2VFZA

Crystal structure of alpha-1,3 galactosyltransferase (r365k) in complex with udp-2f-galactose
Total Genus 101
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
101
sequence length
278
structure length
278
Chain Sequence
KLKLSDWFNPFKRPEVVTMTKWKAPVVWEGTYNRAVLDNYYAKQKITVGLTVFAVGRYIEHYLEEFLTSANKHFMVGHPVIFYIMVDDVSRMPLIELGPLRSFKVFKIKPEKRWQDISMMRMKTIGEHIVAHIQHEVDFLFCMDVDQVFQDKFGVETLGESVAQLQAWWYKADPNDFTYERRKESAAYIPFGEGDFYYHAAIFGGTPTQVLNITQECFKGILKDKKNDIEAQWHDESHLNKYFLLNKPTKILSPEYCWDYHIGLPADIKLVKMSWQTK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords N-ACETYLLACTOSAMINIDE ALPHA-1,3-GALACTOSYL TRANSFERASE
publication title Conformational Changes Induced by Binding Udp-2F-Galactose to Alpha-1,3 Galactosyltransferase-Implications for Catalysis
pubmed doi rcsb
source organism Bos taurus
molecule tags Transferase
total genus 101
structure length 278
sequence length 278
chains with identical sequence B
ec nomenclature ec 2.4.1.87: N-acetyllactosaminide 3-alpha-galactosyltransferase.
pdb deposition date 2007-11-06
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.550.10 Alpha Beta Alpha-Beta Complex Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A 2vfzA00
3R3IA 2CU2A 1K4VA 4FRDA 2V0HA 3SX8A 5C48A 5AJPA 4D48A 5C47A 3SX5A 2I5EA 4G3SA 2BO7A 3F1YA 5C4DA 4P02A 2ZU9A 3OH2A 5AJOA 4D11C 1TW5A 3PKPA 3IOHA 1GX4A 2OI5A 5C1GA 4FRAA 1H5SC 3U0XA 4FCUA 1GQCA 3CGXA 4MNDA 1ZJ1A 2O1GA 3ZF8A 4Y7FA 2W0WA 1OQMB 3NGWA 4DDZA 1MP3A 1MP4A 4KNRA 2YC5A 1QWJA 2GGQA 1G2VA 1NKHB 1ZIZA 1MC3A 3ZGGA 4Y6UA 4B4GA 5C49A 1QGSA 1FZWA 5CMIA 1LVWA 3K8EA 5C1LA 3U2WA 2BO4A 4BMAA 3I0HA 4M2AA 3I0JA 4ZDQA 2DPWA 3BRKX 1R7TA 3F1CA 1WT2A 2FY7A 1OMXA 3E25A 3TQDA 2W0VA 2V0JA 4KC1A 1HM0A 2UX8A 4Y7GA 4HO8A 4Y7UA 4LW3A 1H5TA 5C1HA 4DECA 2JCOA 3BCVA 3TZTA 1ZCTA 4LW6A 3CU0A 2FYBA 3V0MA 3SXBA 1ZJ0A 3IOJA 1W55A 1JYKA 4NAIA 4Y63A 1FO8A 3CKJA 1W57A 2PX7A 3V0PA 1VH3A 4MYBA 3V8ZA 3CKVA 5L6SA 2PGVA 2RJ7A 3D8VA 3Q80A 3I0DA 3OKRA 4M28A 4CVHA 1ZI5A 2YQCA 2Y4KA 1VGZA 2WVMA 4EE5A 5FTVA 3SX3A 4HO3A 1H5SB 2RJ4A 1I52A 1S4NA 3Q4SA 2XMHA 2V0LA 2OEGA 1FG5N 2WEEA 1VM8A 2X65A 3O3PA 2I5KA 1JVGA 1H7FA 4FRBA 4AC3A 4FRMA 3JTJA 3ZLLA 1KWSA 1ZCYA 2P72A 2YC3A 1ZCUA 1GWVA 1FOAA 1H7HA 4C2SA 1FRWA 5C4CA 1TVYA 2Q4JA 2OI7A 3SPTA 1G23A 1WT0A 4HO5A 1ON8A 2XWMA 2QGIA 4D0TA 3RSBA 3OH3A 3SX7A 2VXLA 2AM4A 2Y6PA 1O7QA 1R81A 1VGWA 2NXVA 1ZDFA 3T7OA 4B2XA 2YCMA 1H7LA 2RIXA 2BO6A 1H7EA 1QGQA 1YP3A 3V0NA 3R2WA 2X5ZA 2FFVA 4NANA 2QKXA 2AECA 1V84A 4Y6NA 5C3DA 4NAKA 4EEAA 1XZ6A 1H7TA 2VS5A 1ZHJA 1VPAA 2MZBA 5CMFX 1IIMA 2FYCB 4BQHA 1ZI3A 4YS8A 1LL0A 4FRQA 4NALA 3SXGA 4L41C 1LL2A 3D98A 2AM3A 2RJ8A 1EZIA 2Y4MA 3CKNA 5EIYA 2XWNA 3ST8A 2PA4A 3U2VA 4KT7A 4ECMA 5EJZA 3LW6A 1FGXA 1R7YA 3FWWA 2RJ0A 1NWGB 4CJBA 4FROA 4JISA 5IFYA 4ASJA 5EJ1A 1NMMB 2AM5A 5DDTA 3I0EA 4KXOA 5CQMX 1H7QA 3V8YA 2YQHA 4Y9XA 3GUEA 1GQ9A 1MP5A 1VZTA 2D7IA 2RIYA 3OH0A 3SXAA 4B3UA 3I0LA 2Y7AA 1FXOA 2GGOA 4EEOA 4DE7A 3T7NA 1W77A 1ZI4A 4KPXA 1R7UA 5FTSA 2RIZA 4CJCA 3FOQA 1GWWA 3KIAA 2OI6A 4FRPA 2AESA 5C4BA 1ON6A 1G0RA 2ICXA 2X5SA 4KC2A 5JQQA 2X60A 5L6VA 5C4EA 3OC9A 1GA8A 2RJ1A 3V0LA 1ZCVA 2VSHA 4J18A 3CKOA 1VICA 4CJ8A 1G97A 4Y7TA 1LZIA 4ASYA 1H5RA 1H4EA 1V83A 1O7OA 1HV9A 1Z90A 2JCLA 1G95A 2JCKA 1JYLA 5CQOA 2FFUA 4M4KA 1PZTA 1ZJPA 4HG6A 1FO9A 5BXCA 2RJ6A 3Q7UA 4FRLA 4HCQA 3JUKA 1H7GA 2AE7A 2Z86A 5CMHA 2WAWA 3SXCA 5AJNA 2A8UA 3JUJA 1INIA 2PGYA 1H5TB 3E26A 3QVBA 4GBPA 1ZI1A 4KRVA 4HO0A 1R82A 1SS9A 1YROB 3OH1A 4EEGA 1HJJA 2BO8A 3OAMA 4G3QA 3POLA 3DJ4A 3HL3A 4Y62A 4G87A 1S4PA 1WVCA 4FREA 3CKQA 4B5BA 4HO2A 4M2BA 2P73A 4ARWA 2V0KA 3PNNA 4KQLA 4IRPA 5CMGX 1WT3A 1LZ7A 2Z87A 3OGZA 1V82A 1VZXA 1R7VA 1INJA 1NQIB 1G93A 5FYEA 4EEMA 2YESA 3DUVA 2YQSA 3OH4A 2VSIA 2AGDA 1WSZA 2P6WA 5FU8A 4Y7VA 2Y4LA 3PKQA 1LZJA 1ZDGA 5FUHA 5FU0A 3U2TA 5C4FA 4Y64A 4XWIA 1ZJOA 3USQA 5CMJA 5HS2A 1NF5B 3U0YA 4P00A 3USRA 4K6RA 1IINA 2V0IA 4HO6A 4B2WA 3RMVA 4D11A 3SXDA 1QG8A 4AAWA 2O1FA 5C36A 2ZU7A 2RJ9A 5C3BA 1WT1A 2VS4A 2JCJA 5DDVA 1H5SA 4AYJA 1VZUA 3K8DA 2WVKA 2RJ5A 1G9RA 1G1LA 3U2UA 4JD0A 2D7RA 1FWYA 4EE3A 2Y4JA 1NHEB 3DK5A 4FQWA 2ZU8A 3I0KA 3IOIA 4B4BA 1H4CA 5CQLX 2E8BA 3V91A 3I0CA 2YQJA 1VH1A 1HM9A 1HJLA 4KNXA 2QH5A 1JV3A 4KPZA 5I1FA 1OMZA 2I7BA 2FYDB 5C3AA 1H4DA 1YP4A 2WE9A 1R80A 4R7PA 1LL3A 2WGZA 1LZ0A 4AYLA 2XMEA 1GX0A 4UEGA 3ZLKA 2ICYA 3U2XA 4D0ZA 4HOCA 2APCA 1FXJA 3I0IX 5CQNX 4G3PA 1O23B 3EE5A 2OEFA 5IDTA 3V90A 1HM8A 1O0RA 2E3DA 4IRQA 1G3LA 4FCEA 1TW1A 1S4OA 2XWLA 1H3MA 2VD4A 2VFZA 2A8WA 3I0GA 5IDSA 1JVDA 2AH9A 3RMWA 1ZJ2A 4B42A 5FV9A 4B4MA 1TZFA 3ZGFA 1FR9A 2RITA 1ZJ3A 4E1KA 1H5SD 1YP2A 1FGGA 2VXMA 4HO4A 1PZYB 3SXEA 4HO9A 1FR8A 1JV1A 3V0OA 1VGTA 5C38A 2O1HA 3T7MA 1EYRA 5C8RA 3N9WA 1G8OA 5J49A 2FYAA 1E5KA 4FRHA 1R7XA 5CQPA 2WVLA 1XHBA 3I0FA 3D5NA 4EVWA 3V0QA 4EE4A 4KC4A 2VS3A 1H5RB 1VGUA 2D0JA
chains in the Genus database with same CATH superfamily
3R3IA 2CU2A 1K4VA 4FRDA 2V0HA 3SX8A 5C48A 5AJPA 4D48A 5C47A 3SX5A 2I5EA 4G3SA 2BO7A 3F1YA 5C4DA 4P02A 2ZU9A 3OH2A 5AJOA 4D11C 1TW5A 3PKPA 3IOHA 1GX4A 2OI5A 5C1GA 4FRAA 1H5SC 3U0XA 4FCUA 1GQCA 3CGXA 4MNDA 1ZJ1A 2O1GA 3ZF8A 4Y7FA 2W0WA 1OQMB 3NGWA 4DDZA 1MP3A 1MP4A 4KNRA 2YC5A 1QWJA 2GGQA 1G2VA 1NKHB 1ZIZA 1MC3A 3ZGGA 4Y6UA 4B4GA 5C49A 1QGSA 1FZWA 5CMIA 1LVWA 3K8EA 5C1LA 3U2WA 2BO4A 4BMAA 3I0HA 4M2AA 3I0JA 4ZDQA 2DPWA 3BRKX 1R7TA 3F1CA 1WT2A 2FY7A 1OMXA 3E25A 3TQDA 2W0VA 2V0JA 4KC1A 1HM0A 2UX8A 4Y7GA 4HO8A 4Y7UA 4LW3A 1H5TA 5C1HA 4DECA 2JCOA 2VK9A 3BCVA 3TZTA 1ZCTA 4LW6A 3CU0A 2FYBA 3V0MA 3SXBA 1ZJ0A 3IOJA 1W55A 1JYKA 4NAIA 4Y63A 1FO8A 3CKJA 1W57A 2PX7A 3V0PA 1VH3A 4MYBA 3V8ZA 3CKVA 5L6SA 2PGVA 2RJ7A 3D8VA 3Q80A 4FIXA 3I0DA 3OKRA 4M28A 4CVHA 1ZI5A 2YQCA 2Y4KA 1VGZA 2WVMA 4EE5A 5FTVA 3SX3A 4HO3A 1H5SB 2RJ4A 1I52A 1S4NA 3Q4SA 2XMHA 2V0LA 2OEGA 1FG5N 2WEEA 1VM8A 2X65A 3O3PA 2I5KA 1JVGA 1H7FA 4FRBA 4AC3A 4FRMA 3JTJA 3ZLLA 1KWSA 1ZCYA 2P72A 2YC3A 1ZCUA 1GWVA 1FOAA 1H7HA 4C2SA 1FRWA 5C4CA 1TVYA 2Q4JA 2OI7A 3SPTA 1G23A 1WT0A 4HO5A 1ON8A 2XWMA 2QGIA 4D0TA 3RSBA 3OH3A 3SX7A 2VXLA 2AM4A 2Y6PA 1O7QA 1R81A 1VGWA 2J0AA 2NXVA 1ZDFA 3T7OA 4B2XA 2YCMA 1H7LA 2RIXA 2BO6A 1H7EA 1QGQA 1YP3A 3V0NA 3R2WA 2X5ZA 2FFVA 4NANA 2QKXA 2AECA 1V84A 4Y6NA 5C3DA 4NAKA 4EEAA 1XZ6A 1H7TA 2VS5A 1ZHJA 1VPAA 2MZBA 5CMFX 1IIMA 2FYCB 4BQHA 1ZI3A 4YS8A 1LL0A 4FRQA 4NALA 3SXGA 4L41C 1LL2A 3D98A 2AM3A 4FIYA 2RJ8A 1EZIA 2Y4MA 3CKNA 5EIYA 2XWNA 3ST8A 2PA4A 3U2VA 4KT7A 4ECMA 5EJZA 3LW6A 1FGXA 1R7YA 3FWWA 2RJ0A 1NWGB 4CJBA 4FROA 4JISA 5IFYA 4ASJA 5EJ1A 1NMMB 2AM5A 5DDTA 3I0EA 4KXOA 5CQMX 1H7QA 3V8YA 2YQHA 4Y9XA 3GUEA 4Q7CA 1GQ9A 1MP5A 1VZTA 4O6NA 2D7IA 2RIYA 3OH0A 3SXAA 4B3UA 3I0LA 2Y7AA 1FXOA 2GGOA 4EEOA 4MIXA 4DE7A 3T7NA 1W77A 1ZI4A 4KPXA 1R7UA 5FTSA 2RIZA 4CJCA 3FOQA 1GWWA 3KIAA 2OI6A 4FRPA 2AESA 5C4BA 1ON6A 1G0RA 2ICXA 2X5SA 4KC2A 5JQQA 2X60A 5L6VA 5C4EA 3OC9A 1GA8A 2RJ1A 3V0LA 1ZCVA 2VSHA 4J18A 3CKOA 1VICA 4CJ8A 1G97A 4Y7TA 1LZIA 4ASYA 1H5RA 1H4EA 1V83A 1O7OA 1HV9A 1Z90A 2JCLA 1G95A 2JCKA 1JYLA 5CQOA 2FFUA 4M4KA 1PZTA 1ZJPA 4HG6A 1FO9A 5BXCA 2RJ6A 3Q7UA 4FRLA 4HCQA 3JUKA 1H7GA 2AE7A 2Z86A 5CMHA 2WAWA 3SXCA 5AJNA 2A8UA 3JUJA 1INIA 2PGYA 1H5TB 3E26A 3QVBA 4GBPA 1ZI1A 4KRVA 4HO0A 1R82A 1SS9A 1YROB 3OH1A 4EEGA 1HJJA 2BO8A 3OAMA 4G3QA 3POLA 4O6MA 3DJ4A 3HL3A 4Y62A 4G87A 1S4PA 1WVCA 4FREA 3CKQA 4B5BA 4HO2A 4M2BA 2P73A 4ARWA 2V0KA 3PNNA 4KQLA 4IRPA 5CMGX 1WT3A 1LZ7A 2Z87A 3OGZA 1V82A 1VZXA 1R7VA 1INJA 1NQIB 1G93A 5FYEA 4EEMA 2YESA 3DUVA 2YQSA 3OH4A 2VSIA 2AGDA 1WSZA 2P6WA 5FU8A 4Y7VA 2Y4LA 3PKQA 1LZJA 1ZDGA 5FUHA 5FU0A 3U2TA 5C4FA 4Y64A 4XWIA 1ZJOA 3USQA 5CMJA 5HS2A 1NF5B 3U0YA 4P00A 3USRA 4K6RA 1IINA 2V0IA 4HO6A 4B2WA 3RMVA 4D11A 3SXDA 1QG8A 4AAWA 2O1FA 5C36A 2ZU7A 2RJ9A 5C3BA 1WT1A 2VS4A 2JCJA 5DDVA 1H5SA 4AYJA 1VZUA 3K8DA 2WVKA 2RJ5A 1G9RA 1G1LA 3U2UA 4JD0A 2D7RA 1FWYA 4EE3A 2Y4JA 1NHEB 3DK5A 4FQWA 2ZU8A 3I0KA 3IOIA 4B4BA 1H4CA 5CQLX 2E8BA 3V91A 3I0CA 2YQJA 1VH1A 1HM9A 1HJLA 4KNXA 2QH5A 1JV3A 4KPZA 5I1FA 1OMZA 2I7BA 2FYDB 5C3AA 1H4DA 1YP4A 2WE9A 1R80A 4R7PA 1LL3A 2WGZA 1LZ0A 4AYLA 2XMEA 1GX0A 4UEGA 5D91A 3ZLKA 2ICYA 3U2XA 4D0ZA 4HOCA 2APCA 1FXJA 3I0IX 5CQNX 4G3PA 1O23B 3EE5A 2OEFA 5IDTA 3V90A 1HM8A 1O0RA 2E3DA 4IRQA 1G3LA 4FCEA 1TW1A 1S4OA 2XWLA 1H3MA 2VD4A 2VFZA 2A8WA 3I0GA 5IDSA 1JVDA 2AH9A 3RMWA 1ZJ2A 2J0BA 4B42A 5FV9A 4B4MA 1TZFA 3ZGFA 1FR9A 2RITA 1ZJ3A 4E1KA 1H5SD 1YP2A 1FGGA 2VXMA 4HO4A 1PZYB 3SXEA 4HO9A 1FR8A 1JV1A 3V0OA 1VGTA 5C38A 2O1HA 5D92A 3T7MA 1EYRA 5C8RA 3N9WA 1G8OA 2C0NA 5J49A 2FYAA 1E5KA 4FRHA 1R7XA 5CQPA 2WVLA 1XHBA 3I0FA 3D5NA 4EVWA 3V0QA 4EE4A 4KC4A 2VS3A 1H5RB 1VGUA 2D0JA
chains in the Genus database with same CATH topology
3R3IA 2CU2A 1K4VA 4FRDA 2V0HA 3SX8A 5C48A 5AJPA 4D48A 5C47A 3SX5A 2I5EA 4G3SA 2BO7A 3F1YA 5C4DA 4P02A 2ZU9A 3OH2A 5AJOA 4D11C 1TW5A 3PKPA 3IOHA 1GX4A 2OI5A 5C1GA 4FRAA 1H5SC 3U0XA 4FCUA 1GQCA 3CGXA 4MNDA 1ZJ1A 2O1GA 3ZF8A 4Y7FA 2W0WA 1OQMB 3NGWA 4DDZA 1MP3A 1MP4A 4KNRA 2YC5A 1QWJA 2GGQA 1G2VA 1NKHB 1ZIZA 1MC3A 3ZGGA 4Y6UA 4B4GA 5C49A 1QGSA 1FZWA 5CMIA 1LVWA 3K8EA 5C1LA 3U2WA 2BO4A 4BMAA 3I0HA 4M2AA 3I0JA 4ZDQA 2DPWA 3BRKX 1R7TA 3F1CA 1WT2A 2FY7A 1OMXA 3E25A 3TQDA 2W0VA 2V0JA 4KC1A 1HM0A 2UX8A 4Y7GA 4HO8A 4Y7UA 4LW3A 1H5TA 5C1HA 4DECA 2JCOA 2VK9A 3BCVA 3TZTA 1ZCTA 4LW6A 3CU0A 2FYBA 3V0MA 3SXBA 1ZJ0A 3IOJA 1W55A 1JYKA 4NAIA 4Y63A 1FO8A 3CKJA 1W57A 2PX7A 3V0PA 1VH3A 4MYBA 3V8ZA 3CKVA 5L6SA 2PGVA 2RJ7A 3D8VA 3Q80A 4FIXA 3I0DA 3OKRA 4M28A 4CVHA 1ZI5A 2YQCA 2Y4KA 1VGZA 2WVMA 4EE5A 5FTVA 3SX3A 4HO3A 1H5SB 2RJ4A 1I52A 1S4NA 3Q4SA 2XMHA 2V0LA 2OEGA 1FG5N 2WEEA 1VM8A 2X65A 3O3PA 2I5KA 1JVGA 1H7FA 4FRBA 4AC3A 4FRMA 3JTJA 3ZLLA 1KWSA 1ZCYA 2P72A 2YC3A 1ZCUA 1GWVA 1FOAA 1H7HA 4C2SA 1FRWA 5C4CA 1TVYA 2Q4JA 2OI7A 3SPTA 1G23A 1WT0A 4HO5A 1ON8A 2XWMA 2QGIA 4D0TA 3RSBA 3OH3A 3SX7A 2VXLA 2AM4A 2Y6PA 1O7QA 1R81A 1VGWA 2J0AA 2NXVA 1ZDFA 3T7OA 4B2XA 2YCMA 1H7LA 2RIXA 2BO6A 1H7EA 1QGQA 1YP3A 3V0NA 3R2WA 2X5ZA 2FFVA 4NANA 2QKXA 2AECA 1V84A 4Y6NA 5C3DA 4NAKA 4EEAA 1XZ6A 1H7TA 2VS5A 1ZHJA 1VPAA 2MZBA 5CMFX 1IIMA 2FYCB 4BQHA 1ZI3A 4YS8A 1LL0A 4FRQA 4NALA 3SXGA 4L41C 1LL2A 3D98A 2AM3A 4FIYA 2RJ8A 1EZIA 2Y4MA 3CKNA 5EIYA 2XWNA 3ST8A 2PA4A 3U2VA 4KT7A 4ECMA 5EJZA 3LW6A 1FGXA 1R7YA 3FWWA 2RJ0A 1NWGB 4CJBA 4FROA 4JISA 5IFYA 4ASJA 5EJ1A 1NMMB 2AM5A 5DDTA 3I0EA 4KXOA 5CQMX 1H7QA 3V8YA 2YQHA 4Y9XA 3GUEA 4Q7CA 1GQ9A 1MP5A 1VZTA 4O6NA 2D7IA 2RIYA 3OH0A 3SXAA 4B3UA 3I0LA 2Y7AA 1FXOA 2GGOA 4EEOA 4MIXA 4DE7A 3T7NA 1W77A 1ZI4A 4KPXA 1R7UA 5FTSA 2RIZA 4CJCA 3FOQA 1GWWA 3KIAA 2OI6A 4FRPA 2AESA 5C4BA 1ON6A 1G0RA 2ICXA 2X5SA 4KC2A 5JQQA 2X60A 5L6VA 5C4EA 3OC9A 1GA8A 2RJ1A 3V0LA 1ZCVA 2VSHA 4J18A 3CKOA 1VICA 4CJ8A 1G97A 4Y7TA 1LZIA 4ASYA 1H5RA 1H4EA 1V83A 1O7OA 1HV9A 1Z90A 2JCLA 1G95A 2JCKA 1JYLA 5CQOA 2FFUA 4M4KA 1PZTA 1ZJPA 4HG6A 1FO9A 5BXCA 2RJ6A 3Q7UA 4FRLA 4HCQA 3JUKA 1H7GA 2AE7A 2Z86A 5CMHA 2WAWA 3SXCA 5AJNA 2A8UA 3JUJA 1INIA 2PGYA 1H5TB 3E26A 3QVBA 4GBPA 1ZI1A 4KRVA 4HO0A 1R82A 1SS9A 1YROB 3OH1A 4EEGA 1HJJA 2BO8A 3OAMA 4G3QA 3POLA 4O6MA 3DJ4A 3HL3A 4Y62A 4G87A 1S4PA 1WVCA 4FREA 3CKQA 4B5BA 4HO2A 4M2BA 2P73A 4ARWA 2V0KA 3PNNA 4KQLA 4IRPA 5CMGX 1WT3A 1LZ7A 2Z87A 3OGZA 1V82A 1VZXA 1R7VA 1INJA 1NQIB 1G93A 5FYEA 4EEMA 2YESA 3DUVA 2YQSA 3OH4A 2VSIA 2AGDA 1WSZA 2P6WA 5FU8A 4Y7VA 2Y4LA 3PKQA 1LZJA 1ZDGA 5FUHA 5FU0A 3U2TA 5C4FA 4Y64A 4XWIA 1ZJOA 3USQA 5CMJA 5HS2A 1NF5B 3U0YA 4P00A 3USRA 4K6RA 1IINA 2V0IA 4HO6A 4B2WA 3RMVA 4D11A 3SXDA 1QG8A 4AAWA 2O1FA 5C36A 2ZU7A 2RJ9A 5C3BA 1WT1A 2VS4A 2JCJA 5DDVA 1H5SA 4AYJA 1VZUA 3K8DA 2WVKA 2RJ5A 1G9RA 1G1LA 3U2UA 4JD0A 2D7RA 1FWYA 4EE3A 2Y4JA 1NHEB 3DK5A 4FQWA 2ZU8A 3I0KA 3IOIA 4B4BA 1H4CA 5CQLX 2E8BA 3V91A 3I0CA 2YQJA 1VH1A 1HM9A 1HJLA 4KNXA 2QH5A 1JV3A 4KPZA 5I1FA 1OMZA 2I7BA 2FYDB 5C3AA 1H4DA 1YP4A 2WE9A 1R80A 4R7PA 1LL3A 2WGZA 1LZ0A 4AYLA 2XMEA 1GX0A 4UEGA 5D91A 3ZLKA 2ICYA 3U2XA 4D0ZA 4HOCA 2APCA 1FXJA 3I0IX 5CQNX 4G3PA 1O23B 3EE5A 2OEFA 5IDTA 3V90A 1HM8A 1O0RA 2E3DA 4IRQA 1G3LA 4FCEA 1TW1A 1S4OA 2XWLA 1H3MA 2VD4A 2VFZA 2A8WA 3I0GA 5IDSA 1JVDA 2AH9A 3RMWA 1ZJ2A 2J0BA 4B42A 5FV9A 4B4MA 1TZFA 3ZGFA 1FR9A 2RITA 1ZJ3A 4E1KA 1H5SD 1YP2A 1FGGA 2VXMA 4HO4A 1PZYB 3SXEA 4HO9A 1FR8A 1JV1A 3V0OA 1VGTA 5C38A 2O1HA 5D92A 3T7MA 1EYRA 5C8RA 3N9WA 1G8OA 2C0NA 5J49A 2FYAA 1E5KA 4FRHA 1R7XA 5CQPA 2WVLA 1XHBA 3I0FA 3D5NA 4EVWA 3V0QA 4EE4A 4KC4A 2VS3A 1H5RB 1VGUA 2D0JA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3R3I A;  2CU2 A;  1K4V A;  4FRD A;  2V0H A;  3SX8 A;  5C48 A;  5AJP A;  4D48 A;  5C47 A;  3SX5 A;  2I5E A;  4G3S A;  2BO7 A;  3F1Y A;  5C4D A;  4P02 A;  2ZU9 A;  3OH2 A;  5AJO A;  4D11 C;  1TW5 A;  3PKP A;  3IOH A;  1GX4 A;  2OI5 A;  5C1G A;  4FRA A;  1H5S C;  3U0X A;  4FCU A;  1GQC A;  3CGX A;  4MND A;  1ZJ1 A;  2O1G A;  3ZF8 A;  4Y7F A;  2W0W A;  1OQM B;  3NGW A;  4DDZ A;  1MP3 A;  1MP4 A;  4KNR A;  2YC5 A;  1QWJ A;  2GGQ A;  1G2V A;  1NKH B;  1ZIZ A;  1MC3 A;  3ZGG A;  4Y6U A;  4B4G A;  5C49 A;  1QGS A;  1FZW A;  5CMI A;  1LVW A;  3K8E A;  5C1L A;  3U2W A;  2BO4 A;  4BMA A;  3I0H A;  4M2A A;  3I0J A;  4ZDQ A;  2DPW A;  3BRK X;  1R7T A;  3F1C A;  1WT2 A;  2FY7 A;  1OMX A;  3E25 A;  3TQD A;  2W0V A;  2V0J A;  4KC1 A;  1HM0 A;  2UX8 A;  4Y7G A;  4HO8 A;  4Y7U A;  4LW3 A;  1H5T A;  5C1H A;  4DEC A;  2JCO A;  3BCV A;  3TZT A;  1ZCT A;  4LW6 A;  3CU0 A;  2FYB A;  3V0M A;  3SXB A;  1ZJ0 A;  3IOJ A;  1W55 A;  1JYK A;  4NAI A;  4Y63 A;  1FO8 A;  3CKJ A;  1W57 A;  2PX7 A;  3V0P A;  1VH3 A;  4MYB A;  3V8Z A;  3CKV A;  5L6S A;  2PGV A;  2RJ7 A;  3D8V A;  3Q80 A;  3I0D A;  3OKR A;  4M28 A;  4CVH A;  1ZI5 A;  2YQC A;  2Y4K A;  1VGZ A;  2WVM A;  4EE5 A;  5FTV A;  3SX3 A;  4HO3 A;  1H5S B;  2RJ4 A;  1I52 A;  1S4N A;  3Q4S A;  2XMH A;  2V0L A;  2OEG A;  1FG5 N;  2WEE A;  1VM8 A;  2X65 A;  3O3P A;  2I5K A;  1JVG A;  1H7F A;  4FRB A;  4AC3 A;  4FRM A;  3JTJ A;  3ZLL A;  1KWS A;  1ZCY A;  2P72 A;  2YC3 A;  1ZCU A;  1GWV A;  1FOA A;  1H7H A;  4C2S A;  1FRW A;  5C4C A;  1TVY A;  2Q4J A;  2OI7 A;  3SPT A;  1G23 A;  1WT0 A;  4HO5 A;  1ON8 A;  2XWM A;  2QGI A;  4D0T A;  3RSB A;  3OH3 A;  3SX7 A;  2VXL A;  2AM4 A;  2Y6P A;  1O7Q A;  1R81 A;  1VGW A;  2NXV A;  1ZDF A;  3T7O A;  4B2X A;  2YCM A;  1H7L A;  2RIX A;  2BO6 A;  1H7E A;  1QGQ A;  1YP3 A;  3V0N A;  3R2W A;  2X5Z A;  2FFV A;  4NAN A;  2QKX A;  2AEC A;  1V84 A;  4Y6N A;  5C3D A;  4NAK A;  4EEA A;  1XZ6 A;  1H7T A;  2VS5 A;  1ZHJ A;  1VPA A;  2MZB A;  5CMF X;  1IIM A;  2FYC B;  4BQH A;  1ZI3 A;  4YS8 A;  1LL0 A;  4FRQ A;  4NAL A;  3SXG A;  4L41 C;  1LL2 A;  3D98 A;  2AM3 A;  2RJ8 A;  1EZI A;  2Y4M A;  3CKN A;  5EIY A;  2XWN A;  3ST8 A;  2PA4 A;  3U2V A;  4KT7 A;  4ECM A;  5EJZ A;  3LW6 A;  1FGX A;  1R7Y A;  3FWW A;  2RJ0 A;  1NWG B;  4CJB A;  4FRO A;  4JIS A;  5IFY A;  4ASJ A;  5EJ1 A;  1NMM B;  2AM5 A;  5DDT A;  3I0E A;  4KXO A;  5CQM X;  1H7Q A;  3V8Y A;  2YQH A;  4Y9X A;  3GUE A;  1GQ9 A;  1MP5 A;  1VZT A;  2D7I A;  2RIY A;  3OH0 A;  3SXA A;  4B3U A;  3I0L A;  2Y7A A;  1FXO A;  2GGO A;  4EEO A;  4DE7 A;  3T7N A;  1W77 A;  1ZI4 A;  4KPX A;  1R7U A;  5FTS A;  2RIZ A;  4CJC A;  3FOQ A;  1GWW A;  3KIA A;  2OI6 A;  4FRP A;  2AES A;  5C4B A;  1ON6 A;  1G0R A;  2ICX A;  2X5S A;  4KC2 A;  5JQQ A;  2X60 A;  5L6V A;  5C4E A;  3OC9 A;  1GA8 A;  2RJ1 A;  3V0L A;  1ZCV A;  2VSH A;  4J18 A;  3CKO A;  1VIC A;  4CJ8 A;  1G97 A;  4Y7T A;  1LZI A;  4ASY A;  1H5R A;  1H4E A;  1V83 A;  1O7O A;  1HV9 A;  1Z90 A;  2JCL A;  1G95 A;  2JCK A;  1JYL A;  5CQO A;  2FFU A;  4M4K A;  1PZT A;  1ZJP A;  4HG6 A;  1FO9 A;  5BXC A;  2RJ6 A;  3Q7U A;  4FRL A;  4HCQ A;  3JUK A;  1H7G A;  2AE7 A;  2Z86 A;  5CMH A;  2WAW A;  3SXC A;  5AJN A;  2A8U A;  3JUJ A;  1INI A;  2PGY A;  1H5T B;  3E26 A;  3QVB A;  4GBP A;  1ZI1 A;  4KRV A;  4HO0 A;  1R82 A;  1SS9 A;  1YRO B;  3OH1 A;  4EEG A;  1HJJ A;  2BO8 A;  3OAM A;  4G3Q A;  3POL A;  3DJ4 A;  3HL3 A;  4Y62 A;  4G87 A;  1S4P A;  1WVC A;  4FRE A;  3CKQ A;  4B5B A;  4HO2 A;  4M2B A;  2P73 A;  4ARW A;  2V0K A;  3PNN A;  4KQL A;  4IRP A;  5CMG X;  1WT3 A;  1LZ7 A;  2Z87 A;  3OGZ A;  1V82 A;  1VZX A;  1R7V A;  1INJ A;  1NQI B;  1G93 A;  5FYE A;  4EEM A;  2YES A;  3DUV A;  2YQS A;  3OH4 A;  2VSI A;  2AGD A;  1WSZ A;  2P6W A;  5FU8 A;  4Y7V A;  2Y4L A;  3PKQ A;  1LZJ A;  1ZDG A;  5FUH A;  5FU0 A;  3U2T A;  5C4F A;  4Y64 A;  4XWI A;  1ZJO A;  3USQ A;  5CMJ A;  5HS2 A;  1NF5 B;  3U0Y A;  4P00 A;  3USR A;  4K6R A;  1IIN A;  2V0I A;  4HO6 A;  4B2W A;  3RMV A;  4D11 A;  3SXD A;  1QG8 A;  4AAW A;  2O1F A;  5C36 A;  2ZU7 A;  2RJ9 A;  5C3B A;  1WT1 A;  2VS4 A;  2JCJ A;  5DDV A;  1H5S A;  4AYJ A;  1VZU A;  3K8D A;  2WVK A;  2RJ5 A;  1G9R A;  1G1L A;  3U2U A;  4JD0 A;  2D7R A;  1FWY A;  4EE3 A;  2Y4J A;  1NHE B;  3DK5 A;  4FQW A;  2ZU8 A;  3I0K A;  3IOI A;  4B4B A;  1H4C A;  5CQL X;  2E8B A;  3V91 A;  3I0C A;  2YQJ A;  1VH1 A;  1HM9 A;  1HJL A;  4KNX A;  2QH5 A;  1JV3 A;  4KPZ A;  5I1F A;  1OMZ A;  2I7B A;  2FYD B;  5C3A A;  1H4D A;  1YP4 A;  2WE9 A;  1R80 A;  4R7P A;  1LL3 A;  2WGZ A;  1LZ0 A;  4AYL A;  2XME A;  1GX0 A;  4UEG A;  3ZLK A;  2ICY A;  3U2X A;  4D0Z A;  4HOC A;  2APC A;  1FXJ A;  3I0I X;  5CQN X;  4G3P A;  1O23 B;  3EE5 A;  2OEF A;  5IDT A;  3V90 A;  1HM8 A;  1O0R A;  2E3D A;  4IRQ A;  1G3L A;  4FCE A;  1TW1 A;  1S4O A;  2XWL A;  1H3M A;  2VD4 A;  2VFZ A;  2A8W A;  3I0G A;  5IDS A;  1JVD A;  2AH9 A;  3RMW A;  1ZJ2 A;  4B42 A;  5FV9 A;  4B4M A;  1TZF A;  3ZGF A;  1FR9 A;  2RIT A;  1ZJ3 A;  4E1K A;  1H5S D;  1YP2 A;  1FGG A;  2VXM A;  4HO4 A;  1PZY B;  3SXE A;  4HO9 A;  1FR8 A;  1JV1 A;  3V0O A;  1VGT A;  5C38 A;  2O1H A;  3T7M A;  1EYR A;  5C8R A;  3N9W A;  1G8O A;  5J49 A;  2FYA A;  1E5K A;  4FRH A;  1R7X A;  5CQP A;  2WVL A;  1XHB A;  3I0F A;  3D5N A;  4EVW A;  3V0Q A;  4EE4 A;  4KC4 A;  2VS3 A;  1H5R B;  1VGU A;  2D0J A; 
#chains in the Genus database with same CATH topology
 3R3I A;  2CU2 A;  1K4V A;  4FRD A;  2V0H A;  3SX8 A;  5C48 A;  5AJP A;  4D48 A;  5C47 A;  3SX5 A;  2I5E A;  4G3S A;  2BO7 A;  3F1Y A;  5C4D A;  4P02 A;  2ZU9 A;  3OH2 A;  5AJO A;  4D11 C;  1TW5 A;  3PKP A;  3IOH A;  1GX4 A;  2OI5 A;  5C1G A;  4FRA A;  1H5S C;  3U0X A;  4FCU A;  1GQC A;  3CGX A;  4MND A;  1ZJ1 A;  2O1G A;  3ZF8 A;  4Y7F A;  2W0W A;  1OQM B;  3NGW A;  4DDZ A;  1MP3 A;  1MP4 A;  4KNR A;  2YC5 A;  1QWJ A;  2GGQ A;  1G2V A;  1NKH B;  1ZIZ A;  1MC3 A;  3ZGG A;  4Y6U A;  4B4G A;  5C49 A;  1QGS A;  1FZW A;  5CMI A;  1LVW A;  3K8E A;  5C1L A;  3U2W A;  2BO4 A;  4BMA A;  3I0H A;  4M2A A;  3I0J A;  4ZDQ A;  2DPW A;  3BRK X;  1R7T A;  3F1C A;  1WT2 A;  2FY7 A;  1OMX A;  3E25 A;  3TQD A;  2W0V A;  2V0J A;  4KC1 A;  1HM0 A;  2UX8 A;  4Y7G A;  4HO8 A;  4Y7U A;  4LW3 A;  1H5T A;  5C1H A;  4DEC A;  2JCO A;  2VK9 A;  3BCV A;  3TZT A;  1ZCT A;  4LW6 A;  3CU0 A;  2FYB A;  3V0M A;  3SXB A;  1ZJ0 A;  3IOJ A;  1W55 A;  1JYK A;  4NAI A;  4Y63 A;  1FO8 A;  3CKJ A;  1W57 A;  2PX7 A;  3V0P A;  1VH3 A;  4MYB A;  3V8Z A;  3CKV A;  5L6S A;  2PGV A;  2RJ7 A;  3D8V A;  3Q80 A;  4FIX A;  3I0D A;  3OKR A;  4M28 A;  4CVH A;  1ZI5 A;  2YQC A;  2Y4K A;  1VGZ A;  2WVM A;  4EE5 A;  5FTV A;  3SX3 A;  4HO3 A;  1H5S B;  2RJ4 A;  1I52 A;  1S4N A;  3Q4S A;  2XMH A;  2V0L A;  2OEG A;  1FG5 N;  2WEE A;  1VM8 A;  2X65 A;  3O3P A;  2I5K A;  1JVG A;  1H7F A;  4FRB A;  4AC3 A;  4FRM A;  3JTJ A;  3ZLL A;  1KWS A;  1ZCY A;  2P72 A;  2YC3 A;  1ZCU A;  1GWV A;  1FOA A;  1H7H A;  4C2S A;  1FRW A;  5C4C A;  1TVY A;  2Q4J A;  2OI7 A;  3SPT A;  1G23 A;  1WT0 A;  4HO5 A;  1ON8 A;  2XWM A;  2QGI A;  4D0T A;  3RSB A;  3OH3 A;  3SX7 A;  2VXL A;  2AM4 A;  2Y6P A;  1O7Q A;  1R81 A;  1VGW A;  2J0A A;  2NXV A;  1ZDF A;  3T7O A;  4B2X A;  2YCM A;  1H7L A;  2RIX A;  2BO6 A;  1H7E A;  1QGQ A;  1YP3 A;  3V0N A;  3R2W A;  2X5Z A;  2FFV A;  4NAN A;  2QKX A;  2AEC A;  1V84 A;  4Y6N A;  5C3D A;  4NAK A;  4EEA A;  1XZ6 A;  1H7T A;  2VS5 A;  1ZHJ A;  1VPA A;  2MZB A;  5CMF X;  1IIM A;  2FYC B;  4BQH A;  1ZI3 A;  4YS8 A;  1LL0 A;  4FRQ A;  4NAL A;  3SXG A;  4L41 C;  1LL2 A;  3D98 A;  2AM3 A;  4FIY A;  2RJ8 A;  1EZI A;  2Y4M A;  3CKN A;  5EIY A;  2XWN A;  3ST8 A;  2PA4 A;  3U2V A;  4KT7 A;  4ECM A;  5EJZ A;  3LW6 A;  1FGX A;  1R7Y A;  3FWW A;  2RJ0 A;  1NWG B;  4CJB A;  4FRO A;  4JIS A;  5IFY A;  4ASJ A;  5EJ1 A;  1NMM B;  2AM5 A;  5DDT A;  3I0E A;  4KXO A;  5CQM X;  1H7Q A;  3V8Y A;  2YQH A;  4Y9X A;  3GUE A;  4Q7C A;  1GQ9 A;  1MP5 A;  1VZT A;  4O6N A;  2D7I A;  2RIY A;  3OH0 A;  3SXA A;  4B3U A;  3I0L A;  2Y7A A;  1FXO A;  2GGO A;  4EEO A;  4MIX A;  4DE7 A;  3T7N A;  1W77 A;  1ZI4 A;  4KPX A;  1R7U A;  5FTS A;  2RIZ A;  4CJC A;  3FOQ A;  1GWW A;  3KIA A;  2OI6 A;  4FRP A;  2AES A;  5C4B A;  1ON6 A;  1G0R A;  2ICX A;  2X5S A;  4KC2 A;  5JQQ A;  2X60 A;  5L6V A;  5C4E A;  3OC9 A;  1GA8 A;  2RJ1 A;  3V0L A;  1ZCV A;  2VSH A;  4J18 A;  3CKO A;  1VIC A;  4CJ8 A;  1G97 A;  4Y7T A;  1LZI A;  4ASY A;  1H5R A;  1H4E A;  1V83 A;  1O7O A;  1HV9 A;  1Z90 A;  2JCL A;  1G95 A;  2JCK A;  1JYL A;  5CQO A;  2FFU A;  4M4K A;  1PZT A;  1ZJP A;  4HG6 A;  1FO9 A;  5BXC A;  2RJ6 A;  3Q7U A;  4FRL A;  4HCQ A;  3JUK A;  1H7G A;  2AE7 A;  2Z86 A;  5CMH A;  2WAW A;  3SXC A;  5AJN A;  2A8U A;  3JUJ A;  1INI A;  2PGY A;  1H5T B;  3E26 A;  3QVB A;  4GBP A;  1ZI1 A;  4KRV A;  4HO0 A;  1R82 A;  1SS9 A;  1YRO B;  3OH1 A;  4EEG A;  1HJJ A;  2BO8 A;  3OAM A;  4G3Q A;  3POL A;  4O6M A;  3DJ4 A;  3HL3 A;  4Y62 A;  4G87 A;  1S4P A;  1WVC A;  4FRE A;  3CKQ A;  4B5B A;  4HO2 A;  4M2B A;  2P73 A;  4ARW A;  2V0K A;  3PNN A;  4KQL A;  4IRP A;  5CMG X;  1WT3 A;  1LZ7 A;  2Z87 A;  3OGZ A;  1V82 A;  1VZX A;  1R7V A;  1INJ A;  1NQI B;  1G93 A;  5FYE A;  4EEM A;  2YES A;  3DUV A;  2YQS A;  3OH4 A;  2VSI A;  2AGD A;  1WSZ A;  2P6W A;  5FU8 A;  4Y7V A;  2Y4L A;  3PKQ A;  1LZJ A;  1ZDG A;  5FUH A;  5FU0 A;  3U2T A;  5C4F A;  4Y64 A;  4XWI A;  1ZJO A;  3USQ A;  5CMJ A;  5HS2 A;  1NF5 B;  3U0Y A;  4P00 A;  3USR A;  4K6R A;  1IIN A;  2V0I A;  4HO6 A;  4B2W A;  3RMV A;  4D11 A;  3SXD A;  1QG8 A;  4AAW A;  2O1F A;  5C36 A;  2ZU7 A;  2RJ9 A;  5C3B A;  1WT1 A;  2VS4 A;  2JCJ A;  5DDV A;  1H5S A;  4AYJ A;  1VZU A;  3K8D A;  2WVK A;  2RJ5 A;  1G9R A;  1G1L A;  3U2U A;  4JD0 A;  2D7R A;  1FWY A;  4EE3 A;  2Y4J A;  1NHE B;  3DK5 A;  4FQW A;  2ZU8 A;  3I0K A;  3IOI A;  4B4B A;  1H4C A;  5CQL X;  2E8B A;  3V91 A;  3I0C A;  2YQJ A;  1VH1 A;  1HM9 A;  1HJL A;  4KNX A;  2QH5 A;  1JV3 A;  4KPZ A;  5I1F A;  1OMZ A;  2I7B A;  2FYD B;  5C3A A;  1H4D A;  1YP4 A;  2WE9 A;  1R80 A;  4R7P A;  1LL3 A;  2WGZ A;  1LZ0 A;  4AYL A;  2XME A;  1GX0 A;  4UEG A;  5D91 A;  3ZLK A;  2ICY A;  3U2X A;  4D0Z A;  4HOC A;  2APC A;  1FXJ A;  3I0I X;  5CQN X;  4G3P A;  1O23 B;  3EE5 A;  2OEF A;  5IDT A;  3V90 A;  1HM8 A;  1O0R A;  2E3D A;  4IRQ A;  1G3L A;  4FCE A;  1TW1 A;  1S4O A;  2XWL A;  1H3M A;  2VD4 A;  2VFZ A;  2A8W A;  3I0G A;  5IDS A;  1JVD A;  2AH9 A;  3RMW A;  1ZJ2 A;  2J0B A;  4B42 A;  5FV9 A;  4B4M A;  1TZF A;  3ZGF A;  1FR9 A;  2RIT A;  1ZJ3 A;  4E1K A;  1H5S D;  1YP2 A;  1FGG A;  2VXM A;  4HO4 A;  1PZY B;  3SXE A;  4HO9 A;  1FR8 A;  1JV1 A;  3V0O A;  1VGT A;  5C38 A;  2O1H A;  5D92 A;  3T7M A;  1EYR A;  5C8R A;  3N9W A;  1G8O A;  2C0N A;  5J49 A;  2FYA A;  1E5K A;  4FRH A;  1R7X A;  5CQP A;  2WVL A;  1XHB A;  3I0F A;  3D5N A;  4EVW A;  3V0Q A;  4EE4 A;  4KC4 A;  2VS3 A;  1H5R B;  1VGU A;  2D0J A; 
#chains in the Genus database with same CATH homology
 3R3I A;  2CU2 A;  1K4V A;  4FRD A;  2V0H A;  3SX8 A;  5C48 A;  5AJP A;  4D48 A;  5C47 A;  3SX5 A;  2I5E A;  4G3S A;  2BO7 A;  3F1Y A;  5C4D A;  4P02 A;  2ZU9 A;  3OH2 A;  5AJO A;  4D11 C;  1TW5 A;  3PKP A;  3IOH A;  1GX4 A;  2OI5 A;  5C1G A;  4FRA A;  1H5S C;  3U0X A;  4FCU A;  1GQC A;  3CGX A;  4MND A;  1ZJ1 A;  2O1G A;  3ZF8 A;  4Y7F A;  2W0W A;  1OQM B;  3NGW A;  4DDZ A;  1MP3 A;  1MP4 A;  4KNR A;  2YC5 A;  1QWJ A;  2GGQ A;  1G2V A;  1NKH B;  1ZIZ A;  1MC3 A;  3ZGG A;  4Y6U A;  4B4G A;  5C49 A;  1QGS A;  1FZW A;  5CMI A;  1LVW A;  3K8E A;  5C1L A;  3U2W A;  2BO4 A;  4BMA A;  3I0H A;  4M2A A;  3I0J A;  4ZDQ A;  2DPW A;  3BRK X;  1R7T A;  3F1C A;  1WT2 A;  2FY7 A;  1OMX A;  3E25 A;  3TQD A;  2W0V A;  2V0J A;  4KC1 A;  1HM0 A;  2UX8 A;  4Y7G A;  4HO8 A;  4Y7U A;  4LW3 A;  1H5T A;  5C1H A;  4DEC A;  2JCO A;  2VK9 A;  3BCV A;  3TZT A;  1ZCT A;  4LW6 A;  3CU0 A;  2FYB A;  3V0M A;  3SXB A;  1ZJ0 A;  3IOJ A;  1W55 A;  1JYK A;  4NAI A;  4Y63 A;  1FO8 A;  3CKJ A;  1W57 A;  2PX7 A;  3V0P A;  1VH3 A;  4MYB A;  3V8Z A;  3CKV A;  5L6S A;  2PGV A;  2RJ7 A;  3D8V A;  3Q80 A;  4FIX A;  3I0D A;  3OKR A;  4M28 A;  4CVH A;  1ZI5 A;  2YQC A;  2Y4K A;  1VGZ A;  2WVM A;  4EE5 A;  5FTV A;  3SX3 A;  4HO3 A;  1H5S B;  2RJ4 A;  1I52 A;  1S4N A;  3Q4S A;  2XMH A;  2V0L A;  2OEG A;  1FG5 N;  2WEE A;  1VM8 A;  2X65 A;  3O3P A;  2I5K A;  1JVG A;  1H7F A;  4FRB A;  4AC3 A;  4FRM A;  3JTJ A;  3ZLL A;  1KWS A;  1ZCY A;  2P72 A;  2YC3 A;  1ZCU A;  1GWV A;  1FOA A;  1H7H A;  4C2S A;  1FRW A;  5C4C A;  1TVY A;  2Q4J A;  2OI7 A;  3SPT A;  1G23 A;  1WT0 A;  4HO5 A;  1ON8 A;  2XWM A;  2QGI A;  4D0T A;  3RSB A;  3OH3 A;  3SX7 A;  2VXL A;  2AM4 A;  2Y6P A;  1O7Q A;  1R81 A;  1VGW A;  2J0A A;  2NXV A;  1ZDF A;  3T7O A;  4B2X A;  2YCM A;  1H7L A;  2RIX A;  2BO6 A;  1H7E A;  1QGQ A;  1YP3 A;  3V0N A;  3R2W A;  2X5Z A;  2FFV A;  4NAN A;  2QKX A;  2AEC A;  1V84 A;  4Y6N A;  5C3D A;  4NAK A;  4EEA A;  1XZ6 A;  1H7T A;  2VS5 A;  1ZHJ A;  1VPA A;  2MZB A;  5CMF X;  1IIM A;  2FYC B;  4BQH A;  1ZI3 A;  4YS8 A;  1LL0 A;  4FRQ A;  4NAL A;  3SXG A;  4L41 C;  1LL2 A;  3D98 A;  2AM3 A;  4FIY A;  2RJ8 A;  1EZI A;  2Y4M A;  3CKN A;  5EIY A;  2XWN A;  3ST8 A;  2PA4 A;  3U2V A;  4KT7 A;  4ECM A;  5EJZ A;  3LW6 A;  1FGX A;  1R7Y A;  3FWW A;  2RJ0 A;  1NWG B;  4CJB A;  4FRO A;  4JIS A;  5IFY A;  4ASJ A;  5EJ1 A;  1NMM B;  2AM5 A;  5DDT A;  3I0E A;  4KXO A;  5CQM X;  1H7Q A;  3V8Y A;  2YQH A;  4Y9X A;  3GUE A;  4Q7C A;  1GQ9 A;  1MP5 A;  1VZT A;  4O6N A;  2D7I A;  2RIY A;  3OH0 A;  3SXA A;  4B3U A;  3I0L A;  2Y7A A;  1FXO A;  2GGO A;  4EEO A;  4MIX A;  4DE7 A;  3T7N A;  1W77 A;  1ZI4 A;  4KPX A;  1R7U A;  5FTS A;  2RIZ A;  4CJC A;  3FOQ A;  1GWW A;  3KIA A;  2OI6 A;  4FRP A;  2AES A;  5C4B A;  1ON6 A;  1G0R A;  2ICX A;  2X5S A;  4KC2 A;  5JQQ A;  2X60 A;  5L6V A;  5C4E A;  3OC9 A;  1GA8 A;  2RJ1 A;  3V0L A;  1ZCV A;  2VSH A;  4J18 A;  3CKO A;  1VIC A;  4CJ8 A;  1G97 A;  4Y7T A;  1LZI A;  4ASY A;  1H5R A;  1H4E A;  1V83 A;  1O7O A;  1HV9 A;  1Z90 A;  2JCL A;  1G95 A;  2JCK A;  1JYL A;  5CQO A;  2FFU A;  4M4K A;  1PZT A;  1ZJP A;  4HG6 A;  1FO9 A;  5BXC A;  2RJ6 A;  3Q7U A;  4FRL A;  4HCQ A;  3JUK A;  1H7G A;  2AE7 A;  2Z86 A;  5CMH A;  2WAW A;  3SXC A;  5AJN A;  2A8U A;  3JUJ A;  1INI A;  2PGY A;  1H5T B;  3E26 A;  3QVB A;  4GBP A;  1ZI1 A;  4KRV A;  4HO0 A;  1R82 A;  1SS9 A;  1YRO B;  3OH1 A;  4EEG A;  1HJJ A;  2BO8 A;  3OAM A;  4G3Q A;  3POL A;  4O6M A;  3DJ4 A;  3HL3 A;  4Y62 A;  4G87 A;  1S4P A;  1WVC A;  4FRE A;  3CKQ A;  4B5B A;  4HO2 A;  4M2B A;  2P73 A;  4ARW A;  2V0K A;  3PNN A;  4KQL A;  4IRP A;  5CMG X;  1WT3 A;  1LZ7 A;  2Z87 A;  3OGZ A;  1V82 A;  1VZX A;  1R7V A;  1INJ A;  1NQI B;  1G93 A;  5FYE A;  4EEM A;  2YES A;  3DUV A;  2YQS A;  3OH4 A;  2VSI A;  2AGD A;  1WSZ A;  2P6W A;  5FU8 A;  4Y7V A;  2Y4L A;  3PKQ A;  1LZJ A;  1ZDG A;  5FUH A;  5FU0 A;  3U2T A;  5C4F A;  4Y64 A;  4XWI A;  1ZJO A;  3USQ A;  5CMJ A;  5HS2 A;  1NF5 B;  3U0Y A;  4P00 A;  3USR A;  4K6R A;  1IIN A;  2V0I A;  4HO6 A;  4B2W A;  3RMV A;  4D11 A;  3SXD A;  1QG8 A;  4AAW A;  2O1F A;  5C36 A;  2ZU7 A;  2RJ9 A;  5C3B A;  1WT1 A;  2VS4 A;  2JCJ A;  5DDV A;  1H5S A;  4AYJ A;  1VZU A;  3K8D A;  2WVK A;  2RJ5 A;  1G9R A;  1G1L A;  3U2U A;  4JD0 A;  2D7R A;  1FWY A;  4EE3 A;  2Y4J A;  1NHE B;  3DK5 A;  4FQW A;  2ZU8 A;  3I0K A;  3IOI A;  4B4B A;  1H4C A;  5CQL X;  2E8B A;  3V91 A;  3I0C A;  2YQJ A;  1VH1 A;  1HM9 A;  1HJL A;  4KNX A;  2QH5 A;  1JV3 A;  4KPZ A;  5I1F A;  1OMZ A;  2I7B A;  2FYD B;  5C3A A;  1H4D A;  1YP4 A;  2WE9 A;  1R80 A;  4R7P A;  1LL3 A;  2WGZ A;  1LZ0 A;  4AYL A;  2XME A;  1GX0 A;  4UEG A;  5D91 A;  3ZLK A;  2ICY A;  3U2X A;  4D0Z A;  4HOC A;  2APC A;  1FXJ A;  3I0I X;  5CQN X;  4G3P A;  1O23 B;  3EE5 A;  2OEF A;  5IDT A;  3V90 A;  1HM8 A;  1O0R A;  2E3D A;  4IRQ A;  1G3L A;  4FCE A;  1TW1 A;  1S4O A;  2XWL A;  1H3M A;  2VD4 A;  2VFZ A;  2A8W A;  3I0G A;  5IDS A;  1JVD A;  2AH9 A;  3RMW A;  1ZJ2 A;  2J0B A;  4B42 A;  5FV9 A;  4B4M A;  1TZF A;  3ZGF A;  1FR9 A;  2RIT A;  1ZJ3 A;  4E1K A;  1H5S D;  1YP2 A;  1FGG A;  2VXM A;  4HO4 A;  1PZY B;  3SXE A;  4HO9 A;  1FR8 A;  1JV1 A;  3V0O A;  1VGT A;  5C38 A;  2O1H A;  5D92 A;  3T7M A;  1EYR A;  5C8R A;  3N9W A;  1G8O A;  2C0N A;  5J49 A;  2FYA A;  1E5K A;  4FRH A;  1R7X A;  5CQP A;  2WVL A;  1XHB A;  3I0F A;  3D5N A;  4EVW A;  3V0Q A;  4EE4 A;  4KC4 A;  2VS3 A;  1H5R B;  1VGU A;  2D0J A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...