1LZIA

Glycosyltransferase a + udp + h antigen acceptor
Total Genus 85
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
85
sequence length
283
structure length
264
Chain Sequence
MVSLPRMVYPQPKVLTPCRKDVLVVTPWLAPIVWEGTFNIDILNEQFRLQNTTIGLTVFAIKKYVAFLKLFLETAEKHFMVGHRVHYYVFTDQPAAVPRVTLGTGRQLSVLEVRCERRFLSEVDYLVCVDVDMEFRDHVGVEILTPLFGTLHPGFYGSSREAFTYERRPQSQAYIPKDEGDFYYLGGFFGGSVQEVQRLTRACHQAMMVDQANGIEAVWHDESHLNKYLLRHKPTKVLSPEYLWDQQLLGWPAVLRKLRFTAVP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords Glycosyltransferase A
publication title The structural basis for specificity in human ABO(H) blood group biosynthesis.
pubmed doi rcsb
source organism Homo sapiens
total genus 85
structure length 264
sequence length 283
ec nomenclature ec 2.4.1.37: Fucosylgalactoside 3-alpha-galactosyltransferase.
pdb deposition date 2002-06-10
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.550.10 Alpha Beta Alpha-Beta Complex Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A 1lziA00
4Y62A 4B4MA 3V0LA 3U2UA 1H5SC 4KXOA 1W57A 1MP3A 3DUVA 1R82A 2Z86A 2VS3A 1R7XA 1YROB 4FRAA 2YCMA 3KIAA 1HJJA 3BCVA 4Y7VA 4HCQA 4D11A 3CGXA 1V82A 2JCKA 2NXVA 2Z87A 5J49A 4KC1A 1MC3A 2Y4JA 1V83A 4FRDA 3ZF8A 3I0KA 3OGZA 2AGDA 1VGUA 2O1GA 2VXMA 1G23A 2QGIA 2PGVA 1NHEB 4EE4A 1VH1A 4BMAA 5FU0A 1FOAA 1HV9A 4J18A 2AE7A 3V8YA 4MYBA 3TZTA 1OQMB 2RIZA 1MP4A 4B42A 3T7NA 1H5SA 2XWMA 5C1HA 3K8DA 3SXCA 2FFUA 2DPWA 4NAKA 1H7LA 2X60A 3RMVA 1JV1A 4LW6A 1XZ6A 3I0EA 2JCLA 4M4KA 1E5KA 5CQMX 2ZU7A 3R2WA 1R7TA 3IOHA 1PZYB 1H4CA 1S4OA 3CKVA 2D7IA 4MNDA 1VICA 2Y6PA 3D5NA 1NMMB 5AJOA 4CJ8A 4Y64A 5C3AA 3T7OA 4B2WA 2FYDB 1FG5N 5AJPA 3LW6A 1Z90A 4HG6A 2W0VA 1ZJ2A 1H5RA 5C1GA 4KT7A 2VS4A 2MZBA 2RJ9A 4P00A 1TW5A 2PX7A 2V0KA 4B5BA 5C4BA 3SXAA 3U0YA 4FROA 3SXBA 1PZTA 2OEFA 1FGGA 4Y6UA 3I0IX 2Y4LA 2ICXA 5CQOA 4K6RA 1OMXA 1TVYA 2WEEA 2RJ1A 1WT0A 5FTSA 3SX3A 2YQJA 4CVHA 1QG8A 3IOIA 1ZJ0A 2P72A 1ZJPA 2VFZA 1HJLA 2XMEA 3O3PA 4ECMA 1ZJOA 4FRLA 3Q7UA 2VD4A 3OC9A 1H7TA 1FO8A 2JCJA 3ST8A 5CMIA 2AECA 1NWGB 4HO5A 2X65A 4FQWA 2XMHA 2I5KA 4E1KA 3CU0A 4DE7A 3ZGGA 3DK5A 1VZXA 2P6WA 2GGOA 4IRPA 3T7MA 5C4CA 4M2BA 3OH4A 2Y7AA 4B4GA 4KRVA 4KNXA 3SXDA 4HO9A 3OH2A 1ZCYA 3BRKX 2I5EA 3V90A 3SXEA 4FCUA 1G95A 1GQ9A 1LZ0A 1FR9A 4HO3A 3V0OA 1S4PA 3CKJA 3JTJA 1MP5A 1O23B 5IDSA 1WT3A 1G97A 4EE3A 1GWWA 2X5SA 5AJNA 3RSBA 3V0QA 4EE5A 1GQCA 1H5SD 1JVGA 4FRPA 2Q4JA 1GWVA 1ZI3A 4JISA 1ZCTA 3Q80A 3IOJA 4BQHA 3D98A 5DDVA 2AM3A 3U2WA 3PKQA 5I1FA 2AH9A 4Y63A 3PKPA 4NANA 4EVWA 4XWIA 3PNNA 3ZLLA 1ON8A 2V0HA 3GUEA 2V0LA 1VGWA 3F1YA 4AAWA 2FY7A 3I0GA 3OKRA 4AYJA 2FYCB 2YC3A 1JYKA 3U2VA 5IFYA 3USRA 3USQA 2WVKA 1H5TB 3JUKA 5FTVA 4LW3A 2O1FA 3CKQA 1G93A 5C49A 1H7EA 1O0RA 2A8UA 2JCOA 1HM8A 3HL3A 5CQPA 4EEOA 4Y7TA 5FUHA 2I7BA 5C1LA 1VGZA 1JV3A 1ZJ1A 1O7QA 3V0MA 2AM5A 4CJBA 1G9RA 4YS8A 5CMFX 4FRMA 4GBPA 1ZJ3A 1LZ7A 4FRBA 2RJ4A 2XWLA 2QH5A 3R3IA 4G87A 2E8BA 1NF5B 1G3LA 1ZHJA 1JYLA 4C2SA 3FWWA 1IIMA 2RIXA 1NQIB 1LL3A 1VZUA 1YP4A 2P73A 5C4EA 1HM9A 4HO4A 2O1HA 2YESA 4HO6A 1GX4A 2E3DA 2VSHA 1ZI1A 2VS5A 1LL2A 1VM8A 3JUJA 2WVLA 1HM0A 3I0HA 4IRQA 3K8EA 2RIYA 1EYRA 2AESA 3ZGFA 1V84A 2WVMA 4KQLA 2RJ8A 2Y4MA 3V0PA 1VPAA 1K4VA 4FCEA 2YQHA 4G3SA 5FYEA 4KPXA 2RITA 3CKOA 4ASJA 1QWJA 3I0CA 1I52A 4P02A 1ON6A 3E25A 3U2XA 3QVBA 2CU2A 1KWSA 4D48A 1YP3A 1WVCA 4KC4A 1GX0A 1G8OA 1R7UA 5BXCA 1IINA 1R7YA 2VSIA 3I0LA 1FXOA 1VZTA 1H7HA 5JQQA 5C3DA 3F1CA 4CJCA 2ICYA 3ZLKA 1NKHB 3FOQA 1H4EA 3SPTA 3OAMA 4D0TA 3POLA 3OH1A 3SX8A 2YC5A 4NAIA 4KPZA 5EJZA 5IDTA 1ZCVA 5FV9A 2RJ7A 4R7PA 2RJ5A 2D0JA 5CMHA 5C4DA 4KC2A 4AC3A 3V0NA 3U0XA 1H7QA 2PGYA 1FWYA 1H5SB 1TZFA 5CMGX 4B4BA 3DJ4A 5HS2A 4B3UA 2OI5A 4KNRA 4M28A 2V0JA 2GGQA 1LL0A 1INJA 2BO7A 1LVWA 3RMWA 1LZJA 4AYLA 4Y9XA 4EEAA 1FO9A 1WSZA 4M2AA 3EE5A 2OEGA 4Y7FA 1EZIA 1TW1A 1QGSA 4FREA 2FFVA 4HOCA 3SX5A 5EIYA 1WT2A 4B2XA 2V0IA 3CKNA 4FRQA 1H5TA 2WGZA 4L41C 5C38A 1ZIZA 1FZWA 5CQNX 5C8RA 4G3PA 1VH3A 1H5RB 2D7RA 2XWNA 1R81A 3OH0A 1W77A 5C4FA 1G2VA 4NALA 3OH3A 4Y7UA 5L6SA 1R80A 4Y7GA 4ASYA 3D8VA 5CMJA 3I0FA 1WT1A 5FU8A 2AM4A 1FGXA 2BO8A 1G1LA 1H7GA 5L6VA 1INIA 2RJ6A 2VXLA 2W0WA 5C47A 4D0ZA 2YQCA 2WAWA 2ZU9A 1H4DA 1O7OA 3Q4SA 4G3QA 1XHBA 2OI6A 1ZI5A 2A8WA 3V91A 2ZU8A 1ZDFA 4HO8A 3N9WA 3I0DA 2BO4A 2APCA 5C48A 4Y6NA 1R7VA 3SXGA 4ZDQA 4EEMA 1GA8A 2YQSA 1VGTA 1ZCUA 1G0RA 5EJ1A 2PA4A 4JD0A 2QKXA 4FRHA 2OI7A 4EEGA 5C36A 2WE9A 4DECA 5C3BA 2X5ZA 3V8ZA 1FXJA 3TQDA 1W55A 4DDZA 3NGWA 1FRWA 4D11C 2BO6A 1LZIA 2RJ0A 1ZI4A 5CQLX 1ZDGA 2Y4KA 5DDTA 3SX7A 1YP2A 4HO0A 1QGQA 4HO2A 1S4NA 3I0JA 1FR8A 3E26A 2FYBA 4ARWA 1OMZA 1H3MA 1H7FA 1JVDA 4UEGA 2UX8A 2FYAA 1SS9A 3U2TA
chains in the Genus database with same CATH superfamily
4Y62A 4B4MA 3V0LA 3U2UA 1H5SC 4KXOA 1W57A 1MP3A 3DUVA 1R82A 2Z86A 4FIYA 2VS3A 1R7XA 1YROB 4FRAA 2YCMA 3KIAA 1HJJA 3BCVA 4Y7VA 4HCQA 4D11A 3CGXA 1V82A 2JCKA 2NXVA 2Z87A 5J49A 4KC1A 1MC3A 2Y4JA 1V83A 4FRDA 3ZF8A 3I0KA 3OGZA 2AGDA 1VGUA 2O1GA 2VXMA 1G23A 2QGIA 2PGVA 1NHEB 4EE4A 1VH1A 4BMAA 5FU0A 1FOAA 1HV9A 4J18A 2AE7A 3V8YA 4MYBA 3TZTA 1OQMB 2RIZA 1MP4A 4B42A 3T7NA 1H5SA 2XWMA 5C1HA 3K8DA 3SXCA 2FFUA 2DPWA 4NAKA 1H7LA 2X60A 3RMVA 1JV1A 4LW6A 1XZ6A 3I0EA 2JCLA 4M4KA 1E5KA 5CQMX 2ZU7A 3R2WA 1R7TA 3IOHA 1PZYB 1H4CA 1S4OA 2J0AA 3CKVA 2D7IA 4MNDA 1VICA 2Y6PA 3D5NA 1NMMB 5AJOA 4CJ8A 4Y64A 5C3AA 3T7OA 4B2WA 2FYDB 1FG5N 5AJPA 3LW6A 1Z90A 4HG6A 2W0VA 1ZJ2A 1H5RA 5C1GA 4KT7A 2VS4A 2MZBA 2RJ9A 4P00A 1TW5A 2PX7A 2V0KA 4B5BA 5C4BA 3SXAA 3U0YA 4FROA 3SXBA 1PZTA 2OEFA 1FGGA 4Y6UA 3I0IX 2Y4LA 2ICXA 5CQOA 4K6RA 1OMXA 1TVYA 2WEEA 2RJ1A 1WT0A 5FTSA 3SX3A 2YQJA 4CVHA 1QG8A 3IOIA 1ZJ0A 2P72A 1ZJPA 2VFZA 4MIXA 1HJLA 2XMEA 3O3PA 4ECMA 1ZJOA 4Q7CA 4FRLA 3Q7UA 4FIXA 2VD4A 3OC9A 1H7TA 1FO8A 2JCJA 3ST8A 5CMIA 2AECA 1NWGB 4HO5A 2X65A 4FQWA 2XMHA 2I5KA 4E1KA 3CU0A 4DE7A 3ZGGA 3DK5A 1VZXA 2P6WA 2GGOA 4IRPA 3T7MA 5C4CA 4M2BA 3OH4A 2Y7AA 4B4GA 4KRVA 4KNXA 3SXDA 4HO9A 3OH2A 1ZCYA 3BRKX 2I5EA 3V90A 3SXEA 4FCUA 1G95A 1GQ9A 1LZ0A 1FR9A 4HO3A 3V0OA 1S4PA 3CKJA 3JTJA 1MP5A 1O23B 5IDSA 1WT3A 1G97A 4EE3A 1GWWA 2X5SA 5AJNA 3RSBA 3V0QA 4EE5A 1GQCA 1H5SD 1JVGA 4FRPA 2Q4JA 1GWVA 1ZI3A 4JISA 1ZCTA 3Q80A 3IOJA 4BQHA 3D98A 5DDVA 2AM3A 3U2WA 3PKQA 5I1FA 2AH9A 4Y63A 3PKPA 4NANA 4EVWA 4XWIA 3PNNA 3ZLLA 1ON8A 2V0HA 3GUEA 2V0LA 1VGWA 3F1YA 4AAWA 2FY7A 3I0GA 3OKRA 4AYJA 2FYCB 2YC3A 1JYKA 3U2VA 5IFYA 3USRA 3USQA 2WVKA 1H5TB 3JUKA 5FTVA 4LW3A 2O1FA 3CKQA 1G93A 5D92A 1H7EA 5C49A 1O0RA 2A8UA 2JCOA 1HM8A 4O6NA 3HL3A 5CQPA 4EEOA 4Y7TA 5FUHA 2I7BA 5C1LA 1VGZA 1JV3A 1ZJ1A 1O7QA 3V0MA 2AM5A 4CJBA 1G9RA 4YS8A 5CMFX 4FRMA 4GBPA 1ZJ3A 1LZ7A 4FRBA 2RJ4A 2XWLA 2QH5A 3R3IA 4G87A 2E8BA 1NF5B 1G3LA 1ZHJA 1JYLA 4C2SA 3FWWA 1IIMA 2RIXA 2VK9A 1NQIB 1LL3A 1VZUA 1YP4A 2P73A 5C4EA 1HM9A 4HO4A 2O1HA 2YESA 4HO6A 1GX4A 2E3DA 2VSHA 1ZI1A 2VS5A 1LL2A 1VM8A 3JUJA 2WVLA 1HM0A 3I0HA 4IRQA 3K8EA 2RIYA 1EYRA 2AESA 3ZGFA 1V84A 2WVMA 4KQLA 2RJ8A 5D91A 2Y4MA 3V0PA 1VPAA 1K4VA 4FCEA 2YQHA 4G3SA 5FYEA 4KPXA 2RITA 3CKOA 4ASJA 1QWJA 3I0CA 1I52A 4P02A 1ON6A 3E25A 3U2XA 3QVBA 2CU2A 1KWSA 4D48A 1YP3A 1WVCA 4KC4A 1GX0A 1G8OA 1R7UA 5BXCA 1IINA 1R7YA 2VSIA 3I0LA 1FXOA 1VZTA 1H7HA 5JQQA 5C3DA 3F1CA 4CJCA 2ICYA 3ZLKA 1NKHB 3FOQA 1H4EA 3SPTA 3OAMA 4D0TA 3POLA 3OH1A 3SX8A 2YC5A 4NAIA 4KPZA 5EJZA 5IDTA 1ZCVA 5FV9A 2RJ7A 4R7PA 2RJ5A 2D0JA 5CMHA 5C4DA 4KC2A 4AC3A 3V0NA 3U0XA 1H7QA 2C0NA 2PGYA 1FWYA 1H5SB 1TZFA 5CMGX 4B4BA 3DJ4A 5HS2A 4B3UA 2OI5A 4KNRA 4M28A 2V0JA 2GGQA 1LL0A 1INJA 2BO7A 1LVWA 3RMWA 1LZJA 4AYLA 4Y9XA 4EEAA 1FO9A 1WSZA 4M2AA 3EE5A 2OEGA 4Y7FA 1EZIA 1TW1A 1QGSA 4FREA 2FFVA 4HOCA 3SX5A 5EIYA 1WT2A 4B2XA 2V0IA 3CKNA 4FRQA 1H5TA 2WGZA 4L41C 5C38A 1ZIZA 1FZWA 5CQNX 5C8RA 4G3PA 1VH3A 1H5RB 2D7RA 2XWNA 1R81A 3OH0A 1W77A 5C4FA 1G2VA 4NALA 3OH3A 4Y7UA 5L6SA 1R80A 4Y7GA 4ASYA 3D8VA 5CMJA 3I0FA 1WT1A 5FU8A 2AM4A 1FGXA 2BO8A 1G1LA 1H7GA 5L6VA 1INIA 2RJ6A 2VXLA 2W0WA 5C47A 4D0ZA 2YQCA 2WAWA 2ZU9A 1H4DA 1O7OA 3Q4SA 4G3QA 1XHBA 2OI6A 1ZI5A 2A8WA 3V91A 2ZU8A 1ZDFA 4HO8A 3N9WA 3I0DA 2BO4A 2APCA 5C48A 4Y6NA 1R7VA 3SXGA 4ZDQA 4EEMA 1GA8A 2YQSA 1VGTA 1ZCUA 1G0RA 5EJ1A 2PA4A 4JD0A 2QKXA 4FRHA 2OI7A 4EEGA 5C36A 2J0BA 2WE9A 4DECA 5C3BA 2X5ZA 3V8ZA 1FXJA 3TQDA 1W55A 4DDZA 3NGWA 1FRWA 4D11C 2BO6A 1LZIA 2RJ0A 1ZI4A 5CQLX 1ZDGA 2Y4KA 5DDTA 3SX7A 1YP2A 4HO0A 1QGQA 4HO2A 1S4NA 3I0JA 1FR8A 3E26A 2FYBA 4ARWA 1OMZA 1H3MA 4O6MA 1H7FA 1JVDA 4UEGA 2UX8A 2FYAA 1SS9A 3U2TA
chains in the Genus database with same CATH topology
4Y62A 4B4MA 3V0LA 3U2UA 1H5SC 4KXOA 1W57A 1MP3A 3DUVA 1R82A 2Z86A 4FIYA 2VS3A 1R7XA 1YROB 4FRAA 2YCMA 3KIAA 1HJJA 3BCVA 4Y7VA 4HCQA 4D11A 3CGXA 1V82A 2JCKA 2NXVA 2Z87A 5J49A 4KC1A 1MC3A 2Y4JA 1V83A 4FRDA 3ZF8A 3I0KA 3OGZA 2AGDA 1VGUA 2O1GA 2VXMA 1G23A 2QGIA 2PGVA 1NHEB 4EE4A 1VH1A 4BMAA 5FU0A 1FOAA 1HV9A 4J18A 2AE7A 3V8YA 4MYBA 3TZTA 1OQMB 2RIZA 1MP4A 4B42A 3T7NA 1H5SA 2XWMA 5C1HA 3K8DA 3SXCA 2FFUA 2DPWA 4NAKA 1H7LA 2X60A 3RMVA 1JV1A 4LW6A 1XZ6A 3I0EA 2JCLA 4M4KA 1E5KA 5CQMX 2ZU7A 3R2WA 1R7TA 3IOHA 1PZYB 1H4CA 1S4OA 2J0AA 3CKVA 2D7IA 4MNDA 1VICA 2Y6PA 3D5NA 1NMMB 5AJOA 4CJ8A 4Y64A 5C3AA 3T7OA 4B2WA 2FYDB 1FG5N 5AJPA 3LW6A 1Z90A 4HG6A 2W0VA 1ZJ2A 1H5RA 5C1GA 4KT7A 2VS4A 2MZBA 2RJ9A 4P00A 1TW5A 2PX7A 2V0KA 4B5BA 5C4BA 3SXAA 3U0YA 4FROA 3SXBA 1PZTA 2OEFA 1FGGA 4Y6UA 3I0IX 2Y4LA 2ICXA 5CQOA 4K6RA 1OMXA 1TVYA 2WEEA 2RJ1A 1WT0A 5FTSA 3SX3A 2YQJA 4CVHA 1QG8A 3IOIA 1ZJ0A 2P72A 1ZJPA 2VFZA 4MIXA 1HJLA 2XMEA 3O3PA 4ECMA 1ZJOA 4Q7CA 4FRLA 3Q7UA 4FIXA 2VD4A 3OC9A 1H7TA 1FO8A 2JCJA 3ST8A 5CMIA 2AECA 1NWGB 4HO5A 2X65A 4FQWA 2XMHA 2I5KA 4E1KA 3CU0A 4DE7A 3ZGGA 3DK5A 1VZXA 2P6WA 2GGOA 4IRPA 3T7MA 5C4CA 4M2BA 3OH4A 2Y7AA 4B4GA 4KRVA 4KNXA 3SXDA 4HO9A 3OH2A 1ZCYA 3BRKX 2I5EA 3V90A 3SXEA 4FCUA 1G95A 1GQ9A 1LZ0A 1FR9A 4HO3A 3V0OA 1S4PA 3CKJA 3JTJA 1MP5A 1O23B 5IDSA 1WT3A 1G97A 4EE3A 1GWWA 2X5SA 5AJNA 3RSBA 3V0QA 4EE5A 1GQCA 1H5SD 1JVGA 4FRPA 2Q4JA 1GWVA 1ZI3A 4JISA 1ZCTA 3Q80A 3IOJA 4BQHA 3D98A 5DDVA 2AM3A 3U2WA 3PKQA 5I1FA 2AH9A 4Y63A 3PKPA 4NANA 4EVWA 4XWIA 3PNNA 3ZLLA 1ON8A 2V0HA 3GUEA 2V0LA 1VGWA 3F1YA 4AAWA 2FY7A 3I0GA 3OKRA 4AYJA 2FYCB 2YC3A 1JYKA 3U2VA 5IFYA 3USRA 3USQA 2WVKA 1H5TB 3JUKA 5FTVA 4LW3A 2O1FA 3CKQA 1G93A 5D92A 1H7EA 5C49A 1O0RA 2A8UA 2JCOA 1HM8A 4O6NA 3HL3A 5CQPA 4EEOA 4Y7TA 5FUHA 2I7BA 5C1LA 1VGZA 1JV3A 1ZJ1A 1O7QA 3V0MA 2AM5A 4CJBA 1G9RA 4YS8A 5CMFX 4FRMA 4GBPA 1ZJ3A 1LZ7A 4FRBA 2RJ4A 2XWLA 2QH5A 3R3IA 4G87A 2E8BA 1NF5B 1G3LA 1ZHJA 1JYLA 4C2SA 3FWWA 1IIMA 2RIXA 2VK9A 1NQIB 1LL3A 1VZUA 1YP4A 2P73A 5C4EA 1HM9A 4HO4A 2O1HA 2YESA 4HO6A 1GX4A 2E3DA 2VSHA 1ZI1A 2VS5A 1LL2A 1VM8A 3JUJA 2WVLA 1HM0A 3I0HA 4IRQA 3K8EA 2RIYA 1EYRA 2AESA 3ZGFA 1V84A 2WVMA 4KQLA 2RJ8A 5D91A 2Y4MA 3V0PA 1VPAA 1K4VA 4FCEA 2YQHA 4G3SA 5FYEA 4KPXA 2RITA 3CKOA 4ASJA 1QWJA 3I0CA 1I52A 4P02A 1ON6A 3E25A 3U2XA 3QVBA 2CU2A 1KWSA 4D48A 1YP3A 1WVCA 4KC4A 1GX0A 1G8OA 1R7UA 5BXCA 1IINA 1R7YA 2VSIA 3I0LA 1FXOA 1VZTA 1H7HA 5JQQA 5C3DA 3F1CA 4CJCA 2ICYA 3ZLKA 1NKHB 3FOQA 1H4EA 3SPTA 3OAMA 4D0TA 3POLA 3OH1A 3SX8A 2YC5A 4NAIA 4KPZA 5EJZA 5IDTA 1ZCVA 5FV9A 2RJ7A 4R7PA 2RJ5A 2D0JA 5CMHA 5C4DA 4KC2A 4AC3A 3V0NA 3U0XA 1H7QA 2C0NA 2PGYA 1FWYA 1H5SB 1TZFA 5CMGX 4B4BA 3DJ4A 5HS2A 4B3UA 2OI5A 4KNRA 4M28A 2V0JA 2GGQA 1LL0A 1INJA 2BO7A 1LVWA 3RMWA 1LZJA 4AYLA 4Y9XA 4EEAA 1FO9A 1WSZA 4M2AA 3EE5A 2OEGA 4Y7FA 1EZIA 1TW1A 1QGSA 4FREA 2FFVA 4HOCA 3SX5A 5EIYA 1WT2A 4B2XA 2V0IA 3CKNA 4FRQA 1H5TA 2WGZA 4L41C 5C38A 1ZIZA 1FZWA 5CQNX 5C8RA 4G3PA 1VH3A 1H5RB 2D7RA 2XWNA 1R81A 3OH0A 1W77A 5C4FA 1G2VA 4NALA 3OH3A 4Y7UA 5L6SA 1R80A 4Y7GA 4ASYA 3D8VA 5CMJA 3I0FA 1WT1A 5FU8A 2AM4A 1FGXA 2BO8A 1G1LA 1H7GA 5L6VA 1INIA 2RJ6A 2VXLA 2W0WA 5C47A 4D0ZA 2YQCA 2WAWA 2ZU9A 1H4DA 1O7OA 3Q4SA 4G3QA 1XHBA 2OI6A 1ZI5A 2A8WA 3V91A 2ZU8A 1ZDFA 4HO8A 3N9WA 3I0DA 2BO4A 2APCA 5C48A 4Y6NA 1R7VA 3SXGA 4ZDQA 4EEMA 1GA8A 2YQSA 1VGTA 1ZCUA 1G0RA 5EJ1A 2PA4A 4JD0A 2QKXA 4FRHA 2OI7A 4EEGA 5C36A 2J0BA 2WE9A 4DECA 5C3BA 2X5ZA 3V8ZA 1FXJA 3TQDA 1W55A 4DDZA 3NGWA 1FRWA 4D11C 2BO6A 1LZIA 2RJ0A 1ZI4A 5CQLX 1ZDGA 2Y4KA 5DDTA 3SX7A 1YP2A 4HO0A 1QGQA 4HO2A 1S4NA 3I0JA 1FR8A 3E26A 2FYBA 4ARWA 1OMZA 1H3MA 4O6MA 1H7FA 1JVDA 4UEGA 2UX8A 2FYAA 1SS9A 3U2TA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4Y62 A;  4B4M A;  3V0L A;  3U2U A;  1H5S C;  4KXO A;  1W57 A;  1MP3 A;  3DUV A;  1R82 A;  2Z86 A;  2VS3 A;  1R7X A;  1YRO B;  4FRA A;  2YCM A;  3KIA A;  1HJJ A;  3BCV A;  4Y7V A;  4HCQ A;  4D11 A;  3CGX A;  1V82 A;  2JCK A;  2NXV A;  2Z87 A;  5J49 A;  4KC1 A;  1MC3 A;  2Y4J A;  1V83 A;  4FRD A;  3ZF8 A;  3I0K A;  3OGZ A;  2AGD A;  1VGU A;  2O1G A;  2VXM A;  1G23 A;  2QGI A;  2PGV A;  1NHE B;  4EE4 A;  1VH1 A;  4BMA A;  5FU0 A;  1FOA A;  1HV9 A;  4J18 A;  2AE7 A;  3V8Y A;  4MYB A;  3TZT A;  1OQM B;  2RIZ A;  1MP4 A;  4B42 A;  3T7N A;  1H5S A;  2XWM A;  5C1H A;  3K8D A;  3SXC A;  2FFU A;  2DPW A;  4NAK A;  1H7L A;  2X60 A;  3RMV A;  1JV1 A;  4LW6 A;  1XZ6 A;  3I0E A;  2JCL A;  4M4K A;  1E5K A;  5CQM X;  2ZU7 A;  3R2W A;  1R7T A;  3IOH A;  1PZY B;  1H4C A;  1S4O A;  3CKV A;  2D7I A;  4MND A;  1VIC A;  2Y6P A;  3D5N A;  1NMM B;  5AJO A;  4CJ8 A;  4Y64 A;  5C3A A;  3T7O A;  4B2W A;  2FYD B;  1FG5 N;  5AJP A;  3LW6 A;  1Z90 A;  4HG6 A;  2W0V A;  1ZJ2 A;  1H5R A;  5C1G A;  4KT7 A;  2VS4 A;  2MZB A;  2RJ9 A;  4P00 A;  1TW5 A;  2PX7 A;  2V0K A;  4B5B A;  5C4B A;  3SXA A;  3U0Y A;  4FRO A;  3SXB A;  1PZT A;  2OEF A;  1FGG A;  4Y6U A;  3I0I X;  2Y4L A;  2ICX A;  5CQO A;  4K6R A;  1OMX A;  1TVY A;  2WEE A;  2RJ1 A;  1WT0 A;  5FTS A;  3SX3 A;  2YQJ A;  4CVH A;  1QG8 A;  3IOI A;  1ZJ0 A;  2P72 A;  1ZJP A;  2VFZ A;  1HJL A;  2XME A;  3O3P A;  4ECM A;  1ZJO A;  4FRL A;  3Q7U A;  2VD4 A;  3OC9 A;  1H7T A;  1FO8 A;  2JCJ A;  3ST8 A;  5CMI A;  2AEC A;  1NWG B;  4HO5 A;  2X65 A;  4FQW A;  2XMH A;  2I5K A;  4E1K A;  3CU0 A;  4DE7 A;  3ZGG A;  3DK5 A;  1VZX A;  2P6W A;  2GGO A;  4IRP A;  3T7M A;  5C4C A;  4M2B A;  3OH4 A;  2Y7A A;  4B4G A;  4KRV A;  4KNX A;  3SXD A;  4HO9 A;  3OH2 A;  1ZCY A;  3BRK X;  2I5E A;  3V90 A;  3SXE A;  4FCU A;  1G95 A;  1GQ9 A;  1LZ0 A;  1FR9 A;  4HO3 A;  3V0O A;  1S4P A;  3CKJ A;  3JTJ A;  1MP5 A;  1O23 B;  5IDS A;  1WT3 A;  1G97 A;  4EE3 A;  1GWW A;  2X5S A;  5AJN A;  3RSB A;  3V0Q A;  4EE5 A;  1GQC A;  1H5S D;  1JVG A;  4FRP A;  2Q4J A;  1GWV A;  1ZI3 A;  4JIS A;  1ZCT A;  3Q80 A;  3IOJ A;  4BQH A;  3D98 A;  5DDV A;  2AM3 A;  3U2W A;  3PKQ A;  5I1F A;  2AH9 A;  4Y63 A;  3PKP A;  4NAN A;  4EVW A;  4XWI A;  3PNN A;  3ZLL A;  1ON8 A;  2V0H A;  3GUE A;  2V0L A;  1VGW A;  3F1Y A;  4AAW A;  2FY7 A;  3I0G A;  3OKR A;  4AYJ A;  2FYC B;  2YC3 A;  1JYK A;  3U2V A;  5IFY A;  3USR A;  3USQ A;  2WVK A;  1H5T B;  3JUK A;  5FTV A;  4LW3 A;  2O1F A;  3CKQ A;  1G93 A;  5C49 A;  1H7E A;  1O0R A;  2A8U A;  2JCO A;  1HM8 A;  3HL3 A;  5CQP A;  4EEO A;  4Y7T A;  5FUH A;  2I7B A;  5C1L A;  1VGZ A;  1JV3 A;  1ZJ1 A;  1O7Q A;  3V0M A;  2AM5 A;  4CJB A;  1G9R A;  4YS8 A;  5CMF X;  4FRM A;  4GBP A;  1ZJ3 A;  1LZ7 A;  4FRB A;  2RJ4 A;  2XWL A;  2QH5 A;  3R3I A;  4G87 A;  2E8B A;  1NF5 B;  1G3L A;  1ZHJ A;  1JYL A;  4C2S A;  3FWW A;  1IIM A;  2RIX A;  1NQI B;  1LL3 A;  1VZU A;  1YP4 A;  2P73 A;  5C4E A;  1HM9 A;  4HO4 A;  2O1H A;  2YES A;  4HO6 A;  1GX4 A;  2E3D A;  2VSH A;  1ZI1 A;  2VS5 A;  1LL2 A;  1VM8 A;  3JUJ A;  2WVL A;  1HM0 A;  3I0H A;  4IRQ A;  3K8E A;  2RIY A;  1EYR A;  2AES A;  3ZGF A;  1V84 A;  2WVM A;  4KQL A;  2RJ8 A;  2Y4M A;  3V0P A;  1VPA A;  1K4V A;  4FCE A;  2YQH A;  4G3S A;  5FYE A;  4KPX A;  2RIT A;  3CKO A;  4ASJ A;  1QWJ A;  3I0C A;  1I52 A;  4P02 A;  1ON6 A;  3E25 A;  3U2X A;  3QVB A;  2CU2 A;  1KWS A;  4D48 A;  1YP3 A;  1WVC A;  4KC4 A;  1GX0 A;  1G8O A;  1R7U A;  5BXC A;  1IIN A;  1R7Y A;  2VSI A;  3I0L A;  1FXO A;  1VZT A;  1H7H A;  5JQQ A;  5C3D A;  3F1C A;  4CJC A;  2ICY A;  3ZLK A;  1NKH B;  3FOQ A;  1H4E A;  3SPT A;  3OAM A;  4D0T A;  3POL A;  3OH1 A;  3SX8 A;  2YC5 A;  4NAI A;  4KPZ A;  5EJZ A;  5IDT A;  1ZCV A;  5FV9 A;  2RJ7 A;  4R7P A;  2RJ5 A;  2D0J A;  5CMH A;  5C4D A;  4KC2 A;  4AC3 A;  3V0N A;  3U0X A;  1H7Q A;  2PGY A;  1FWY A;  1H5S B;  1TZF A;  5CMG X;  4B4B A;  3DJ4 A;  5HS2 A;  4B3U A;  2OI5 A;  4KNR A;  4M28 A;  2V0J A;  2GGQ A;  1LL0 A;  1INJ A;  2BO7 A;  1LVW A;  3RMW A;  1LZJ A;  4AYL A;  4Y9X A;  4EEA A;  1FO9 A;  1WSZ A;  4M2A A;  3EE5 A;  2OEG A;  4Y7F A;  1EZI A;  1TW1 A;  1QGS A;  4FRE A;  2FFV A;  4HOC A;  3SX5 A;  5EIY A;  1WT2 A;  4B2X A;  2V0I A;  3CKN A;  4FRQ A;  1H5T A;  2WGZ A;  4L41 C;  5C38 A;  1ZIZ A;  1FZW A;  5CQN X;  5C8R A;  4G3P A;  1VH3 A;  1H5R B;  2D7R A;  2XWN A;  1R81 A;  3OH0 A;  1W77 A;  5C4F A;  1G2V A;  4NAL A;  3OH3 A;  4Y7U A;  5L6S A;  1R80 A;  4Y7G A;  4ASY A;  3D8V A;  5CMJ A;  3I0F A;  1WT1 A;  5FU8 A;  2AM4 A;  1FGX A;  2BO8 A;  1G1L A;  1H7G A;  5L6V A;  1INI A;  2RJ6 A;  2VXL A;  2W0W A;  5C47 A;  4D0Z A;  2YQC A;  2WAW A;  2ZU9 A;  1H4D A;  1O7O A;  3Q4S A;  4G3Q A;  1XHB A;  2OI6 A;  1ZI5 A;  2A8W A;  3V91 A;  2ZU8 A;  1ZDF A;  4HO8 A;  3N9W A;  3I0D A;  2BO4 A;  2APC A;  5C48 A;  4Y6N A;  1R7V A;  3SXG A;  4ZDQ A;  4EEM A;  1GA8 A;  2YQS A;  1VGT A;  1ZCU A;  1G0R A;  5EJ1 A;  2PA4 A;  4JD0 A;  2QKX A;  4FRH A;  2OI7 A;  4EEG A;  5C36 A;  2WE9 A;  4DEC A;  5C3B A;  2X5Z A;  3V8Z A;  1FXJ A;  3TQD A;  1W55 A;  4DDZ A;  3NGW A;  1FRW A;  4D11 C;  2BO6 A;  1LZI A;  2RJ0 A;  1ZI4 A;  5CQL X;  1ZDG A;  2Y4K A;  5DDT A;  3SX7 A;  1YP2 A;  4HO0 A;  1QGQ A;  4HO2 A;  1S4N A;  3I0J A;  1FR8 A;  3E26 A;  2FYB A;  4ARW A;  1OMZ A;  1H3M A;  1H7F A;  1JVD A;  4UEG A;  2UX8 A;  2FYA A;  1SS9 A;  3U2T A; 
#chains in the Genus database with same CATH topology
 4Y62 A;  4B4M A;  3V0L A;  3U2U A;  1H5S C;  4KXO A;  1W57 A;  1MP3 A;  3DUV A;  1R82 A;  2Z86 A;  4FIY A;  2VS3 A;  1R7X A;  1YRO B;  4FRA A;  2YCM A;  3KIA A;  1HJJ A;  3BCV A;  4Y7V A;  4HCQ A;  4D11 A;  3CGX A;  1V82 A;  2JCK A;  2NXV A;  2Z87 A;  5J49 A;  4KC1 A;  1MC3 A;  2Y4J A;  1V83 A;  4FRD A;  3ZF8 A;  3I0K A;  3OGZ A;  2AGD A;  1VGU A;  2O1G A;  2VXM A;  1G23 A;  2QGI A;  2PGV A;  1NHE B;  4EE4 A;  1VH1 A;  4BMA A;  5FU0 A;  1FOA A;  1HV9 A;  4J18 A;  2AE7 A;  3V8Y A;  4MYB A;  3TZT A;  1OQM B;  2RIZ A;  1MP4 A;  4B42 A;  3T7N A;  1H5S A;  2XWM A;  5C1H A;  3K8D A;  3SXC A;  2FFU A;  2DPW A;  4NAK A;  1H7L A;  2X60 A;  3RMV A;  1JV1 A;  4LW6 A;  1XZ6 A;  3I0E A;  2JCL A;  4M4K A;  1E5K A;  5CQM X;  2ZU7 A;  3R2W A;  1R7T A;  3IOH A;  1PZY B;  1H4C A;  1S4O A;  2J0A A;  3CKV A;  2D7I A;  4MND A;  1VIC A;  2Y6P A;  3D5N A;  1NMM B;  5AJO A;  4CJ8 A;  4Y64 A;  5C3A A;  3T7O A;  4B2W A;  2FYD B;  1FG5 N;  5AJP A;  3LW6 A;  1Z90 A;  4HG6 A;  2W0V A;  1ZJ2 A;  1H5R A;  5C1G A;  4KT7 A;  2VS4 A;  2MZB A;  2RJ9 A;  4P00 A;  1TW5 A;  2PX7 A;  2V0K A;  4B5B A;  5C4B A;  3SXA A;  3U0Y A;  4FRO A;  3SXB A;  1PZT A;  2OEF A;  1FGG A;  4Y6U A;  3I0I X;  2Y4L A;  2ICX A;  5CQO A;  4K6R A;  1OMX A;  1TVY A;  2WEE A;  2RJ1 A;  1WT0 A;  5FTS A;  3SX3 A;  2YQJ A;  4CVH A;  1QG8 A;  3IOI A;  1ZJ0 A;  2P72 A;  1ZJP A;  2VFZ A;  4MIX A;  1HJL A;  2XME A;  3O3P A;  4ECM A;  1ZJO A;  4Q7C A;  4FRL A;  3Q7U A;  4FIX A;  2VD4 A;  3OC9 A;  1H7T A;  1FO8 A;  2JCJ A;  3ST8 A;  5CMI A;  2AEC A;  1NWG B;  4HO5 A;  2X65 A;  4FQW A;  2XMH A;  2I5K A;  4E1K A;  3CU0 A;  4DE7 A;  3ZGG A;  3DK5 A;  1VZX A;  2P6W A;  2GGO A;  4IRP A;  3T7M A;  5C4C A;  4M2B A;  3OH4 A;  2Y7A A;  4B4G A;  4KRV A;  4KNX A;  3SXD A;  4HO9 A;  3OH2 A;  1ZCY A;  3BRK X;  2I5E A;  3V90 A;  3SXE A;  4FCU A;  1G95 A;  1GQ9 A;  1LZ0 A;  1FR9 A;  4HO3 A;  3V0O A;  1S4P A;  3CKJ A;  3JTJ A;  1MP5 A;  1O23 B;  5IDS A;  1WT3 A;  1G97 A;  4EE3 A;  1GWW A;  2X5S A;  5AJN A;  3RSB A;  3V0Q A;  4EE5 A;  1GQC A;  1H5S D;  1JVG A;  4FRP A;  2Q4J A;  1GWV A;  1ZI3 A;  4JIS A;  1ZCT A;  3Q80 A;  3IOJ A;  4BQH A;  3D98 A;  5DDV A;  2AM3 A;  3U2W A;  3PKQ A;  5I1F A;  2AH9 A;  4Y63 A;  3PKP A;  4NAN A;  4EVW A;  4XWI A;  3PNN A;  3ZLL A;  1ON8 A;  2V0H A;  3GUE A;  2V0L A;  1VGW A;  3F1Y A;  4AAW A;  2FY7 A;  3I0G A;  3OKR A;  4AYJ A;  2FYC B;  2YC3 A;  1JYK A;  3U2V A;  5IFY A;  3USR A;  3USQ A;  2WVK A;  1H5T B;  3JUK A;  5FTV A;  4LW3 A;  2O1F A;  3CKQ A;  1G93 A;  5D92 A;  1H7E A;  5C49 A;  1O0R A;  2A8U A;  2JCO A;  1HM8 A;  4O6N A;  3HL3 A;  5CQP A;  4EEO A;  4Y7T A;  5FUH A;  2I7B A;  5C1L A;  1VGZ A;  1JV3 A;  1ZJ1 A;  1O7Q A;  3V0M A;  2AM5 A;  4CJB A;  1G9R A;  4YS8 A;  5CMF X;  4FRM A;  4GBP A;  1ZJ3 A;  1LZ7 A;  4FRB A;  2RJ4 A;  2XWL A;  2QH5 A;  3R3I A;  4G87 A;  2E8B A;  1NF5 B;  1G3L A;  1ZHJ A;  1JYL A;  4C2S A;  3FWW A;  1IIM A;  2RIX A;  2VK9 A;  1NQI B;  1LL3 A;  1VZU A;  1YP4 A;  2P73 A;  5C4E A;  1HM9 A;  4HO4 A;  2O1H A;  2YES A;  4HO6 A;  1GX4 A;  2E3D A;  2VSH A;  1ZI1 A;  2VS5 A;  1LL2 A;  1VM8 A;  3JUJ A;  2WVL A;  1HM0 A;  3I0H A;  4IRQ A;  3K8E A;  2RIY A;  1EYR A;  2AES A;  3ZGF A;  1V84 A;  2WVM A;  4KQL A;  2RJ8 A;  5D91 A;  2Y4M A;  3V0P A;  1VPA A;  1K4V A;  4FCE A;  2YQH A;  4G3S A;  5FYE A;  4KPX A;  2RIT A;  3CKO A;  4ASJ A;  1QWJ A;  3I0C A;  1I52 A;  4P02 A;  1ON6 A;  3E25 A;  3U2X A;  3QVB A;  2CU2 A;  1KWS A;  4D48 A;  1YP3 A;  1WVC A;  4KC4 A;  1GX0 A;  1G8O A;  1R7U A;  5BXC A;  1IIN A;  1R7Y A;  2VSI A;  3I0L A;  1FXO A;  1VZT A;  1H7H A;  5JQQ A;  5C3D A;  3F1C A;  4CJC A;  2ICY A;  3ZLK A;  1NKH B;  3FOQ A;  1H4E A;  3SPT A;  3OAM A;  4D0T A;  3POL A;  3OH1 A;  3SX8 A;  2YC5 A;  4NAI A;  4KPZ A;  5EJZ A;  5IDT A;  1ZCV A;  5FV9 A;  2RJ7 A;  4R7P A;  2RJ5 A;  2D0J A;  5CMH A;  5C4D A;  4KC2 A;  4AC3 A;  3V0N A;  3U0X A;  1H7Q A;  2C0N A;  2PGY A;  1FWY A;  1H5S B;  1TZF A;  5CMG X;  4B4B A;  3DJ4 A;  5HS2 A;  4B3U A;  2OI5 A;  4KNR A;  4M28 A;  2V0J A;  2GGQ A;  1LL0 A;  1INJ A;  2BO7 A;  1LVW A;  3RMW A;  1LZJ A;  4AYL A;  4Y9X A;  4EEA A;  1FO9 A;  1WSZ A;  4M2A A;  3EE5 A;  2OEG A;  4Y7F A;  1EZI A;  1TW1 A;  1QGS A;  4FRE A;  2FFV A;  4HOC A;  3SX5 A;  5EIY A;  1WT2 A;  4B2X A;  2V0I A;  3CKN A;  4FRQ A;  1H5T A;  2WGZ A;  4L41 C;  5C38 A;  1ZIZ A;  1FZW A;  5CQN X;  5C8R A;  4G3P A;  1VH3 A;  1H5R B;  2D7R A;  2XWN A;  1R81 A;  3OH0 A;  1W77 A;  5C4F A;  1G2V A;  4NAL A;  3OH3 A;  4Y7U A;  5L6S A;  1R80 A;  4Y7G A;  4ASY A;  3D8V A;  5CMJ A;  3I0F A;  1WT1 A;  5FU8 A;  2AM4 A;  1FGX A;  2BO8 A;  1G1L A;  1H7G A;  5L6V A;  1INI A;  2RJ6 A;  2VXL A;  2W0W A;  5C47 A;  4D0Z A;  2YQC A;  2WAW A;  2ZU9 A;  1H4D A;  1O7O A;  3Q4S A;  4G3Q A;  1XHB A;  2OI6 A;  1ZI5 A;  2A8W A;  3V91 A;  2ZU8 A;  1ZDF A;  4HO8 A;  3N9W A;  3I0D A;  2BO4 A;  2APC A;  5C48 A;  4Y6N A;  1R7V A;  3SXG A;  4ZDQ A;  4EEM A;  1GA8 A;  2YQS A;  1VGT A;  1ZCU A;  1G0R A;  5EJ1 A;  2PA4 A;  4JD0 A;  2QKX A;  4FRH A;  2OI7 A;  4EEG A;  5C36 A;  2J0B A;  2WE9 A;  4DEC A;  5C3B A;  2X5Z A;  3V8Z A;  1FXJ A;  3TQD A;  1W55 A;  4DDZ A;  3NGW A;  1FRW A;  4D11 C;  2BO6 A;  1LZI A;  2RJ0 A;  1ZI4 A;  5CQL X;  1ZDG A;  2Y4K A;  5DDT A;  3SX7 A;  1YP2 A;  4HO0 A;  1QGQ A;  4HO2 A;  1S4N A;  3I0J A;  1FR8 A;  3E26 A;  2FYB A;  4ARW A;  1OMZ A;  1H3M A;  4O6M A;  1H7F A;  1JVD A;  4UEG A;  2UX8 A;  2FYA A;  1SS9 A;  3U2T A; 
#chains in the Genus database with same CATH homology
 4Y62 A;  4B4M A;  3V0L A;  3U2U A;  1H5S C;  4KXO A;  1W57 A;  1MP3 A;  3DUV A;  1R82 A;  2Z86 A;  4FIY A;  2VS3 A;  1R7X A;  1YRO B;  4FRA A;  2YCM A;  3KIA A;  1HJJ A;  3BCV A;  4Y7V A;  4HCQ A;  4D11 A;  3CGX A;  1V82 A;  2JCK A;  2NXV A;  2Z87 A;  5J49 A;  4KC1 A;  1MC3 A;  2Y4J A;  1V83 A;  4FRD A;  3ZF8 A;  3I0K A;  3OGZ A;  2AGD A;  1VGU A;  2O1G A;  2VXM A;  1G23 A;  2QGI A;  2PGV A;  1NHE B;  4EE4 A;  1VH1 A;  4BMA A;  5FU0 A;  1FOA A;  1HV9 A;  4J18 A;  2AE7 A;  3V8Y A;  4MYB A;  3TZT A;  1OQM B;  2RIZ A;  1MP4 A;  4B42 A;  3T7N A;  1H5S A;  2XWM A;  5C1H A;  3K8D A;  3SXC A;  2FFU A;  2DPW A;  4NAK A;  1H7L A;  2X60 A;  3RMV A;  1JV1 A;  4LW6 A;  1XZ6 A;  3I0E A;  2JCL A;  4M4K A;  1E5K A;  5CQM X;  2ZU7 A;  3R2W A;  1R7T A;  3IOH A;  1PZY B;  1H4C A;  1S4O A;  2J0A A;  3CKV A;  2D7I A;  4MND A;  1VIC A;  2Y6P A;  3D5N A;  1NMM B;  5AJO A;  4CJ8 A;  4Y64 A;  5C3A A;  3T7O A;  4B2W A;  2FYD B;  1FG5 N;  5AJP A;  3LW6 A;  1Z90 A;  4HG6 A;  2W0V A;  1ZJ2 A;  1H5R A;  5C1G A;  4KT7 A;  2VS4 A;  2MZB A;  2RJ9 A;  4P00 A;  1TW5 A;  2PX7 A;  2V0K A;  4B5B A;  5C4B A;  3SXA A;  3U0Y A;  4FRO A;  3SXB A;  1PZT A;  2OEF A;  1FGG A;  4Y6U A;  3I0I X;  2Y4L A;  2ICX A;  5CQO A;  4K6R A;  1OMX A;  1TVY A;  2WEE A;  2RJ1 A;  1WT0 A;  5FTS A;  3SX3 A;  2YQJ A;  4CVH A;  1QG8 A;  3IOI A;  1ZJ0 A;  2P72 A;  1ZJP A;  2VFZ A;  4MIX A;  1HJL A;  2XME A;  3O3P A;  4ECM A;  1ZJO A;  4Q7C A;  4FRL A;  3Q7U A;  4FIX A;  2VD4 A;  3OC9 A;  1H7T A;  1FO8 A;  2JCJ A;  3ST8 A;  5CMI A;  2AEC A;  1NWG B;  4HO5 A;  2X65 A;  4FQW A;  2XMH A;  2I5K A;  4E1K A;  3CU0 A;  4DE7 A;  3ZGG A;  3DK5 A;  1VZX A;  2P6W A;  2GGO A;  4IRP A;  3T7M A;  5C4C A;  4M2B A;  3OH4 A;  2Y7A A;  4B4G A;  4KRV A;  4KNX A;  3SXD A;  4HO9 A;  3OH2 A;  1ZCY A;  3BRK X;  2I5E A;  3V90 A;  3SXE A;  4FCU A;  1G95 A;  1GQ9 A;  1LZ0 A;  1FR9 A;  4HO3 A;  3V0O A;  1S4P A;  3CKJ A;  3JTJ A;  1MP5 A;  1O23 B;  5IDS A;  1WT3 A;  1G97 A;  4EE3 A;  1GWW A;  2X5S A;  5AJN A;  3RSB A;  3V0Q A;  4EE5 A;  1GQC A;  1H5S D;  1JVG A;  4FRP A;  2Q4J A;  1GWV A;  1ZI3 A;  4JIS A;  1ZCT A;  3Q80 A;  3IOJ A;  4BQH A;  3D98 A;  5DDV A;  2AM3 A;  3U2W A;  3PKQ A;  5I1F A;  2AH9 A;  4Y63 A;  3PKP A;  4NAN A;  4EVW A;  4XWI A;  3PNN A;  3ZLL A;  1ON8 A;  2V0H A;  3GUE A;  2V0L A;  1VGW A;  3F1Y A;  4AAW A;  2FY7 A;  3I0G A;  3OKR A;  4AYJ A;  2FYC B;  2YC3 A;  1JYK A;  3U2V A;  5IFY A;  3USR A;  3USQ A;  2WVK A;  1H5T B;  3JUK A;  5FTV A;  4LW3 A;  2O1F A;  3CKQ A;  1G93 A;  5D92 A;  1H7E A;  5C49 A;  1O0R A;  2A8U A;  2JCO A;  1HM8 A;  4O6N A;  3HL3 A;  5CQP A;  4EEO A;  4Y7T A;  5FUH A;  2I7B A;  5C1L A;  1VGZ A;  1JV3 A;  1ZJ1 A;  1O7Q A;  3V0M A;  2AM5 A;  4CJB A;  1G9R A;  4YS8 A;  5CMF X;  4FRM A;  4GBP A;  1ZJ3 A;  1LZ7 A;  4FRB A;  2RJ4 A;  2XWL A;  2QH5 A;  3R3I A;  4G87 A;  2E8B A;  1NF5 B;  1G3L A;  1ZHJ A;  1JYL A;  4C2S A;  3FWW A;  1IIM A;  2RIX A;  2VK9 A;  1NQI B;  1LL3 A;  1VZU A;  1YP4 A;  2P73 A;  5C4E A;  1HM9 A;  4HO4 A;  2O1H A;  2YES A;  4HO6 A;  1GX4 A;  2E3D A;  2VSH A;  1ZI1 A;  2VS5 A;  1LL2 A;  1VM8 A;  3JUJ A;  2WVL A;  1HM0 A;  3I0H A;  4IRQ A;  3K8E A;  2RIY A;  1EYR A;  2AES A;  3ZGF A;  1V84 A;  2WVM A;  4KQL A;  2RJ8 A;  5D91 A;  2Y4M A;  3V0P A;  1VPA A;  1K4V A;  4FCE A;  2YQH A;  4G3S A;  5FYE A;  4KPX A;  2RIT A;  3CKO A;  4ASJ A;  1QWJ A;  3I0C A;  1I52 A;  4P02 A;  1ON6 A;  3E25 A;  3U2X A;  3QVB A;  2CU2 A;  1KWS A;  4D48 A;  1YP3 A;  1WVC A;  4KC4 A;  1GX0 A;  1G8O A;  1R7U A;  5BXC A;  1IIN A;  1R7Y A;  2VSI A;  3I0L A;  1FXO A;  1VZT A;  1H7H A;  5JQQ A;  5C3D A;  3F1C A;  4CJC A;  2ICY A;  3ZLK A;  1NKH B;  3FOQ A;  1H4E A;  3SPT A;  3OAM A;  4D0T A;  3POL A;  3OH1 A;  3SX8 A;  2YC5 A;  4NAI A;  4KPZ A;  5EJZ A;  5IDT A;  1ZCV A;  5FV9 A;  2RJ7 A;  4R7P A;  2RJ5 A;  2D0J A;  5CMH A;  5C4D A;  4KC2 A;  4AC3 A;  3V0N A;  3U0X A;  1H7Q A;  2C0N A;  2PGY A;  1FWY A;  1H5S B;  1TZF A;  5CMG X;  4B4B A;  3DJ4 A;  5HS2 A;  4B3U A;  2OI5 A;  4KNR A;  4M28 A;  2V0J A;  2GGQ A;  1LL0 A;  1INJ A;  2BO7 A;  1LVW A;  3RMW A;  1LZJ A;  4AYL A;  4Y9X A;  4EEA A;  1FO9 A;  1WSZ A;  4M2A A;  3EE5 A;  2OEG A;  4Y7F A;  1EZI A;  1TW1 A;  1QGS A;  4FRE A;  2FFV A;  4HOC A;  3SX5 A;  5EIY A;  1WT2 A;  4B2X A;  2V0I A;  3CKN A;  4FRQ A;  1H5T A;  2WGZ A;  4L41 C;  5C38 A;  1ZIZ A;  1FZW A;  5CQN X;  5C8R A;  4G3P A;  1VH3 A;  1H5R B;  2D7R A;  2XWN A;  1R81 A;  3OH0 A;  1W77 A;  5C4F A;  1G2V A;  4NAL A;  3OH3 A;  4Y7U A;  5L6S A;  1R80 A;  4Y7G A;  4ASY A;  3D8V A;  5CMJ A;  3I0F A;  1WT1 A;  5FU8 A;  2AM4 A;  1FGX A;  2BO8 A;  1G1L A;  1H7G A;  5L6V A;  1INI A;  2RJ6 A;  2VXL A;  2W0W A;  5C47 A;  4D0Z A;  2YQC A;  2WAW A;  2ZU9 A;  1H4D A;  1O7O A;  3Q4S A;  4G3Q A;  1XHB A;  2OI6 A;  1ZI5 A;  2A8W A;  3V91 A;  2ZU8 A;  1ZDF A;  4HO8 A;  3N9W A;  3I0D A;  2BO4 A;  2APC A;  5C48 A;  4Y6N A;  1R7V A;  3SXG A;  4ZDQ A;  4EEM A;  1GA8 A;  2YQS A;  1VGT A;  1ZCU A;  1G0R A;  5EJ1 A;  2PA4 A;  4JD0 A;  2QKX A;  4FRH A;  2OI7 A;  4EEG A;  5C36 A;  2J0B A;  2WE9 A;  4DEC A;  5C3B A;  2X5Z A;  3V8Z A;  1FXJ A;  3TQD A;  1W55 A;  4DDZ A;  3NGW A;  1FRW A;  4D11 C;  2BO6 A;  1LZI A;  2RJ0 A;  1ZI4 A;  5CQL X;  1ZDG A;  2Y4K A;  5DDT A;  3SX7 A;  1YP2 A;  4HO0 A;  1QGQ A;  4HO2 A;  1S4N A;  3I0J A;  1FR8 A;  3E26 A;  2FYB A;  4ARW A;  1OMZ A;  1H3M A;  4O6M A;  1H7F A;  1JVD A;  4UEG A;  2UX8 A;  2FYA A;  1SS9 A;  3U2T A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...