3O3P A;  1EZI A;  1VGW A;  1FZW A;  1GX4 A;  1ZJP A;  3I0C A;  1ZI1 A;  2WE9 A;  1JV1 A;  4KC1 A;  2YQC A;  5AJO A;  2D0J A;  1TZF A;  2AH9 A;  3CU0 A;  3V0N A;  5FU0 A;  4Y7G A;  3SXG A;  1OQM B;  2Y4L A;  1ON8 A;  4LW3 A;  4J18 A;  4ASY A;  5CQO A;  2YQJ A;  3ZLK A;  1HJL A;  1G2V A;  3SXB A;  1H5T A;  4IRP A;  1V83 A;  2J0B A;  4NAI A;  3NGW A;  2PGV A;  1W57 A;  3V0Q A;  2AES A;  3IOJ A;  2WAW A;  3SPT A;  3SXC A;  2PA4 A;  3DUV A;  1XHB A;  4M4K A;  4Y7T A;  4FRE A;  2RJ7 A;  5C1G A;  2O1H A;  1G3L A;  3D98 A;  1G97 A;  3ZF8 A;  4YS8 A;  4KRV A;  5JQQ A;  1LZI A;  1VGZ A;  2AM5 A;  1K4V A;  5CMF X;  1INJ A;  1WT3 A;  1G0R A;  4ASJ A;  5C1L A;  5C47 A;  4MYB A;  5C36 A;  5I1F A;  1S4N A;  2WVL A;  1G8O A;  2Z86 A;  1WSZ A;  3I0F A;  4HO4 A;  1MC3 A;  2OEG A;  4FRL A;  4HO3 A;  1QGS A;  5AJN A;  2DPW A;  4Y64 A;  4M2B A;  1FXO A;  2RJ0 A;  2BO6 A;  5L6S A;  1MP3 A;  2VD4 A;  4D0Z A;  5C3A A;  1QGQ A;  1JV3 A;  1FXJ A;  2OI7 A;  4FIY A;  3SX5 A;  5C4F A;  4M28 A;  2Y4J A;  1H4D A;  2FYC B;  1H5S B;  2Y4K A;  3I0I X;  1IIN A;  5AJP A;  1H5S C;  2D7I A;  4FIX A;  4BMA A;  1ZCY A;  2RJ1 A;  5IDS A;  3OH1 A;  2RJ8 A;  2YQS A;  3E26 A;  4NAN A;  4CJ8 A;  3U0X A;  4FCE A;  3Q80 A;  1H7Q A;  3USQ A;  4B4B A;  1WT2 A;  1VZT A;  2BO4 A;  1WVC A;  1VZX A;  4HO9 A;  1R81 A;  1YP4 A;  3I0E A;  4FRB A;  2ZU8 A;  3Q4S A;  2PGY A;  3OH2 A;  2A8W A;  2Y6P A;  2Y7A A;  3D8V A;  4Y6U A;  4O6N A;  1OMX A;  3SXE A;  1G9R A;  3U2X A;  2ZU7 A;  1NQI B;  2OI5 A;  2XWM A;  3V8Y A;  2P6W A;  2NXV A;  4FRH A;  3QVB A;  4ZDQ A;  3FOQ A;  4EVW A;  3E25 A;  2AM4 A;  4HO8 A;  1R7T A;  4DE7 A;  2V0K A;  2E3D A;  1FR9 A;  2YC3 A;  3U2V A;  2E8B A;  1G95 A;  1IIM A;  2X5S A;  1VM8 A;  4KNR A;  2FYD B;  1ZCV A;  5CMH A;  4FQW A;  2YQH A;  2V0L A;  2AEC A;  1GX0 A;  1MP4 A;  4HCQ A;  2X5Z A;  1FGX A;  5BXC A;  1G23 A;  4NAK A;  3KIA A;  2FYB A;  3SX8 A;  2Q4J A;  3OH0 A;  4UEG A;  1VH3 A;  1JVG A;  2X65 A;  1LZ7 A;  4O6M A;  1ZDG A;  1FO8 A;  5CMG X;  1MP5 A;  3I0L A;  3R2W A;  1NF5 B;  3OKR A;  2AM3 A;  2RIZ A;  1YRO B;  5CQL X;  5C3B A;  1FG5 N;  1R7Y A;  4JIS A;  4BQH A;  4FRA A;  1H5R A;  3POL A;  4IRQ A;  2V0I A;  3SX3 A;  5CMI A;  2VSH A;  5C8R A;  1YP2 A;  1ZJ3 A;  3TQD A;  2VXM A; 
#chains in the Genus database with same CATH homology
 3F1Y A;  3V0L A;  2I5E A;  4KC2 A;  1SS9 A;  4R7P A;  4P02 A;  1H7T A;  4EEA A;  4ECM A;  4NAL A;  2O1G A;  3IOH A;  1G93 A;  2A8U A;  2FY7 A;  1FR8 A;  3V0P A;  1LL3 A;  4C2S A;  3N9W A;  3U2W A;  2VFZ A;  4KT7 A;  1O7Q A;  4G3P A;  4HG6 A;  3OAM A;  3TZT A;  4D0T A;  2RIT A;  1HV9 A;  3T7O A;  1TW1 A;  4B4M A;  2YCM A;  5FYE A;  4M2A A;  1TVY A;  5C38 A;  1LL2 A;  5IFY A;  2RIY A;  2UX8 A;  4FRM A;  4LW6 A;  3CKN A;  3PKP A;  4KQL A;  4EE3 A;  3FWW A;  3BCV A;  3JUJ A;  4Y6N A;  1FGG A;  3I0D A;  4KC4 A;  1ZI5 A;  3PNN A;  2BO8 A;  4B5B A;  2W0V A;  4HO5 A;  2I5K A;  2ICX A;  1ZCT A;  2XWL A;  1ZJ0 A;  4GBP A;  3USR A;  1OMZ A;  2WEE A;  1H4C A;  4DDZ A;  1NWG B;  4FRD A;  4HOC A;  4MIX A;  2BO7 A;  5C3D A;  3ZGF A;  4K6R A;  2JCL A;  3SXA A;  1LZ0 A;  2J0A A;  3DJ4 A;  2V0H A;  1H5R B;  5FU8 A;  1FO9 A;  2RJ4 A;  4Y7F A;  3OH4 A;  1H7L A;  1LL0 A;  1WT1 A;  2WVK A;  2YES A;  5DDT A;  1H3M A;  1PZY B;  5FV9 A;  1H7F A;  5IDT A;  2RJ9 A;  2XMH A;  1QWJ A;  5C4D A;  1XZ6 A;  1ON6 A;  4KPZ A;  1VIC A;  1ZIZ A;  1R80 A;  4XWI A;  3I0G A;  1FOA A;  4EEO A;  1G1L A;  1QG8 A;  1ZI4 A;  4AAW A;  3U2U A;  2V0J A;  1VH1 A;  3ZLL A;  2X60 A;  5EJZ A;  2JCJ A;  2ICY A;  4G3Q A;  1GQC A;  4L41 C;  1PZT A;  2APC A;  1R7U A;  3T7M A;  4KNX A;  3T7N A;  1EYR A;  4D11 C;  5EJ1 A;  5DDV A;  3LW6 A;  2P72 A;  2Y4M A;  2WVM A;  1ZJ2 A;  5C4E A;  4EE4 A;  1H7G A;  2P73 A;  1R82 A;  5J49 A;  3CKQ A;  4Y63 A;  3U0Y A;  2VK9 A;  5CMJ A;  1HM8 A;  4AYL A;  1O0R A;  2YC5 A;  3BRK X;  3RMV A;  4AYJ A;  2Z87 A;  2GGO A;  3R3I A;  1GQ9 A;  1H4E A;  2WGZ A;  5FTS A;  1INI A;  2XME A;  3SX7 A;  1JYL A;  2D7R A;  2JCO A;  3I0J A;  3V90 A;  1GA8 A;  3ST8 A;  3ZGG A;  2VXL A;  3HL3 A;  3CKJ A;  1S4O A;  1R7V A;  5CQN X;  4DEC A;  3CKV A;  2VSI A;  4B3U A;  5C4B A;  1HM9 A;  1ZJO A;  4EEG A;  2O1F A;  4E1K A;  1VPA A;  1NKH B;  1Z90 A;  4P00 A;  4B4G A;  4D11 A;  3SXD A;  1GWW A;  1H7E A;  3CGX A;  1V84 A;  2I7B A;  3D5N A;  4KXO A;  2FFV A;  4CJC A;  3V8Z A;  4JD0 A;  2W0W A;  1LVW A;  1FWY A;  1ZJ1 A;  3DK5 A;  3OGZ A;  5CQP A;  2VS4 A;  4B2W A;  1NMM B;  4Y7V A;  3GUE A;  3PKQ A;  2MZB A;  1VGT A;  3U2T A;  2VS3 A;  2OI6 A;  2GGQ A;  2RJ5 A;  1VGU A;  4EE5 A;  3I0K A;  4D48 A;  5C48 A;  5HS2 A;  2AE7 A;  2CU2 A;  5C1H A;  2PX7 A;  2VS5 A;  1HJJ A;  4HO6 A;  1VZU A;  1I52 A;  3OC9 A;  3EE5 A;  2RJ6 A;  4EEM A;  1ZHJ A;  5CQM X;  2QGI A;  2OEF A;  1ZDF A;  3Q7U A;  1TW5 A;  1YP3 A;  4FCU A;  1KWS A;  4AC3 A;  3I0H A;  2FYA A;  1ZCU A;  1GWV A;  2ZU9 A;  4KPX A;  3V91 A;  1W55 A;  4FRQ A;  3OH3 A;  1E5K A;  1S4P A;  4B2X A;  4HO2 A;  4HO0 A;  5D92 A;  4Y9X A;  3V0O A;  5FTV A;  1H7H A;  1HM0 A;  2JCK A;  1V82 A;  2AGD A;  1W77 A;  1FRW A;  4Y7U A;  4FRP A;  5L6V A;  3F1C A;  3K8D A;  1JYK A;  2QKX A;  3IOI A;  4Y62 A;  3K8E A;  1H5T B;  4ARW A;  3CKO A;  1O7O A;  3JUK A;  5C49 A;  2XWN A;  2C0N A;  2RIX A;  3RMW A;  4G87 A;  3JTJ A;  1R7X A;  4G3S A;  4MND A;  1H5S D;  2QH5 A;  3V0M A;  5EIY A;  1WT0 A;  4B42 A;  4FRO A;  5C4C A;  1O23 B;  1NHE B;  3RSB A;  1H5S A;  4CVH A;  1JVD A;  2FFU A;  4CJB A;  5FUH A;  1LZJ A;  1ZI3 A;  4Q7C A;  5D91 A;  3O3P A;  1EZI A;  1VGW A;  1FZW A;  1GX4 A;  1ZJP A;  3I0C A;  1ZI1 A;  2WE9 A;  1JV1 A;  4KC1 A;  2YQC A;  5AJO A;  2D0J A;  1TZF A;  2AH9 A;  3CU0 A;  3V0N A;  5FU0 A;  4Y7G A;  3SXG A;  1OQM B;  2Y4L A;  1ON8 A;  4LW3 A;  4J18 A;  4ASY A;  5CQO A;  2YQJ A;  3ZLK A;  1HJL A;  1G2V A;  3SXB A;  1H5T A;  4IRP A;  1V83 A;  2J0B A;  4NAI A;  3NGW A;  2PGV A;  1W57 A;  3V0Q A;  2AES A;  3IOJ A;  2WAW A;  3SPT A;  3SXC A;  2PA4 A;  3DUV A;  1XHB A;  4M4K A;  4Y7T A;  4FRE A;  2RJ7 A;  5C1G A;  2O1H A;  1G3L A;  3D98 A;  1G97 A;  3ZF8 A;  4YS8 A;  4KRV A;  5JQQ A;  1LZI A;  1VGZ A;  2AM5 A;  1K4V A;  5CMF X;  1INJ A;  1WT3 A;  1G0R A;  4ASJ A;  5C1L A;  5C47 A;  4MYB A;  5C36 A;  5I1F A;  1S4N A;  2WVL A;  1G8O A;  2Z86 A;  1WSZ A;  3I0F A;  4HO4 A;  1MC3 A;  2OEG A;  4FRL A;  4HO3 A;  1QGS A;  5AJN A;  2DPW A;  4Y64 A;  4M2B A;  1FXO A;  2RJ0 A;  2BO6 A;  5L6S A;  1MP3 A;  2VD4 A;  4D0Z A;  5C3A A;  1QGQ A;  1JV3 A;  1FXJ A;  2OI7 A;  4FIY A;  3SX5 A;  5C4F A;  4M28 A;  2Y4J A;  1H4D A;  2FYC B;  1H5S B;  2Y4K A;  3I0I X;  1IIN A;  5AJP A;  1H5S C;  2D7I A;  4FIX A;  4BMA A;  1ZCY A;  2RJ1 A;  5IDS A;  3OH1 A;  2RJ8 A;  2YQS A;  3E26 A;  4NAN A;  4CJ8 A;  3U0X A;  4FCE A;  3Q80 A;  1H7Q A;  3USQ A;  4B4B A;  1WT2 A;  1VZT A;  2BO4 A;  1WVC A;  1VZX A;  4HO9 A;  1R81 A;  1YP4 A;  3I0E A;  4FRB A;  2ZU8 A;  3Q4S A;  2PGY A;  3OH2 A;  2A8W A;  2Y6P A;  2Y7A A;  3D8V A;  4Y6U A;  4O6N A;  1OMX A;  3SXE A;  1G9R A;  3U2X A;  2ZU7 A;  1NQI B;  2OI5 A;  2XWM A;  3V8Y A;  2P6W A;  2NXV A;  4FRH A;  3QVB A;  4ZDQ A;  3FOQ A;  4EVW A;  3E25 A;  2AM4 A;  4HO8 A;  1R7T A;  4DE7 A;  2V0K A;  2E3D A;  1FR9 A;  2YC3 A;  3U2V A;  2E8B A;  1G95 A;  1IIM A;  2X5S A;  1VM8 A;  4KNR A;  2FYD B;  1ZCV A;  5CMH A;  4FQW A;  2YQH A;  2V0L A;  2AEC A;  1GX0 A;  1MP4 A;  4HCQ A;  2X5Z A;  1FGX A;  5BXC A;  1G23 A;  4NAK A;  3KIA A;  2FYB A;  3SX8 A;  2Q4J A;  3OH0 A;  4UEG A;  1VH3 A;  1JVG A;  2X65 A;  1LZ7 A;  4O6M A;  1ZDG A;  1FO8 A;  5CMG X;  1MP5 A;  3I0L A;  3R2W A;  1NF5 B;  3OKR A;  2AM3 A;  2RIZ A;  1YRO B;  5CQL X;  5C3B A;  1FG5 N;  1R7Y A;  4JIS A;  4BQH A;  4FRA A;  1H5R A;  3POL A;  4IRQ A;  2V0I A;  3SX3 A;  5CMI A;  2VSH A;  5C8R A;  1YP2 A;  1ZJ3 A;  3TQD A;  2VXM A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...