4Y62A

Aaglyb in complex with amino-acid analogues
Total Genus 94
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
94
sequence length
281
structure length
277
Chain Sequence
SLPRMVYPQPKVLTPCRKDVLVVTPWLAPIVWEGTFNIDILNEQFRLQNTTIGLTVFAIKKYVAFLKLFLETAEKHFMVGHRVHYYVFTDQPAAVPRVTLGTGRQLSVLEVRWQDVSMRRMEMISDFCERRFLSEVDYLVCVDVDMEFRDHVGVEILTPLFGTLHPGFYGSSREAFTYERRPQSQAYIPKDEGDFYYGGAFFGGSVQEVQRLTRACHQAMMVDQANGIEAVWHDESHLNKYLLRHKPTKVLSPEYLWDQQLLGWPAVLRKLRFTAVP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords Histo-blood group ABO system transferase
publication title Design of Glycosyltransferase Inhibitors: Serine Analogues as Pyrophosphate Surrogates?
doi rcsb
source organism Homo sapiens
total genus 94
structure length 277
sequence length 281
ec nomenclature ec 2.4.1.37: Fucosylgalactoside 3-alpha-galactosyltransferase.
pdb deposition date 2015-02-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03414 Glyco_transf_6 Glycosyltransferase family 6
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.550.10 Alpha Beta Alpha-Beta Complex Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A 4y62A00
2OI7A 4D48A 1H5TB 1NWGB 1ZCYA 1JYLA 2V0LA 1EYRA 2Y4KA 2Y4MA 4C2SA 2YC5A 2V0IA 3HL3A 4FROA 3T7OA 3OH1A 3TQDA 3OGZA 2FYDB 4DE7A 1ZI5A 1H5SD 2XWLA 4Y7UA 4FRDA 5J49A 3FWWA 2JCLA 4KNRA 2WAWA 1W57A 1ZDGA 4KRVA 3U2XA 1NHEB 2NXVA 2OI5A 5C4BA 4HO9A 2D7IA 5FU8A 1H4CA 2APCA 4GBPA 1H5RB 2Y4JA 3SPTA 1OQMB 2VXLA 3Q7UA 2DPWA 1H7LA 2Q4JA 3U0YA 4IRQA 1H5TA 1VGTA 4M2BA 4B2XA 2AE7A 4B2WA 5C36A 1G2VA 2PGVA 2XMHA 1OMXA 4HOCA 2QKXA 1IINA 4ARWA 4HO3A 1XHBA 1ZCTA 3SX5A 2O1FA 3OAMA 5C3DA 2Y4LA 4D11A 1HJJA 1H5SB 1H7HA 3QVBA 1GWVA 4FRLA 2OI6A 2FFVA 2RIZA 3CKVA 2UX8A 3I0EA 5CMJA 3OH2A 2VS5A 1G8OA 1YROB 4Y9XA 2XWNA 3I0HA 4YS8A 4L41C 1H7TA 2RIYA 4KXOA 4Y7GA 2FFUA 4Y7VA 1FRWA 3ZLLA 4KC4A 1H5RA 5C4FA 3BRKX 2RIXA 3SX3A 3E26A 5C4CA 4B3UA 2VD4A 5DDVA 1H4DA 1YP2A 3ZGGA 4KPZA 1KWSA 2AGDA 1QWJA 4FCUA 4B5BA 1R82A 2AECA 1FO8A 2AM5A 1FR8A 4D0ZA 2JCJA 2OEFA 3LW6A 3V0LA 1NF5B 1WT2A 3I0IX 3U2WA 4KPXA 1H5SA 2YESA 2X5ZA 2XWMA 2WVLA 2VS4A 3FOQA 1VZUA 2X60A 1S4PA 3PKQA 2JCOA 3RMVA 1NQIB 1HM0A 1NKHB 1H7GA 3V8YA 5C8RA 1FG5N 2AM3A 4Y6UA 2VSHA 4EVWA 2JCKA 2P72A 1HM9A 1JVDA 4UEGA 1INJA 5C49A 5JQQA 4B4BA 3U0XA 4M2AA 2X65A 1HM8A 5C3BA 1H7FA 5IFYA 2AH9A 5L6SA 4EE5A 4AAWA 3PNNA 2O1GA 4AYLA 4LW3A 5AJOA 1QGQA 3GUEA 1VZTA 4KT7A 5L6VA 3V0MA 3ST8A 5FYEA 4NAKA 2FYBA 1OMZA 1WT3A 1LL3A 3EE5A 4EEAA 1ZI4A 4HO4A 1V82A 3I0CA 4CJ8A 2ZU9A 4AYJA 2OEGA 3D8VA 5FV9A 4EE4A 1ZJ2A 3SXBA 1ZDFA 2YQSA 1R7XA 3JUKA 1PZTA 1LL2A 4CJBA 1WT0A 1ZJ0A 1FZWA 3K8EA 2RJ6A 1WVCA 3SX8A 5CQPA 1GX0A 2YQCA 1O7OA 5EJ1A 1G23A 4KC1A 3V8ZA 2YQJA 2A8WA 2P6WA 4MNDA 5C47A 2GGOA 4M28A 2E8BA 2BO6A 4FQWA 4HO6A 2QGIA 1ZCUA 1TW1A 1VGUA 5C38A 2RJ0A 3SXDA 1ON6A 3JUJA 1GWWA 3NGWA 4D0TA 3CKQA 3D98A 4KC2A 4KNXA 5CMGX 1H3MA 1ON8A 1VGZA 3V0QA 1ZCVA 1LZ0A 3DJ4A 3KIAA 2RJ7A 1H4EA 3DK5A 3I0JA 5CMIA 5DDTA 4MYBA 2FY7A 4D11C 4FRBA 3CKJA 4E1KA 5C1LA 4Y62A 4ASJA 3BCVA 4IRPA 2O1HA 2BO4A 1R80A 2VFZA 1VH3A 2PA4A 2ZU8A 4ZDQA 2WEEA 1VPAA 4Y63A 2W0WA 3CKOA 1YP4A 3PKPA 1G1LA 1IIMA 1W55A 2I5KA 1LZIA 1ZIZA 3U2TA 1LZ7A 1MP5A 3IOHA 5FTSA 3OH0A 3T7NA 2V0JA 1G9RA 4EEOA 1R7UA 1I52A 1O23B 1V83A 2XMEA 2WVMA 1JV3A 1H5SC 1YP3A 2W0VA 3K8DA 1GA8A 2RJ9A 3RMWA 1G0RA 4G3PA 1JYKA 2FYCB 1VM8A 4ASYA 1LZJA 5BXCA 3Q4SA 1V84A 5CQOA 1LVWA 2GGQA 5FTVA 4EEGA 1Z90A 1FOAA 4FRHA 2VSIA 4FRQA 4BMAA 3OH4A 2CU2A 4Y6NA 1GQ9A 2VXMA 3V91A 1K4VA 5EIYA 3SXCA 1H7EA 4EE3A 2MZBA 5C3AA 2I7BA 4CJCA 2YQHA 4NALA 5C1HA 2BO7A 1VZXA 4K6RA 5IDSA 3U2VA 1ZJPA 4JD0A 2I5EA 4AC3A 4ECMA 5AJPA 5I1FA 1MP4A 3ZLKA 1JVGA 1G95A 4Y7TA 1G3LA 3V0PA 1FXJA 1G93A 2RJ5A 2WE9A 3ZF8A 2RJ8A 5CQLX 4HO0A 1MC3A 1R7TA 2V0HA 2Z87A 3IOIA 5C4EA 1VGWA 3CU0A 1ZHJA 4HO8A 4J18A 1FGGA 5IDTA 4FRMA 3U2UA 4P02A 5CQNX 1GQCA 4M4KA 5FUHA 2D7RA 1QGSA 3V0NA 2YCMA 4JISA 4B4GA 2Y7AA 3POLA 3SXGA 1ZI3A 1ZJOA 4G87A 4FCEA 3OC9A 2VS3A 4FRPA 4HCQA 1O7QA 3USRA 5C1GA 3F1CA 4NAIA 2D0JA 1VICA 2AESA 2X5SA 3F1YA 3V90A 1ZJ1A 5CMHA 2RITA 2ICYA 1HJLA 1QG8A 3E25A 1TW5A 3SXEA 2BO8A 2WGZA 5CQMX 1ZI1A 2RJ4A 4G3SA 4CVHA 1JV1A 1S4OA 3I0DA 3SXAA 1O0RA 2PX7A 3N9WA 5AJNA 2AM4A 3CKNA 2E3DA 2A8UA 4BQHA 3I0KA 1S4NA 1NMMB 1VH1A 4DECA 3V0OA 1SS9A 2P73A 4XWIA 5HS2A 2RJ1A 3ZGFA 1INIA 4Y64A 4KQLA 1FWYA 4R7PA 3USQA 4G3QA 2ZU7A 4DDZA 1FO9A 1TVYA 4B42A 3I0FA 2QH5A 2YC3A 4HO2A 4EEMA 3Q80A 2Y6PA 5EJZA 4NANA 5FU0A 2WVKA 3OH3A 3IOJA 3I0GA 1H7QA 3T7MA 2ICXA 3JTJA 4FRAA 3SX7A 2PGYA 4B4MA 1WT1A 4LW6A 3RSBA 3O3PA 3I0LA 5C4DA 4Y7FA 1TZFA 1FXOA 1R7YA 2FYAA 1PZYB 1R81A 4P00A 2V0KA 1WSZA 1MP3A 3D5NA 1R7VA 3TZTA 1W77A 3CGXA 1XZ6A 4HO5A 1HV9A 1FGXA 5CMFX 1GX4A 3R3IA 3OKRA 1E5KA 1LL0A 1G97A 4HG6A 5C48A 1ZJ3A 2Z86A 3R2WA 3DUVA 1EZIA 1FR9A 4FREA
chains in the Genus database with same CATH superfamily
2OI7A 4D48A 1H5TB 1NWGB 1ZCYA 1JYLA 2V0LA 1EYRA 2Y4KA 2Y4MA 4C2SA 2YC5A 2V0IA 3HL3A 4FROA 3T7OA 3OH1A 3TQDA 3OGZA 4FIXA 2FYDB 4DE7A 1ZI5A 1H5SD 2XWLA 4Y7UA 4FRDA 5J49A 3FWWA 2JCLA 4KNRA 2WAWA 1W57A 1ZDGA 4KRVA 3U2XA 1NHEB 2NXVA 2OI5A 5C4BA 4HO9A 2D7IA 5FU8A 1H4CA 4O6MA 2APCA 4GBPA 1H5RB 2Y4JA 3SPTA 1OQMB 2VXLA 3Q7UA 2DPWA 1H7LA 2Q4JA 3U0YA 4IRQA 1H5TA 1VGTA 4M2BA 4B2XA 2AE7A 4B2WA 5C36A 1G2VA 2PGVA 2XMHA 1OMXA 4HOCA 2QKXA 1IINA 4ARWA 4HO3A 1XHBA 1ZCTA 3SX5A 2O1FA 3OAMA 5C3DA 2Y4LA 4D11A 1HJJA 2J0BA 1H5SB 1H7HA 3QVBA 1GWVA 4FRLA 2OI6A 2FFVA 2RIZA 3CKVA 2UX8A 3I0EA 5CMJA 3OH2A 2VS5A 4MIXA 1G8OA 1YROB 4Y9XA 2XWNA 3I0HA 4YS8A 4L41C 1H7TA 2RIYA 4KXOA 4Y7GA 2FFUA 4Y7VA 1FRWA 3ZLLA 4KC4A 1H5RA 5C4FA 3BRKX 2RIXA 3SX3A 3E26A 5C4CA 4B3UA 2VD4A 5DDVA 1H4DA 1YP2A 3ZGGA 4KPZA 1KWSA 2AGDA 1QWJA 4FCUA 4B5BA 1R82A 2AECA 1FO8A 2AM5A 1FR8A 4D0ZA 2JCJA 2OEFA 3LW6A 3V0LA 1NF5B 1WT2A 3I0IX 3U2WA 4KPXA 1H5SA 2YESA 2X5ZA 2XWMA 2WVLA 2VS4A 3FOQA 1VZUA 2X60A 1S4PA 3PKQA 2JCOA 3RMVA 1NQIB 1HM0A 1NKHB 1H7GA 3V8YA 5C8RA 1FG5N 2AM3A 4Y6UA 2VSHA 4EVWA 2JCKA 2P72A 1HM9A 1JVDA 4UEGA 1INJA 5C49A 5JQQA 4B4BA 3U0XA 4M2AA 2X65A 1HM8A 5C3BA 1H7FA 5IFYA 2AH9A 5L6SA 4EE5A 4AAWA 3PNNA 2O1GA 4AYLA 4LW3A 5AJOA 1QGQA 3GUEA 1VZTA 4KT7A 5L6VA 3V0MA 2C0NA 3ST8A 5FYEA 4NAKA 2FYBA 1OMZA 1WT3A 1LL3A 3EE5A 4EEAA 1ZI4A 4HO4A 1V82A 3I0CA 4CJ8A 4O6NA 2ZU9A 4AYJA 2OEGA 3D8VA 5FV9A 4EE4A 1ZJ2A 3SXBA 1ZDFA 2YQSA 1R7XA 3JUKA 1PZTA 1LL2A 4CJBA 1WT0A 1ZJ0A 1FZWA 3K8EA 2RJ6A 1WVCA 3SX8A 5CQPA 1GX0A 2YQCA 2VK9A 1O7OA 5EJ1A 1G23A 4KC1A 3V8ZA 2YQJA 2A8WA 2P6WA 4MNDA 5C47A 2GGOA 4M28A 2E8BA 2BO6A 4FQWA 4HO6A 2QGIA 1ZCUA 1TW1A 1VGUA 5C38A 2RJ0A 3SXDA 1ON6A 3JUJA 1GWWA 3NGWA 4D0TA 3CKQA 3D98A 4KC2A 4KNXA 5CMGX 1H3MA 1ON8A 1VGZA 3V0QA 1ZCVA 1LZ0A 3DJ4A 3KIAA 2RJ7A 1H4EA 3DK5A 3I0JA 5CMIA 5DDTA 4MYBA 2FY7A 4D11C 4FRBA 3CKJA 4E1KA 5C1LA 4Y62A 4ASJA 3BCVA 4IRPA 2O1HA 2BO4A 1R80A 2VFZA 1VH3A 2PA4A 2ZU8A 4ZDQA 2WEEA 1VPAA 4Y63A 2W0WA 3CKOA 1YP4A 3PKPA 1G1LA 1IIMA 1W55A 2I5KA 1LZIA 1ZIZA 3U2TA 1LZ7A 1MP5A 3IOHA 5FTSA 3OH0A 3T7NA 2V0JA 1G9RA 4EEOA 1R7UA 1I52A 1O23B 1V83A 2XMEA 2WVMA 1JV3A 1H5SC 1YP3A 2W0VA 3K8DA 1GA8A 2RJ9A 3RMWA 1G0RA 4G3PA 1JYKA 2FYCB 1VM8A 4ASYA 1LZJA 5BXCA 3Q4SA 1V84A 5CQOA 1LVWA 2GGQA 5FTVA 4EEGA 1Z90A 1FOAA 4FRHA 2VSIA 4FRQA 4BMAA 3OH4A 2CU2A 4Y6NA 1GQ9A 2VXMA 3V91A 1K4VA 5EIYA 3SXCA 1H7EA 4EE3A 2MZBA 5C3AA 2I7BA 4CJCA 2YQHA 4NALA 5C1HA 2BO7A 1VZXA 4K6RA 5IDSA 3U2VA 1ZJPA 4JD0A 2I5EA 4AC3A 4ECMA 5AJPA 5I1FA 1MP4A 3ZLKA 1JVGA 1G95A 4Y7TA 1G3LA 3V0PA 1FXJA 1G93A 2RJ5A 2WE9A 3ZF8A 2RJ8A 5CQLX 4HO0A 1MC3A 1R7TA 2V0HA 2Z87A 3IOIA 5C4EA 4FIYA 1VGWA 3CU0A 1ZHJA 4HO8A 4J18A 1FGGA 5IDTA 4FRMA 3U2UA 4P02A 5CQNX 1GQCA 4M4KA 5FUHA 2D7RA 1QGSA 3V0NA 2YCMA 4JISA 4B4GA 2Y7AA 3POLA 3SXGA 1ZI3A 1ZJOA 4G87A 4FCEA 3OC9A 2VS3A 4FRPA 4HCQA 1O7QA 3USRA 5C1GA 3F1CA 4NAIA 2D0JA 1VICA 2AESA 2X5SA 3F1YA 3V90A 1ZJ1A 5CMHA 2RITA 2ICYA 1HJLA 1QG8A 3E25A 1TW5A 3SXEA 2BO8A 2WGZA 5CQMX 1ZI1A 2RJ4A 4G3SA 4CVHA 1JV1A 1S4OA 3I0DA 3SXAA 1O0RA 2PX7A 3N9WA 5AJNA 2AM4A 3CKNA 2E3DA 2A8UA 4BQHA 3I0KA 1S4NA 1NMMB 1VH1A 2J0AA 4DECA 3V0OA 1SS9A 2P73A 4XWIA 5HS2A 2RJ1A 3ZGFA 1INIA 4Y64A 4KQLA 1FWYA 4R7PA 3USQA 4G3QA 2ZU7A 4DDZA 1FO9A 1TVYA 4B42A 3I0FA 2QH5A 2YC3A 4HO2A 4EEMA 3Q80A 2Y6PA 5EJZA 4NANA 5FU0A 2WVKA 5D92A 3OH3A 3IOJA 5D91A 3I0GA 1H7QA 3T7MA 2ICXA 3JTJA 4FRAA 3SX7A 2PGYA 4B4MA 1WT1A 4LW6A 3RSBA 3O3PA 3I0LA 5C4DA 4Y7FA 1TZFA 1FXOA 1R7YA 2FYAA 1PZYB 1R81A 4P00A 2V0KA 1WSZA 1MP3A 3D5NA 1R7VA 3TZTA 1W77A 3CGXA 1XZ6A 4HO5A 1HV9A 1FGXA 5CMFX 1GX4A 3R3IA 3OKRA 1E5KA 1LL0A 1G97A 4HG6A 5C48A 1ZJ3A 2Z86A 3R2WA 3DUVA 1EZIA 1FR9A 4Q7CA 4FREA
chains in the Genus database with same CATH topology
2OI7A 4D48A 1H5TB 1NWGB 1ZCYA 1JYLA 2V0LA 1EYRA 2Y4KA 2Y4MA 4C2SA 2YC5A 2V0IA 3HL3A 4FROA 3T7OA 3OH1A 3TQDA 3OGZA 4FIXA 2FYDB 4DE7A 1ZI5A 1H5SD 2XWLA 4Y7UA 4FRDA 5J49A 3FWWA 2JCLA 4KNRA 2WAWA 1W57A 1ZDGA 4KRVA 3U2XA 1NHEB 2NXVA 2OI5A 5C4BA 4HO9A 2D7IA 5FU8A 1H4CA 4O6MA 2APCA 4GBPA 1H5RB 2Y4JA 3SPTA 1OQMB 2VXLA 3Q7UA 2DPWA 1H7LA 2Q4JA 3U0YA 4IRQA 1H5TA 1VGTA 4M2BA 4B2XA 2AE7A 4B2WA 5C36A 1G2VA 2PGVA 2XMHA 1OMXA 4HOCA 2QKXA 1IINA 4ARWA 4HO3A 1XHBA 1ZCTA 3SX5A 2O1FA 3OAMA 5C3DA 2Y4LA 4D11A 1HJJA 2J0BA 1H5SB 1H7HA 3QVBA 1GWVA 4FRLA 2OI6A 2FFVA 2RIZA 3CKVA 2UX8A 3I0EA 5CMJA 3OH2A 2VS5A 4MIXA 1G8OA 1YROB 4Y9XA 2XWNA 3I0HA 4YS8A 4L41C 1H7TA 2RIYA 4KXOA 4Y7GA 2FFUA 4Y7VA 1FRWA 3ZLLA 4KC4A 1H5RA 5C4FA 3BRKX 2RIXA 3SX3A 3E26A 5C4CA 4B3UA 2VD4A 5DDVA 1H4DA 1YP2A 3ZGGA 4KPZA 1KWSA 2AGDA 1QWJA 4FCUA 4B5BA 1R82A 2AECA 1FO8A 2AM5A 1FR8A 4D0ZA 2JCJA 2OEFA 3LW6A 3V0LA 1NF5B 1WT2A 3I0IX 3U2WA 4KPXA 1H5SA 2YESA 2X5ZA 2XWMA 2WVLA 2VS4A 3FOQA 1VZUA 2X60A 1S4PA 3PKQA 2JCOA 3RMVA 1NQIB 1HM0A 1NKHB 1H7GA 3V8YA 5C8RA 1FG5N 2AM3A 4Y6UA 2VSHA 4EVWA 2JCKA 2P72A 1HM9A 1JVDA 4UEGA 1INJA 5C49A 5JQQA 4B4BA 3U0XA 4M2AA 2X65A 1HM8A 5C3BA 1H7FA 5IFYA 2AH9A 5L6SA 4EE5A 4AAWA 3PNNA 2O1GA 4AYLA 4LW3A 5AJOA 1QGQA 3GUEA 1VZTA 4KT7A 5L6VA 3V0MA 2C0NA 3ST8A 5FYEA 4NAKA 2FYBA 1OMZA 1WT3A 1LL3A 3EE5A 4EEAA 1ZI4A 4HO4A 1V82A 3I0CA 4CJ8A 4O6NA 2ZU9A 4AYJA 2OEGA 3D8VA 5FV9A 4EE4A 1ZJ2A 3SXBA 1ZDFA 2YQSA 1R7XA 3JUKA 1PZTA 1LL2A 4CJBA 1WT0A 1ZJ0A 1FZWA 3K8EA 2RJ6A 1WVCA 3SX8A 5CQPA 1GX0A 2YQCA 2VK9A 1O7OA 5EJ1A 1G23A 4KC1A 3V8ZA 2YQJA 2A8WA 2P6WA 4MNDA 5C47A 2GGOA 4M28A 2E8BA 2BO6A 4FQWA 4HO6A 2QGIA 1ZCUA 1TW1A 1VGUA 5C38A 2RJ0A 3SXDA 1ON6A 3JUJA 1GWWA 3NGWA 4D0TA 3CKQA 3D98A 4KC2A 4KNXA 5CMGX 1H3MA 1ON8A 1VGZA 3V0QA 1ZCVA 1LZ0A 3DJ4A 3KIAA 2RJ7A 1H4EA 3DK5A 3I0JA 5CMIA 5DDTA 4MYBA 2FY7A 4D11C 4FRBA 3CKJA 4E1KA 5C1LA 4Y62A 4ASJA 3BCVA 4IRPA 2O1HA 2BO4A 1R80A 2VFZA 1VH3A 2PA4A 2ZU8A 4ZDQA 2WEEA 1VPAA 4Y63A 2W0WA 3CKOA 1YP4A 3PKPA 1G1LA 1IIMA 1W55A 2I5KA 1LZIA 1ZIZA 3U2TA 1LZ7A 1MP5A 3IOHA 5FTSA 3OH0A 3T7NA 2V0JA 1G9RA 4EEOA 1R7UA 1I52A 1O23B 1V83A 2XMEA 2WVMA 1JV3A 1H5SC 1YP3A 2W0VA 3K8DA 1GA8A 2RJ9A 3RMWA 1G0RA 4G3PA 1JYKA 2FYCB 1VM8A 4ASYA 1LZJA 5BXCA 3Q4SA 1V84A 5CQOA 1LVWA 2GGQA 5FTVA 4EEGA 1Z90A 1FOAA 4FRHA 2VSIA 4FRQA 4BMAA 3OH4A 2CU2A 4Y6NA 1GQ9A 2VXMA 3V91A 1K4VA 5EIYA 3SXCA 1H7EA 4EE3A 2MZBA 5C3AA 2I7BA 4CJCA 2YQHA 4NALA 5C1HA 2BO7A 1VZXA 4K6RA 5IDSA 3U2VA 1ZJPA 4JD0A 2I5EA 4AC3A 4ECMA 5AJPA 5I1FA 1MP4A 3ZLKA 1JVGA 1G95A 4Y7TA 1G3LA 3V0PA 1FXJA 1G93A 2RJ5A 2WE9A 3ZF8A 2RJ8A 5CQLX 4HO0A 1MC3A 1R7TA 2V0HA 2Z87A 3IOIA 5C4EA 4FIYA 1VGWA 3CU0A 1ZHJA 4HO8A 4J18A 1FGGA 5IDTA 4FRMA 3U2UA 4P02A 5CQNX 1GQCA 4M4KA 5FUHA 2D7RA 1QGSA 3V0NA 2YCMA 4JISA 4B4GA 2Y7AA 3POLA 3SXGA 1ZI3A 1ZJOA 4G87A 4FCEA 3OC9A 2VS3A 4FRPA 4HCQA 1O7QA 3USRA 5C1GA 3F1CA 4NAIA 2D0JA 1VICA 2AESA 2X5SA 3F1YA 3V90A 1ZJ1A 5CMHA 2RITA 2ICYA 1HJLA 1QG8A 3E25A 1TW5A 3SXEA 2BO8A 2WGZA 5CQMX 1ZI1A 2RJ4A 4G3SA 4CVHA 1JV1A 1S4OA 3I0DA 3SXAA 1O0RA 2PX7A 3N9WA 5AJNA 2AM4A 3CKNA 2E3DA 2A8UA 4BQHA 3I0KA 1S4NA 1NMMB 1VH1A 2J0AA 4DECA 3V0OA 1SS9A 2P73A 4XWIA 5HS2A 2RJ1A 3ZGFA 1INIA 4Y64A 4KQLA 1FWYA 4R7PA 3USQA 4G3QA 2ZU7A 4DDZA 1FO9A 1TVYA 4B42A 3I0FA 2QH5A 2YC3A 4HO2A 4EEMA 3Q80A 2Y6PA 5EJZA 4NANA 5FU0A 2WVKA 5D92A 3OH3A 3IOJA 5D91A 3I0GA 1H7QA 3T7MA 2ICXA 3JTJA 4FRAA 3SX7A 2PGYA 4B4MA 1WT1A 4LW6A 3RSBA 3O3PA 3I0LA 5C4DA 4Y7FA 1TZFA 1FXOA 1R7YA 2FYAA 1PZYB 1R81A 4P00A 2V0KA 1WSZA 1MP3A 3D5NA 1R7VA 3TZTA 1W77A 3CGXA 1XZ6A 4HO5A 1HV9A 1FGXA 5CMFX 1GX4A 3R3IA 3OKRA 1E5KA 1LL0A 1G97A 4HG6A 5C48A 1ZJ3A 2Z86A 3R2WA 3DUVA 1EZIA 1FR9A 4Q7CA 4FREA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2OI7 A;  4D48 A;  1H5T B;  1NWG B;  1ZCY A;  1JYL A;  2V0L A;  1EYR A;  2Y4K A;  2Y4M A;  4C2S A;  2YC5 A;  2V0I A;  3HL3 A;  4FRO A;  3T7O A;  3OH1 A;  3TQD A;  3OGZ A;  2FYD B;  4DE7 A;  1ZI5 A;  1H5S D;  2XWL A;  4Y7U A;  4FRD A;  5J49 A;  3FWW A;  2JCL A;  4KNR A;  2WAW A;  1W57 A;  1ZDG A;  4KRV A;  3U2X A;  1NHE B;  2NXV A;  2OI5 A;  5C4B A;  4HO9 A;  2D7I A;  5FU8 A;  1H4C A;  2APC A;  4GBP A;  1H5R B;  2Y4J A;  3SPT A;  1OQM B;  2VXL A;  3Q7U A;  2DPW A;  1H7L A;  2Q4J A;  3U0Y A;  4IRQ A;  1H5T A;  1VGT A;  4M2B A;  4B2X A;  2AE7 A;  4B2W A;  5C36 A;  1G2V A;  2PGV A;  2XMH A;  1OMX A;  4HOC A;  2QKX A;  1IIN A;  4ARW A;  4HO3 A;  1XHB A;  1ZCT A;  3SX5 A;  2O1F A;  3OAM A;  5C3D A;  2Y4L A;  4D11 A;  1HJJ A;  1H5S B;  1H7H A;  3QVB A;  1GWV A;  4FRL A;  2OI6 A;  2FFV A;  2RIZ A;  3CKV A;  2UX8 A;  3I0E A;  5CMJ A;  3OH2 A;  2VS5 A;  1G8O A;  1YRO B;  4Y9X A;  2XWN A;  3I0H A;  4YS8 A;  4L41 C;  1H7T A;  2RIY A;  4KXO A;  4Y7G A;  2FFU A;  4Y7V A;  1FRW A;  3ZLL A;  4KC4 A;  1H5R A;  5C4F A;  3BRK X;  2RIX A;  3SX3 A;  3E26 A;  5C4C A;  4B3U A;  2VD4 A;  5DDV A;  1H4D A;  1YP2 A;  3ZGG A;  4KPZ A;  1KWS A;  2AGD A;  1QWJ A;  4FCU A;  4B5B A;  1R82 A;  2AEC A;  1FO8 A;  2AM5 A;  1FR8 A;  4D0Z A;  2JCJ A;  2OEF A;  3LW6 A;  3V0L A;  1NF5 B;  1WT2 A;  3I0I X;  3U2W A;  4KPX A;  1H5S A;  2YES A;  2X5Z A;  2XWM A;  2WVL A;  2VS4 A;  3FOQ A;  1VZU A;  2X60 A;  1S4P A;  3PKQ A;  2JCO A;  3RMV A;  1NQI B;  1HM0 A;  1NKH B;  1H7G A;  3V8Y A;  5C8R A;  1FG5 N;  2AM3 A;  4Y6U A;  2VSH A;  4EVW A;  2JCK A;  2P72 A;  1HM9 A;  1JVD A;  4UEG A;  1INJ A;  5C49 A;  5JQQ A;  4B4B A;  3U0X A;  4M2A A;  2X65 A;  1HM8 A;  5C3B A;  1H7F A;  5IFY A;  2AH9 A;  5L6S A;  4EE5 A;  4AAW A;  3PNN A;  2O1G A;  4AYL A;  4LW3 A;  5AJO A;  1QGQ A;  3GUE A;  1VZT A;  4KT7 A;  5L6V A;  3V0M A;  3ST8 A;  5FYE A;  4NAK A;  2FYB A;  1OMZ A;  1WT3 A;  1LL3 A;  3EE5 A;  4EEA A;  1ZI4 A;  4HO4 A;  1V82 A;  3I0C A;  4CJ8 A;  2ZU9 A;  4AYJ A;  2OEG A;  3D8V A;  5FV9 A;  4EE4 A;  1ZJ2 A;  3SXB A;  1ZDF A;  2YQS A;  1R7X A;  3JUK A;  1PZT A;  1LL2 A;  4CJB A;  1WT0 A;  1ZJ0 A;  1FZW A;  3K8E A;  2RJ6 A;  1WVC A;  3SX8 A;  5CQP A;  1GX0 A;  2YQC A;  1O7O A;  5EJ1 A;  1G23 A;  4KC1 A;  3V8Z A;  2YQJ A;  2A8W A;  2P6W A;  4MND A;  5C47 A;  2GGO A;  4M28 A;  2E8B A;  2BO6 A;  4FQW A;  4HO6 A;  2QGI A;  1ZCU A;  1TW1 A;  1VGU A;  5C38 A;  2RJ0 A;  3SXD A;  1ON6 A;  3JUJ A;  1GWW A;  3NGW A;  4D0T A;  3CKQ A;  3D98 A;  4KC2 A;  4KNX A;  5CMG X;  1H3M A;  1ON8 A;  1VGZ A;  3V0Q A;  1ZCV A;  1LZ0 A;  3DJ4 A;  3KIA A;  2RJ7 A;  1H4E A;  3DK5 A;  3I0J A;  5CMI A;  5DDT A;  4MYB A;  2FY7 A;  4D11 C;  4FRB A;  3CKJ A;  4E1K A;  5C1L A;  4Y62 A;  4ASJ A;  3BCV A;  4IRP A;  2O1H A;  2BO4 A;  1R80 A;  2VFZ A;  1VH3 A;  2PA4 A;  2ZU8 A;  4ZDQ A;  2WEE A;  1VPA A;  4Y63 A;  2W0W A;  3CKO A;  1YP4 A;  3PKP A;  1G1L A;  1IIM A;  1W55 A;  2I5K A;  1LZI A;  1ZIZ A;  3U2T A;  1LZ7 A;  1MP5 A;  3IOH A;  5FTS A;  3OH0 A;  3T7N A;  2V0J A;  1G9R A;  4EEO A;  1R7U A;  1I52 A;  1O23 B;  1V83 A;  2XME A;  2WVM A;  1JV3 A;  1H5S C;  1YP3 A;  2W0V A;  3K8D A;  1GA8 A;  2RJ9 A;  3RMW A;  1G0R A;  4G3P A;  1JYK A;  2FYC B;  1VM8 A;  4ASY A;  1LZJ A;  5BXC A;  3Q4S A;  1V84 A;  5CQO A;  1LVW A;  2GGQ A;  5FTV A;  4EEG A;  1Z90 A;  1FOA A;  4FRH A;  2VSI A;  4FRQ A;  4BMA A;  3OH4 A;  2CU2 A;  4Y6N A;  1GQ9 A;  2VXM A;  3V91 A;  1K4V A;  5EIY A;  3SXC A;  1H7E A;  4EE3 A;  2MZB A;  5C3A A;  2I7B A;  4CJC A;  2YQH A;  4NAL A;  5C1H A;  2BO7 A;  1VZX A;  4K6R A;  5IDS A;  3U2V A;  1ZJP A;  4JD0 A;  2I5E A;  4AC3 A;  4ECM A;  5AJP A;  5I1F A;  1MP4 A;  3ZLK A;  1JVG A;  1G95 A;  4Y7T A;  1G3L A;  3V0P A;  1FXJ A;  1G93 A;  2RJ5 A;  2WE9 A;  3ZF8 A;  2RJ8 A;  5CQL X;  4HO0 A;  1MC3 A;  1R7T A;  2V0H A;  2Z87 A;  3IOI A;  5C4E A;  1VGW A;  3CU0 A;  1ZHJ A;  4HO8 A;  4J18 A;  1FGG A;  5IDT A;  4FRM A;  3U2U A;  4P02 A;  5CQN X;  1GQC A;  4M4K A;  5FUH A;  2D7R A;  1QGS A;  3V0N A;  2YCM A;  4JIS A;  4B4G A;  2Y7A A;  3POL A;  3SXG A;  1ZI3 A;  1ZJO A;  4G87 A;  4FCE A;  3OC9 A;  2VS3 A;  4FRP A;  4HCQ A;  1O7Q A;  3USR A;  5C1G A;  3F1C A;  4NAI A;  2D0J A;  1VIC A;  2AES A;  2X5S A;  3F1Y A;  3V90 A;  1ZJ1 A;  5CMH A;  2RIT A;  2ICY A;  1HJL A;  1QG8 A;  3E25 A;  1TW5 A;  3SXE A;  2BO8 A;  2WGZ A;  5CQM X;  1ZI1 A;  2RJ4 A;  4G3S A;  4CVH A;  1JV1 A;  1S4O A;  3I0D A;  3SXA A;  1O0R A;  2PX7 A;  3N9W A;  5AJN A;  2AM4 A;  3CKN A;  2E3D A;  2A8U A;  4BQH A;  3I0K A;  1S4N A;  1NMM B;  1VH1 A;  4DEC A;  3V0O A;  1SS9 A;  2P73 A;  4XWI A;  5HS2 A;  2RJ1 A;  3ZGF A;  1INI A;  4Y64 A;  4KQL A;  1FWY A;  4R7P A;  3USQ A;  4G3Q A;  2ZU7 A;  4DDZ A;  1FO9 A;  1TVY A;  4B42 A;  3I0F A;  2QH5 A;  2YC3 A;  4HO2 A;  4EEM A;  3Q80 A;  2Y6P A;  5EJZ A;  4NAN A;  5FU0 A;  2WVK A;  3OH3 A;  3IOJ A;  3I0G A;  1H7Q A;  3T7M A;  2ICX A;  3JTJ A;  4FRA A;  3SX7 A;  2PGY A;  4B4M A;  1WT1 A;  4LW6 A;  3RSB A;  3O3P A;  3I0L A;  5C4D A;  4Y7F A;  1TZF A;  1FXO A;  1R7Y A;  2FYA A;  1PZY B;  1R81 A;  4P00 A;  2V0K A;  1WSZ A;  1MP3 A;  3D5N A;  1R7V A;  3TZT A;  1W77 A;  3CGX A;  1XZ6 A;  4HO5 A;  1HV9 A;  1FGX A;  5CMF X;  1GX4 A;  3R3I A;  3OKR A;  1E5K A;  1LL0 A;  1G97 A;  4HG6 A;  5C48 A;  1ZJ3 A;  2Z86 A;  3R2W A;  3DUV A;  1EZI A;  1FR9 A;  4FRE A; 
#chains in the Genus database with same CATH topology
 2OI7 A;  4D48 A;  1H5T B;  1NWG B;  1ZCY A;  1JYL A;  2V0L A;  1EYR A;  2Y4K A;  2Y4M A;  4C2S A;  2YC5 A;  2V0I A;  3HL3 A;  4FRO A;  3T7O A;  3OH1 A;  3TQD A;  3OGZ A;  4FIX A;  2FYD B;  4DE7 A;  1ZI5 A;  1H5S D;  2XWL A;  4Y7U A;  4FRD A;  5J49 A;  3FWW A;  2JCL A;  4KNR A;  2WAW A;  1W57 A;  1ZDG A;  4KRV A;  3U2X A;  1NHE B;  2NXV A;  2OI5 A;  5C4B A;  4HO9 A;  2D7I A;  5FU8 A;  1H4C A;  4O6M A;  2APC A;  4GBP A;  1H5R B;  2Y4J A;  3SPT A;  1OQM B;  2VXL A;  3Q7U A;  2DPW A;  1H7L A;  2Q4J A;  3U0Y A;  4IRQ A;  1H5T A;  1VGT A;  4M2B A;  4B2X A;  2AE7 A;  4B2W A;  5C36 A;  1G2V A;  2PGV A;  2XMH A;  1OMX A;  4HOC A;  2QKX A;  1IIN A;  4ARW A;  4HO3 A;  1XHB A;  1ZCT A;  3SX5 A;  2O1F A;  3OAM A;  5C3D A;  2Y4L A;  4D11 A;  1HJJ A;  2J0B A;  1H5S B;  1H7H A;  3QVB A;  1GWV A;  4FRL A;  2OI6 A;  2FFV A;  2RIZ A;  3CKV A;  2UX8 A;  3I0E A;  5CMJ A;  3OH2 A;  2VS5 A;  4MIX A;  1G8O A;  1YRO B;  4Y9X A;  2XWN A;  3I0H A;  4YS8 A;  4L41 C;  1H7T A;  2RIY A;  4KXO A;  4Y7G A;  2FFU A;  4Y7V A;  1FRW A;  3ZLL A;  4KC4 A;  1H5R A;  5C4F A;  3BRK X;  2RIX A;  3SX3 A;  3E26 A;  5C4C A;  4B3U A;  2VD4 A;  5DDV A;  1H4D A;  1YP2 A;  3ZGG A;  4KPZ A;  1KWS A;  2AGD A;  1QWJ A;  4FCU A;  4B5B A;  1R82 A;  2AEC A;  1FO8 A;  2AM5 A;  1FR8 A;  4D0Z A;  2JCJ A;  2OEF A;  3LW6 A;  3V0L A;  1NF5 B;  1WT2 A;  3I0I X;  3U2W A;  4KPX A;  1H5S A;  2YES A;  2X5Z A;  2XWM A;  2WVL A;  2VS4 A;  3FOQ A;  1VZU A;  2X60 A;  1S4P A;  3PKQ A;  2JCO A;  3RMV A;  1NQI B;  1HM0 A;  1NKH B;  1H7G A;  3V8Y A;  5C8R A;  1FG5 N;  2AM3 A;  4Y6U A;  2VSH A;  4EVW A;  2JCK A;  2P72 A;  1HM9 A;  1JVD A;  4UEG A;  1INJ A;  5C49 A;  5JQQ A;  4B4B A;  3U0X A;  4M2A A;  2X65 A;  1HM8 A;  5C3B A;  1H7F A;  5IFY A;  2AH9 A;  5L6S A;  4EE5 A;  4AAW A;  3PNN A;  2O1G A;  4AYL A;  4LW3 A;  5AJO A;  1QGQ A;  3GUE A;  1VZT A;  4KT7 A;  5L6V A;  3V0M A;  2C0N A;  3ST8 A;  5FYE A;  4NAK A;  2FYB A;  1OMZ A;  1WT3 A;  1LL3 A;  3EE5 A;  4EEA A;  1ZI4 A;  4HO4 A;  1V82 A;  3I0C A;  4CJ8 A;  4O6N A;  2ZU9 A;  4AYJ A;  2OEG A;  3D8V A;  5FV9 A;  4EE4 A;  1ZJ2 A;  3SXB A;  1ZDF A;  2YQS A;  1R7X A;  3JUK A;  1PZT A;  1LL2 A;  4CJB A;  1WT0 A;  1ZJ0 A;  1FZW A;  3K8E A;  2RJ6 A;  1WVC A;  3SX8 A;  5CQP A;  1GX0 A;  2YQC A;  2VK9 A;  1O7O A;  5EJ1 A;  1G23 A;  4KC1 A;  3V8Z A;  2YQJ A;  2A8W A;  2P6W A;  4MND A;  5C47 A;  2GGO A;  4M28 A;  2E8B A;  2BO6 A;  4FQW A;  4HO6 A;  2QGI A;  1ZCU A;  1TW1 A;  1VGU A;  5C38 A;  2RJ0 A;  3SXD A;  1ON6 A;  3JUJ A;  1GWW A;  3NGW A;  4D0T A;  3CKQ A;  3D98 A;  4KC2 A;  4KNX A;  5CMG X;  1H3M A;  1ON8 A;  1VGZ A;  3V0Q A;  1ZCV A;  1LZ0 A;  3DJ4 A;  3KIA A;  2RJ7 A;  1H4E A;  3DK5 A;  3I0J A;  5CMI A;  5DDT A;  4MYB A;  2FY7 A;  4D11 C;  4FRB A;  3CKJ A;  4E1K A;  5C1L A;  4Y62 A;  4ASJ A;  3BCV A;  4IRP A;  2O1H A;  2BO4 A;  1R80 A;  2VFZ A;  1VH3 A;  2PA4 A;  2ZU8 A;  4ZDQ A;  2WEE A;  1VPA A;  4Y63 A;  2W0W A;  3CKO A;  1YP4 A;  3PKP A;  1G1L A;  1IIM A;  1W55 A;  2I5K A;  1LZI A;  1ZIZ A;  3U2T A;  1LZ7 A;  1MP5 A;  3IOH A;  5FTS A;  3OH0 A;  3T7N A;  2V0J A;  1G9R A;  4EEO A;  1R7U A;  1I52 A;  1O23 B;  1V83 A;  2XME A;  2WVM A;  1JV3 A;  1H5S C;  1YP3 A;  2W0V A;  3K8D A;  1GA8 A;  2RJ9 A;  3RMW A;  1G0R A;  4G3P A;  1JYK A;  2FYC B;  1VM8 A;  4ASY A;  1LZJ A;  5BXC A;  3Q4S A;  1V84 A;  5CQO A;  1LVW A;  2GGQ A;  5FTV A;  4EEG A;  1Z90 A;  1FOA A;  4FRH A;  2VSI A;  4FRQ A;  4BMA A;  3OH4 A;  2CU2 A;  4Y6N A;  1GQ9 A;  2VXM A;  3V91 A;  1K4V A;  5EIY A;  3SXC A;  1H7E A;  4EE3 A;  2MZB A;  5C3A A;  2I7B A;  4CJC A;  2YQH A;  4NAL A;  5C1H A;  2BO7 A;  1VZX A;  4K6R A;  5IDS A;  3U2V A;  1ZJP A;  4JD0 A;  2I5E A;  4AC3 A;  4ECM A;  5AJP A;  5I1F A;  1MP4 A;  3ZLK A;  1JVG A;  1G95 A;  4Y7T A;  1G3L A;  3V0P A;  1FXJ A;  1G93 A;  2RJ5 A;  2WE9 A;  3ZF8 A;  2RJ8 A;  5CQL X;  4HO0 A;  1MC3 A;  1R7T A;  2V0H A;  2Z87 A;  3IOI A;  5C4E A;  4FIY A;  1VGW A;  3CU0 A;  1ZHJ A;  4HO8 A;  4J18 A;  1FGG A;  5IDT A;  4FRM A;  3U2U A;  4P02 A;  5CQN X;  1GQC A;  4M4K A;  5FUH A;  2D7R A;  1QGS A;  3V0N A;  2YCM A;  4JIS A;  4B4G A;  2Y7A A;  3POL A;  3SXG A;  1ZI3 A;  1ZJO A;  4G87 A;  4FCE A;  3OC9 A;  2VS3 A;  4FRP A;  4HCQ A;  1O7Q A;  3USR A;  5C1G A;  3F1C A;  4NAI A;  2D0J A;  1VIC A;  2AES A;  2X5S A;  3F1Y A;  3V90 A;  1ZJ1 A;  5CMH A;  2RIT A;  2ICY A;  1HJL A;  1QG8 A;  3E25 A;  1TW5 A;  3SXE A;  2BO8 A;  2WGZ A;  5CQM X;  1ZI1 A;  2RJ4 A;  4G3S A;  4CVH A;  1JV1 A;  1S4O A;  3I0D A;  3SXA A;  1O0R A;  2PX7 A;  3N9W A;  5AJN A;  2AM4 A;  3CKN A;  2E3D A;  2A8U A;  4BQH A;  3I0K A;  1S4N A;  1NMM B;  1VH1 A;  2J0A A;  4DEC A;  3V0O A;  1SS9 A;  2P73 A;  4XWI A;  5HS2 A;  2RJ1 A;  3ZGF A;  1INI A;  4Y64 A;  4KQL A;  1FWY A;  4R7P A;  3USQ A;  4G3Q A;  2ZU7 A;  4DDZ A;  1FO9 A;  1TVY A;  4B42 A;  3I0F A;  2QH5 A;  2YC3 A;  4HO2 A;  4EEM A;  3Q80 A;  2Y6P A;  5EJZ A;  4NAN A;  5FU0 A;  2WVK A;  5D92 A;  3OH3 A;  3IOJ A;  5D91 A;  3I0G A;  1H7Q A;  3T7M A;  2ICX A;  3JTJ A;  4FRA A;  3SX7 A;  2PGY A;  4B4M A;  1WT1 A;  4LW6 A;  3RSB A;  3O3P A;  3I0L A;  5C4D A;  4Y7F A;  1TZF A;  1FXO A;  1R7Y A;  2FYA A;  1PZY B;  1R81 A;  4P00 A;  2V0K A;  1WSZ A;  1MP3 A;  3D5N A;  1R7V A;  3TZT A;  1W77 A;  3CGX A;  1XZ6 A;  4HO5 A;  1HV9 A;  1FGX A;  5CMF X;  1GX4 A;  3R3I A;  3OKR A;  1E5K A;  1LL0 A;  1G97 A;  4HG6 A;  5C48 A;  1ZJ3 A;  2Z86 A;  3R2W A;  3DUV A;  1EZI A;  1FR9 A;  4Q7C A;  4FRE A; 
#chains in the Genus database with same CATH homology
 2OI7 A;  4D48 A;  1H5T B;  1NWG B;  1ZCY A;  1JYL A;  2V0L A;  1EYR A;  2Y4K A;  2Y4M A;  4C2S A;  2YC5 A;  2V0I A;  3HL3 A;  4FRO A;  3T7O A;  3OH1 A;  3TQD A;  3OGZ A;  4FIX A;  2FYD B;  4DE7 A;  1ZI5 A;  1H5S D;  2XWL A;  4Y7U A;  4FRD A;  5J49 A;  3FWW A;  2JCL A;  4KNR A;  2WAW A;  1W57 A;  1ZDG A;  4KRV A;  3U2X A;  1NHE B;  2NXV A;  2OI5 A;  5C4B A;  4HO9 A;  2D7I A;  5FU8 A;  1H4C A;  4O6M A;  2APC A;  4GBP A;  1H5R B;  2Y4J A;  3SPT A;  1OQM B;  2VXL A;  3Q7U A;  2DPW A;  1H7L A;  2Q4J A;  3U0Y A;  4IRQ A;  1H5T A;  1VGT A;  4M2B A;  4B2X A;  2AE7 A;  4B2W A;  5C36 A;  1G2V A;  2PGV A;  2XMH A;  1OMX A;  4HOC A;  2QKX A;  1IIN A;  4ARW A;  4HO3 A;  1XHB A;  1ZCT A;  3SX5 A;  2O1F A;  3OAM A;  5C3D A;  2Y4L A;  4D11 A;  1HJJ A;  2J0B A;  1H5S B;  1H7H A;  3QVB A;  1GWV A;  4FRL A;  2OI6 A;  2FFV A;  2RIZ A;  3CKV A;  2UX8 A;  3I0E A;  5CMJ A;  3OH2 A;  2VS5 A;  4MIX A;  1G8O A;  1YRO B;  4Y9X A;  2XWN A;  3I0H A;  4YS8 A;  4L41 C;  1H7T A;  2RIY A;  4KXO A;  4Y7G A;  2FFU A;  4Y7V A;  1FRW A;  3ZLL A;  4KC4 A;  1H5R A;  5C4F A;  3BRK X;  2RIX A;  3SX3 A;  3E26 A;  5C4C A;  4B3U A;  2VD4 A;  5DDV A;  1H4D A;  1YP2 A;  3ZGG A;  4KPZ A;  1KWS A;  2AGD A;  1QWJ A;  4FCU A;  4B5B A;  1R82 A;  2AEC A;  1FO8 A;  2AM5 A;  1FR8 A;  4D0Z A;  2JCJ A;  2OEF A;  3LW6 A;  3V0L A;  1NF5 B;  1WT2 A;  3I0I X;  3U2W A;  4KPX A;  1H5S A;  2YES A;  2X5Z A;  2XWM A;  2WVL A;  2VS4 A;  3FOQ A;  1VZU A;  2X60 A;  1S4P A;  3PKQ A;  2JCO A;  3RMV A;  1NQI B;  1HM0 A;  1NKH B;  1H7G A;  3V8Y A;  5C8R A;  1FG5 N;  2AM3 A;  4Y6U A;  2VSH A;  4EVW A;  2JCK A;  2P72 A;  1HM9 A;  1JVD A;  4UEG A;  1INJ A;  5C49 A;  5JQQ A;  4B4B A;  3U0X A;  4M2A A;  2X65 A;  1HM8 A;  5C3B A;  1H7F A;  5IFY A;  2AH9 A;  5L6S A;  4EE5 A;  4AAW A;  3PNN A;  2O1G A;  4AYL A;  4LW3 A;  5AJO A;  1QGQ A;  3GUE A;  1VZT A;  4KT7 A;  5L6V A;  3V0M A;  2C0N A;  3ST8 A;  5FYE A;  4NAK A;  2FYB A;  1OMZ A;  1WT3 A;  1LL3 A;  3EE5 A;  4EEA A;  1ZI4 A;  4HO4 A;  1V82 A;  3I0C A;  4CJ8 A;  4O6N A;  2ZU9 A;  4AYJ A;  2OEG A;  3D8V A;  5FV9 A;  4EE4 A;  1ZJ2 A;  3SXB A;  1ZDF A;  2YQS A;  1R7X A;  3JUK A;  1PZT A;  1LL2 A;  4CJB A;  1WT0 A;  1ZJ0 A;  1FZW A;  3K8E A;  2RJ6 A;  1WVC A;  3SX8 A;  5CQP A;  1GX0 A;  2YQC A;  2VK9 A;  1O7O A;  5EJ1 A;  1G23 A;  4KC1 A;  3V8Z A;  2YQJ A;  2A8W A;  2P6W A;  4MND A;  5C47 A;  2GGO A;  4M28 A;  2E8B A;  2BO6 A;  4FQW A;  4HO6 A;  2QGI A;  1ZCU A;  1TW1 A;  1VGU A;  5C38 A;  2RJ0 A;  3SXD A;  1ON6 A;  3JUJ A;  1GWW A;  3NGW A;  4D0T A;  3CKQ A;  3D98 A;  4KC2 A;  4KNX A;  5CMG X;  1H3M A;  1ON8 A;  1VGZ A;  3V0Q A;  1ZCV A;  1LZ0 A;  3DJ4 A;  3KIA A;  2RJ7 A;  1H4E A;  3DK5 A;  3I0J A;  5CMI A;  5DDT A;  4MYB A;  2FY7 A;  4D11 C;  4FRB A;  3CKJ A;  4E1K A;  5C1L A;  4Y62 A;  4ASJ A;  3BCV A;  4IRP A;  2O1H A;  2BO4 A;  1R80 A;  2VFZ A;  1VH3 A;  2PA4 A;  2ZU8 A;  4ZDQ A;  2WEE A;  1VPA A;  4Y63 A;  2W0W A;  3CKO A;  1YP4 A;  3PKP A;  1G1L A;  1IIM A;  1W55 A;  2I5K A;  1LZI A;  1ZIZ A;  3U2T A;  1LZ7 A;  1MP5 A;  3IOH A;  5FTS A;  3OH0 A;  3T7N A;  2V0J A;  1G9R A;  4EEO A;  1R7U A;  1I52 A;  1O23 B;  1V83 A;  2XME A;  2WVM A;  1JV3 A;  1H5S C;  1YP3 A;  2W0V A;  3K8D A;  1GA8 A;  2RJ9 A;  3RMW A;  1G0R A;  4G3P A;  1JYK A;  2FYC B;  1VM8 A;  4ASY A;  1LZJ A;  5BXC A;  3Q4S A;  1V84 A;  5CQO A;  1LVW A;  2GGQ A;  5FTV A;  4EEG A;  1Z90 A;  1FOA A;  4FRH A;  2VSI A;  4FRQ A;  4BMA A;  3OH4 A;  2CU2 A;  4Y6N A;  1GQ9 A;  2VXM A;  3V91 A;  1K4V A;  5EIY A;  3SXC A;  1H7E A;  4EE3 A;  2MZB A;  5C3A A;  2I7B A;  4CJC A;  2YQH A;  4NAL A;  5C1H A;  2BO7 A;  1VZX A;  4K6R A;  5IDS A;  3U2V A;  1ZJP A;  4JD0 A;  2I5E A;  4AC3 A;  4ECM A;  5AJP A;  5I1F A;  1MP4 A;  3ZLK A;  1JVG A;  1G95 A;  4Y7T A;  1G3L A;  3V0P A;  1FXJ A;  1G93 A;  2RJ5 A;  2WE9 A;  3ZF8 A;  2RJ8 A;  5CQL X;  4HO0 A;  1MC3 A;  1R7T A;  2V0H A;  2Z87 A;  3IOI A;  5C4E A;  4FIY A;  1VGW A;  3CU0 A;  1ZHJ A;  4HO8 A;  4J18 A;  1FGG A;  5IDT A;  4FRM A;  3U2U A;  4P02 A;  5CQN X;  1GQC A;  4M4K A;  5FUH A;  2D7R A;  1QGS A;  3V0N A;  2YCM A;  4JIS A;  4B4G A;  2Y7A A;  3POL A;  3SXG A;  1ZI3 A;  1ZJO A;  4G87 A;  4FCE A;  3OC9 A;  2VS3 A;  4FRP A;  4HCQ A;  1O7Q A;  3USR A;  5C1G A;  3F1C A;  4NAI A;  2D0J A;  1VIC A;  2AES A;  2X5S A;  3F1Y A;  3V90 A;  1ZJ1 A;  5CMH A;  2RIT A;  2ICY A;  1HJL A;  1QG8 A;  3E25 A;  1TW5 A;  3SXE A;  2BO8 A;  2WGZ A;  5CQM X;  1ZI1 A;  2RJ4 A;  4G3S A;  4CVH A;  1JV1 A;  1S4O A;  3I0D A;  3SXA A;  1O0R A;  2PX7 A;  3N9W A;  5AJN A;  2AM4 A;  3CKN A;  2E3D A;  2A8U A;  4BQH A;  3I0K A;  1S4N A;  1NMM B;  1VH1 A;  2J0A A;  4DEC A;  3V0O A;  1SS9 A;  2P73 A;  4XWI A;  5HS2 A;  2RJ1 A;  3ZGF A;  1INI A;  4Y64 A;  4KQL A;  1FWY A;  4R7P A;  3USQ A;  4G3Q A;  2ZU7 A;  4DDZ A;  1FO9 A;  1TVY A;  4B42 A;  3I0F A;  2QH5 A;  2YC3 A;  4HO2 A;  4EEM A;  3Q80 A;  2Y6P A;  5EJZ A;  4NAN A;  5FU0 A;  2WVK A;  5D92 A;  3OH3 A;  3IOJ A;  5D91 A;  3I0G A;  1H7Q A;  3T7M A;  2ICX A;  3JTJ A;  4FRA A;  3SX7 A;  2PGY A;  4B4M A;  1WT1 A;  4LW6 A;  3RSB A;  3O3P A;  3I0L A;  5C4D A;  4Y7F A;  1TZF A;  1FXO A;  1R7Y A;  2FYA A;  1PZY B;  1R81 A;  4P00 A;  2V0K A;  1WSZ A;  1MP3 A;  3D5N A;  1R7V A;  3TZT A;  1W77 A;  3CGX A;  1XZ6 A;  4HO5 A;  1HV9 A;  1FGX A;  5CMF X;  1GX4 A;  3R3I A;  3OKR A;  1E5K A;  1LL0 A;  1G97 A;  4HG6 A;  5C48 A;  1ZJ3 A;  2Z86 A;  3R2W A;  3DUV A;  1EZI A;  1FR9 A;  4Q7C A;  4FRE A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...