4ASYA

Pseudomonas aeruginosa rmla in complex with allosteric inhibitor
Total Genus 95
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
95
sequence length
293
structure length
293
Chain Sequence
MKRKGIILAGGSGTRLHPATLAISKQLLPVYDKPMIYYPLSTLMLAGIREILIISTPQDTPRFQQLLGDGSNWGLDLQYAVQPSPDGLAQAFLIGESFIGNDLSALVLGDNLYYGHDFHELLGSASQRQTGASVFAYHVLDPERYGVVEFDQGGKAISLEEKPLEPKSNYAVTGLYFYDQQVVDIARDLKPSPRGELEITDVNRAYLERGQLSVEIMGRGYAWLDTGTHDSLLEAGQFIATLENRQGLKVACPEEIAYRQKWIDAAQLEKLAAPLAKNGYGQYLKRLLTETVY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords GLUCOSE-1-PHOSPHATE THYMIDYLYLTRANSFERASE
publication title Allosteric competitive inhibitors of the glucose-1-phosphate thymidylyltransferase (RmlA) from Pseudomonas aeruginosa.
pubmed doi rcsb
source organism Pseudomonas aeruginosa
total genus 95
structure length 293
sequence length 293
chains with identical sequence B, C, D
ec nomenclature ec 2.7.7.74: 1L-myo-inositol 1-phosphate cytidylyltransferase.
pdb deposition date 2012-05-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00483 NTP_transferase Nucleotidyl transferase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.550.10 Alpha Beta Alpha-Beta Complex Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A 4asyA00
1FGXA 1FXJA 4K6RA 3OH2A 3OH0A 2RIXA 1NMMB 1G9RA 4D0TA 1O0RA 3OH3A 1QGQA 2D7IA 1NHEB 3T7NA 4LW3A 1V83A 1EZIA 4KPXA 1O7QA 1H7GA 1HM0A 4FRLA 1JVDA 1ZJ0A 2X5ZA 2RJ0A 3JUKA 1VGZA 2FFVA 2RJ1A 4EE5A 3IOJA 3I0FA 4KXOA 1FR8A 4ARWA 1G93A 1VZXA 2Y7AA 5C4BA 1G97A 1ON8A 1G2VA 4MYBA 1V84A 1WT1A 2GGOA 4KC1A 2PA4A 5C3AA 3USQA 2A8UA 1QWJA 4C2SA 1TW5A 2YC3A 3D8VA 2RITA 5J49A 4Y7UA 4GBPA 1YROB 4FRAA 4NANA 2BO7A 1LVWA 3BCVA 5CQNX 4ZDQA 3U2WA 1HM9A 1WT3A 1W77A 2OI6A 4EEOA 2JCJA 1HV9A 3JUJA 3IOIA 1W55A 2VD4A 1INJA 1ZI1A 3SXBA 1G3LA 2UX8A 3F1YA 2V0JA 2WVLA 3E25A 2I5KA 2ZU7A 4EEGA 2RIYA 2V0HA 5C4EA 2V0LA 4AYLA 3U2VA 1H7EA 1VZUA 3SXAA 1VGWA 1YP4A 2RJ6A 3ST8A 2FYCB 1PZYB 3FOQA 4HCQA 2O1GA 1G23A 2P6WA 2JCOA 1H5SB 1H5RA 3PKQA 3I0GA 1LL3A 2FY7A 1R7YA 2Y4KA 1FR9A 2WVMA 2P72A 2AH9A 1G8OA 1VZTA 3TQDA 2WGZA 1OMXA 1NKHB 4FCEA 1TW1A 5CQOA 2GGQA 4G3SA 4AC3A 3I0KA 2NXVA 3R3IA 2X65A 4NALA 1H5TA 2OEGA 4B4MA 1LZIA 2V0KA 2Y4JA 4UEGA 4HO4A 1NWGB 3RMWA 3T7MA 1ZCVA 3ZLKA 1WVCA 4FREA 4KT7A 2QH5A 3K8EA 4NAKA 1H5RB 1VPAA 1JVGA 1NF5B 3JTJA 4L41C 1YP2A 4KPZA 2RJ8A 4LW6A 1XHBA 1QGSA 1ZJ2A 3OH1A 3V0PA 1LZJA 2JCLA 1XZ6A 3U0YA 3ZGFA 5C4DA 1ZJ1A 2AM5A 4KC4A 1S4OA 1H5TB 4J18A 4HO9A 4D11A 1KWSA 1FXOA 3F1CA 3SX8A 1R7XA 4EE4A 4B3UA 3QVBA 2WVKA 3T7OA 1MP4A 4KNRA 4IRQA 5C36A 5FYEA 1H7FA 1SS9A 3O3PA 4Y9XA 1ZHJA 2I7BA 2PGVA 4HO8A 1FOAA 5C1GA 3V91A 5FTSA 3I0HA 2Y6PA 3DJ4A 1IINA 4G3PA 5HS2A 3RMVA 2AGDA 2OI5A 2BO8A 3I0CA 3K8DA 5C38A 2BO4A 4Y62A 4Y7TA 1FGGA 2O1FA 1MP5A 5IFYA 4JISA 2WEEA 4M2AA 3OC9A 1MC3A 3D98A 3ZGGA 3CKOA 1S4PA 2O1HA 1JV3A 1LZ7A 1I52A 3LW6A 4Y63A 2AM3A 3Q7UA 1GA8A 5AJOA 4D11C 4FRBA 4ASYA 3SX7A 3I0LA 4R7PA 4KNXA 1ZJ3A 1HM8A 4HO3A 5FU0A 1VH3A 1GX4A 5CQMX 4IRPA 1R80A 3POLA 5FUHA 2VS5A 3ZLLA 4HO5A 2VSHA 4Y7GA 3BRKX 4Y7FA 5IDTA 5C4CA 5FV9A 3U2TA 3SXGA 4CVHA 3PKPA 4M4KA 4EEMA 5CMHA 4DDZA 4DECA 5BXCA 2A8WA 4EE3A 1PZTA 1ZIZA 1FZWA 2ICXA 2RJ5A 1ZJPA 4M2BA 4CJCA 2ICYA 3V8YA 3EE5A 1LL0A 4B2WA 1WSZA 4BMAA 1FO9A 1ZJOA 4KC2A 4B42A 2D7RA 1VH1A 1OMZA 2QGIA 2VS4A 1GWVA 2DPWA 2XWLA 3OGZA 3PNNA 1S4NA 5C47A 1JYKA 1G95A 1ZCTA 4B2XA 3U2UA 2XWNA 1IIMA 4Y6UA 5AJNA 4P00A 1FO8A 3E26A 4AAWA 2VSIA 2ZU9A 3CKQA 1ZDGA 4JD0A 4B4GA 4BQHA 1TZFA 2ZU8A 4EEAA 5I1FA 2APCA 3CKJA 2FFUA 5CMJA 3IOHA 3SX3A 1ZDFA 1ZCYA 2QKXA 1LZ0A 3OAMA 5DDVA 4FRQA 1R82A 5CMGX 3CGXA 1VGTA 2P73A 2VS3A 3D5NA 1R7VA 3CU0A 2VXLA 1ZI3A 3SX5A 4D0ZA 5EJ1A 1G1LA 4XWIA 5DDTA 1K4VA 2OEFA 1VICA 2YQJA 2Y4MA 4B5BA 2E8BA 1FG5N 2E3DA 1H7LA 1EYRA 4AYJA 2BO6A 3OKRA 3V0OA 5C48A 3Q4SA 4P02A 1ZI4A 4MNDA 2YQHA 4Y6NA 3ZF8A 1H7QA 1ON6A 1JV1A 1WT2A 5AJPA 2CU2A 4FQWA 3V8ZA 5IDSA 2RJ4A 3GUEA 4B4BA 3U0XA 3Q80A 3R2WA 4FRMA 2XWMA 1R7UA 2XMHA 2D0JA 2I5EA 1H5SD 5C1LA 4KRVA 4CJBA 1Z90A 4FROA 2YESA 1YP3A 1H5SA 2FYAA 3I0JA 3OH4A 2V0IA 1INIA 5L6SA 4FRPA 1GQCA 1NQIB 3KIAA 4HG6A 4YS8A 3NGWA 3I0IX 1OQMB 1LL2A 5CMIA 5C3BA 4Y7VA 3V0QA 2FYBA 2X5SA 3V0MA 4FRDA 4DE7A 4Y64A 1FWYA 2JCKA 1HJJA 3USRA 5CQLX 3V0LA 4KQLA 4M28A 1V82A 4ASJA 1GQ9A 5C4FA 2RJ9A 3I0EA 3CKVA 1VM8A 4ECMA 5C49A 3U2XA 5FTVA 1JYLA 1MP3A 2YQSA 2FYDB 4NAIA 5C1HA 2WAWA 2Z87A 3SXEA 3V90A 2RIZA 5L6VA 4FCUA 4D48A 2MZBA 2YCMA 5EJZA 5C3DA 2Z86A 1W57A 1FRWA 3FWWA 5CMFX 1WT0A 4HOCA 1TVYA 1H5SC 3HL3A 2VXMA 3V0NA 5CQPA 3CKNA 4G87A 2W0WA 2WE9A 2AECA 2X60A 1VGUA 4EVWA 3DUVA 2Q4JA 3I0DA 2YC5A 2YQCA 1H4DA 1R81A 3RSBA 1G0RA 2VFZA 1H4EA 3TZTA 1ZI5A 2PX7A 2RJ7A 4G3QA 1R7TA 2W0VA 3N9WA 1HJLA 1H7TA 4E1KA 1QG8A 2AE7A 3SXCA 3SPTA 2AESA 4HO2A 1O7OA 4HO0A 1GWWA 2XMEA 1E5KA 3SXDA 4HO6A 1H3MA 4CJ8A 1H7HA 5JQQA 2OI7A 1ZCUA 2AM4A 4FRHA 5C8RA 3DK5A 1GX0A 1H4CA 5FU8A 2PGYA 2Y4LA 1O23B 5EIYA
chains in the Genus database with same CATH superfamily
1FGXA 1FXJA 4K6RA 3OH2A 3OH0A 2RIXA 1NMMB 1G9RA 4D0TA 1O0RA 3OH3A 1QGQA 2D7IA 1NHEB 3T7NA 4LW3A 1V83A 1EZIA 4KPXA 1O7QA 1H7GA 2J0BA 1HM0A 2C0NA 1JVDA 1ZJ0A 4FRLA 2X5ZA 2RJ0A 3JUKA 1VGZA 2FFVA 2RJ1A 4EE5A 3IOJA 3I0FA 4KXOA 1FR8A 4ARWA 1G93A 1VZXA 2Y7AA 5C4BA 1G97A 1ON8A 1G2VA 4MYBA 1V84A 1WT1A 2GGOA 4KC1A 2PA4A 5C3AA 3USQA 2A8UA 1QWJA 4C2SA 1TW5A 2YC3A 3D8VA 2RITA 5J49A 4Y7UA 4GBPA 1YROB 4FRAA 4NANA 2BO7A 1LVWA 3BCVA 5CQNX 4ZDQA 3U2WA 1HM9A 1WT3A 1W77A 2OI6A 4EEOA 2JCJA 1HV9A 3JUJA 3IOIA 1W55A 2VD4A 1INJA 1ZI1A 3SXBA 1G3LA 2UX8A 3F1YA 2V0JA 2WVLA 3E25A 2I5KA 2ZU7A 4EEGA 2RIYA 2V0HA 5C4EA 2V0LA 4AYLA 3U2VA 1H7EA 1VZUA 3SXAA 1VGWA 1YP4A 2RJ6A 3ST8A 2FYCB 1PZYB 3FOQA 4HCQA 2O1GA 1G23A 2P6WA 2JCOA 1H5SB 1H5RA 3PKQA 3I0GA 1LL3A 2FY7A 1R7YA 2Y4KA 1FR9A 2WVMA 2P72A 2AH9A 1G8OA 1VZTA 3TQDA 2WGZA 1OMXA 1NKHB 4FCEA 1TW1A 5CQOA 2GGQA 4G3SA 4AC3A 3I0KA 2NXVA 3R3IA 2X65A 4NALA 1H5TA 2OEGA 4B4MA 1LZIA 2V0KA 2Y4JA 4UEGA 4HO4A 1NWGB 3RMWA 3T7MA 1ZCVA 3ZLKA 1WVCA 4FREA 4KT7A 2QH5A 3K8EA 4NAKA 1H5RB 1VPAA 1JVGA 1NF5B 3JTJA 4L41C 2VK9A 1YP2A 4KPZA 2RJ8A 4LW6A 1XHBA 1QGSA 1ZJ2A 3OH1A 3V0PA 1LZJA 2JCLA 1XZ6A 3U0YA 3ZGFA 5C4DA 1ZJ1A 2AM5A 4KC4A 1S4OA 1H5TB 4J18A 4HO9A 4D11A 1KWSA 1FXOA 3F1CA 3SX8A 1R7XA 4EE4A 4B3UA 3QVBA 2WVKA 3T7OA 1MP4A 4KNRA 4IRQA 5C36A 5FYEA 1H7FA 1SS9A 3O3PA 4Y9XA 1ZHJA 2I7BA 2PGVA 4HO8A 1FOAA 5C1GA 3V91A 5FTSA 3I0HA 2Y6PA 3DJ4A 1IINA 4G3PA 5HS2A 3RMVA 2AGDA 2OI5A 2BO8A 3I0CA 3K8DA 4O6MA 5C38A 2BO4A 4Y62A 4Y7TA 1FGGA 2O1FA 1MP5A 5IFYA 4JISA 2WEEA 4M2AA 3OC9A 1MC3A 3D98A 3ZGGA 3CKOA 1S4PA 2O1HA 1JV3A 1LZ7A 1I52A 5D92A 3LW6A 4Y63A 2AM3A 3Q7UA 1GA8A 5AJOA 4D11C 4FRBA 4ASYA 3SX7A 3I0LA 4R7PA 4KNXA 1ZJ3A 1HM8A 4HO3A 5FU0A 1VH3A 1GX4A 5CQMX 4IRPA 1R80A 4FIYA 3POLA 5FUHA 2VS5A 3ZLLA 4HO5A 2VSHA 4Y7GA 3BRKX 4Y7FA 5IDTA 5C4CA 5FV9A 3U2TA 3SXGA 4CVHA 3PKPA 4M4KA 4EEMA 5CMHA 4DDZA 4DECA 5BXCA 2A8WA 4EE3A 1PZTA 1ZIZA 1FZWA 2ICXA 2RJ5A 1ZJPA 4M2BA 4CJCA 2ICYA 3V8YA 3EE5A 1LL0A 4B2WA 1WSZA 4BMAA 1FO9A 1ZJOA 4KC2A 4B42A 2D7RA 1VH1A 1OMZA 2QGIA 2VS4A 1GWVA 2DPWA 2XWLA 3OGZA 3PNNA 1S4NA 5C47A 1JYKA 1G95A 1ZCTA 4B2XA 3U2UA 2XWNA 1IIMA 4Y6UA 5AJNA 4P00A 1FO8A 3E26A 4AAWA 2VSIA 2ZU9A 3CKQA 1ZDGA 4MIXA 4JD0A 4B4GA 4BQHA 1TZFA 2ZU8A 4EEAA 5I1FA 2APCA 3CKJA 2FFUA 5CMJA 3IOHA 3SX3A 1ZDFA 1ZCYA 2J0AA 2QKXA 1LZ0A 3OAMA 5DDVA 4FRQA 1R82A 5CMGX 3CGXA 1VGTA 2P73A 2VS3A 3D5NA 1R7VA 3CU0A 2VXLA 1ZI3A 3SX5A 4D0ZA 5EJ1A 1G1LA 4XWIA 5DDTA 1K4VA 2OEFA 1VICA 2YQJA 2Y4MA 4B5BA 2E8BA 1FG5N 2E3DA 1H7LA 1EYRA 4AYJA 2BO6A 3OKRA 3V0OA 5C48A 3Q4SA 4P02A 1ZI4A 4MNDA 2YQHA 4Y6NA 3ZF8A 1H7QA 1ON6A 1JV1A 1WT2A 5AJPA 2CU2A 4FQWA 3V8ZA 5IDSA 2RJ4A 3GUEA 4B4BA 3U0XA 3Q80A 3R2WA 4FRMA 2XWMA 1R7UA 2XMHA 2D0JA 2I5EA 1H5SD 5C1LA 4KRVA 4CJBA 1Z90A 4FROA 2YESA 1YP3A 1H5SA 2FYAA 3I0JA 3OH4A 2V0IA 1INIA 5L6SA 4FRPA 1GQCA 1NQIB 3KIAA 4HG6A 4YS8A 3NGWA 4Q7CA 3I0IX 1OQMB 1LL2A 5CMIA 5C3BA 4Y7VA 3V0QA 2FYBA 2X5SA 3V0MA 4FRDA 4DE7A 4Y64A 1FWYA 2JCKA 1HJJA 3USRA 5CQLX 3V0LA 4KQLA 4M28A 1V82A 4ASJA 1GQ9A 5C4FA 2RJ9A 3I0EA 3CKVA 1VM8A 4ECMA 5C49A 3U2XA 5FTVA 1JYLA 1MP3A 2YQSA 2FYDB 4NAIA 5C1HA 2WAWA 2Z87A 3SXEA 4FIXA 3V90A 2RIZA 5L6VA 4FCUA 4D48A 2MZBA 2YCMA 5EJZA 5C3DA 2Z86A 1W57A 1FRWA 3FWWA 5CMFX 1WT0A 4HOCA 1TVYA 1H5SC 3HL3A 2VXMA 3V0NA 5CQPA 3CKNA 4G87A 5D91A 2W0WA 2WE9A 2AECA 2X60A 1VGUA 4EVWA 3DUVA 2Q4JA 3I0DA 2YC5A 2YQCA 1H4DA 1R81A 3RSBA 1G0RA 2VFZA 1H4EA 3TZTA 1ZI5A 2PX7A 2RJ7A 4G3QA 1R7TA 2W0VA 3N9WA 1HJLA 1H7TA 4E1KA 1QG8A 2AE7A 3SXCA 3SPTA 2AESA 4HO2A 1O7OA 4HO0A 4O6NA 1GWWA 2XMEA 1E5KA 3SXDA 4HO6A 1H3MA 4CJ8A 1H7HA 5JQQA 2OI7A 1ZCUA 2AM4A 4FRHA 5C8RA 3DK5A 1GX0A 1H4CA 5FU8A 2PGYA 2Y4LA 1O23B 5EIYA
chains in the Genus database with same CATH topology
1FGXA 1FXJA 4K6RA 3OH2A 3OH0A 2RIXA 1NMMB 1G9RA 4D0TA 1O0RA 3OH3A 1QGQA 2D7IA 1NHEB 3T7NA 4LW3A 1V83A 1EZIA 4KPXA 1O7QA 1H7GA 2J0BA 1HM0A 2C0NA 1JVDA 1ZJ0A 4FRLA 2X5ZA 2RJ0A 3JUKA 1VGZA 2FFVA 2RJ1A 4EE5A 3IOJA 3I0FA 4KXOA 1FR8A 4ARWA 1G93A 1VZXA 2Y7AA 5C4BA 1G97A 1ON8A 1G2VA 4MYBA 1V84A 1WT1A 2GGOA 4KC1A 2PA4A 5C3AA 3USQA 2A8UA 1QWJA 4C2SA 1TW5A 2YC3A 3D8VA 2RITA 5J49A 4Y7UA 4GBPA 1YROB 4FRAA 4NANA 2BO7A 1LVWA 3BCVA 5CQNX 4ZDQA 3U2WA 1HM9A 1WT3A 1W77A 2OI6A 4EEOA 2JCJA 1HV9A 3JUJA 3IOIA 1W55A 2VD4A 1INJA 1ZI1A 3SXBA 1G3LA 2UX8A 3F1YA 2V0JA 2WVLA 3E25A 2I5KA 2ZU7A 4EEGA 2RIYA 2V0HA 5C4EA 2V0LA 4AYLA 3U2VA 1H7EA 1VZUA 3SXAA 1VGWA 1YP4A 2RJ6A 3ST8A 2FYCB 1PZYB 3FOQA 4HCQA 2O1GA 1G23A 2P6WA 2JCOA 1H5SB 1H5RA 3PKQA 3I0GA 1LL3A 2FY7A 1R7YA 2Y4KA 1FR9A 2WVMA 2P72A 2AH9A 1G8OA 1VZTA 3TQDA 2WGZA 1OMXA 1NKHB 4FCEA 1TW1A 5CQOA 2GGQA 4G3SA 4AC3A 3I0KA 2NXVA 3R3IA 2X65A 4NALA 1H5TA 2OEGA 4B4MA 1LZIA 2V0KA 2Y4JA 4UEGA 4HO4A 1NWGB 3RMWA 3T7MA 1ZCVA 3ZLKA 1WVCA 4FREA 4KT7A 2QH5A 3K8EA 4NAKA 1H5RB 1VPAA 1JVGA 1NF5B 3JTJA 4L41C 2VK9A 1YP2A 4KPZA 2RJ8A 4LW6A 1XHBA 1QGSA 1ZJ2A 3OH1A 3V0PA 1LZJA 2JCLA 1XZ6A 3U0YA 3ZGFA 5C4DA 1ZJ1A 2AM5A 4KC4A 1S4OA 1H5TB 4J18A 4HO9A 4D11A 1KWSA 1FXOA 3F1CA 3SX8A 1R7XA 4EE4A 4B3UA 3QVBA 2WVKA 3T7OA 1MP4A 4KNRA 4IRQA 5C36A 5FYEA 1H7FA 1SS9A 3O3PA 4Y9XA 1ZHJA 2I7BA 2PGVA 4HO8A 1FOAA 5C1GA 3V91A 5FTSA 3I0HA 2Y6PA 3DJ4A 1IINA 4G3PA 5HS2A 3RMVA 2AGDA 2OI5A 2BO8A 3I0CA 3K8DA 4O6MA 5C38A 2BO4A 4Y62A 4Y7TA 1FGGA 2O1FA 1MP5A 5IFYA 4JISA 2WEEA 4M2AA 3OC9A 1MC3A 3D98A 3ZGGA 3CKOA 1S4PA 2O1HA 1JV3A 1LZ7A 1I52A 5D92A 3LW6A 4Y63A 2AM3A 3Q7UA 1GA8A 5AJOA 4D11C 4FRBA 4ASYA 3SX7A 3I0LA 4R7PA 4KNXA 1ZJ3A 1HM8A 4HO3A 5FU0A 1VH3A 1GX4A 5CQMX 4IRPA 1R80A 4FIYA 3POLA 5FUHA 2VS5A 3ZLLA 4HO5A 2VSHA 4Y7GA 3BRKX 4Y7FA 5IDTA 5C4CA 5FV9A 3U2TA 3SXGA 4CVHA 3PKPA 4M4KA 4EEMA 5CMHA 4DDZA 4DECA 5BXCA 2A8WA 4EE3A 1PZTA 1ZIZA 1FZWA 2ICXA 2RJ5A 1ZJPA 4M2BA 4CJCA 2ICYA 3V8YA 3EE5A 1LL0A 4B2WA 1WSZA 4BMAA 1FO9A 1ZJOA 4KC2A 4B42A 2D7RA 1VH1A 1OMZA 2QGIA 2VS4A 1GWVA 2DPWA 2XWLA 3OGZA 3PNNA 1S4NA 5C47A 1JYKA 1G95A 1ZCTA 4B2XA 3U2UA 2XWNA 1IIMA 4Y6UA 5AJNA 4P00A 1FO8A 3E26A 4AAWA 2VSIA 2ZU9A 3CKQA 1ZDGA 4MIXA 4JD0A 4B4GA 4BQHA 1TZFA 2ZU8A 4EEAA 5I1FA 2APCA 3CKJA 2FFUA 5CMJA 3IOHA 3SX3A 1ZDFA 1ZCYA 2J0AA 2QKXA 1LZ0A 3OAMA 5DDVA 4FRQA 1R82A 5CMGX 3CGXA 1VGTA 2P73A 2VS3A 3D5NA 1R7VA 3CU0A 2VXLA 1ZI3A 3SX5A 4D0ZA 5EJ1A 1G1LA 4XWIA 5DDTA 1K4VA 2OEFA 1VICA 2YQJA 2Y4MA 4B5BA 2E8BA 1FG5N 2E3DA 1H7LA 1EYRA 4AYJA 2BO6A 3OKRA 3V0OA 5C48A 3Q4SA 4P02A 1ZI4A 4MNDA 2YQHA 4Y6NA 3ZF8A 1H7QA 1ON6A 1JV1A 1WT2A 5AJPA 2CU2A 4FQWA 3V8ZA 5IDSA 2RJ4A 3GUEA 4B4BA 3U0XA 3Q80A 3R2WA 4FRMA 2XWMA 1R7UA 2XMHA 2D0JA 2I5EA 1H5SD 5C1LA 4KRVA 4CJBA 1Z90A 4FROA 2YESA 1YP3A 1H5SA 2FYAA 3I0JA 3OH4A 2V0IA 1INIA 5L6SA 4FRPA 1GQCA 1NQIB 3KIAA 4HG6A 4YS8A 3NGWA 4Q7CA 3I0IX 1OQMB 1LL2A 5CMIA 5C3BA 4Y7VA 3V0QA 2FYBA 2X5SA 3V0MA 4FRDA 4DE7A 4Y64A 1FWYA 2JCKA 1HJJA 3USRA 5CQLX 3V0LA 4KQLA 4M28A 1V82A 4ASJA 1GQ9A 5C4FA 2RJ9A 3I0EA 3CKVA 1VM8A 4ECMA 5C49A 3U2XA 5FTVA 1JYLA 1MP3A 2YQSA 2FYDB 4NAIA 5C1HA 2WAWA 2Z87A 3SXEA 4FIXA 3V90A 2RIZA 5L6VA 4FCUA 4D48A 2MZBA 2YCMA 5EJZA 5C3DA 2Z86A 1W57A 1FRWA 3FWWA 5CMFX 1WT0A 4HOCA 1TVYA 1H5SC 3HL3A 2VXMA 3V0NA 5CQPA 3CKNA 4G87A 5D91A 2W0WA 2WE9A 2AECA 2X60A 1VGUA 4EVWA 3DUVA 2Q4JA 3I0DA 2YC5A 2YQCA 1H4DA 1R81A 3RSBA 1G0RA 2VFZA 1H4EA 3TZTA 1ZI5A 2PX7A 2RJ7A 4G3QA 1R7TA 2W0VA 3N9WA 1HJLA 1H7TA 4E1KA 1QG8A 2AE7A 3SXCA 3SPTA 2AESA 4HO2A 1O7OA 4HO0A 4O6NA 1GWWA 2XMEA 1E5KA 3SXDA 4HO6A 1H3MA 4CJ8A 1H7HA 5JQQA 2OI7A 1ZCUA 2AM4A 4FRHA 5C8RA 3DK5A 1GX0A 1H4CA 5FU8A 2PGYA 2Y4LA 1O23B 5EIYA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1FGX A;  1FXJ A;  4K6R A;  3OH2 A;  3OH0 A;  2RIX A;  1NMM B;  1G9R A;  4D0T A;  1O0R A;  3OH3 A;  1QGQ A;  2D7I A;  1NHE B;  3T7N A;  4LW3 A;  1V83 A;  1EZI A;  4KPX A;  1O7Q A;  1H7G A;  1HM0 A;  4FRL A;  1JVD A;  1ZJ0 A;  2X5Z A;  2RJ0 A;  3JUK A;  1VGZ A;  2FFV A;  2RJ1 A;  4EE5 A;  3IOJ A;  3I0F A;  4KXO A;  1FR8 A;  4ARW A;  1G93 A;  1VZX A;  2Y7A A;  5C4B A;  1G97 A;  1ON8 A;  1G2V A;  4MYB A;  1V84 A;  1WT1 A;  2GGO A;  4KC1 A;  2PA4 A;  5C3A A;  3USQ A;  2A8U A;  1QWJ A;  4C2S A;  1TW5 A;  2YC3 A;  3D8V A;  2RIT A;  5J49 A;  4Y7U A;  4GBP A;  1YRO B;  4FRA A;  4NAN A;  2BO7 A;  1LVW A;  3BCV A;  5CQN X;  4ZDQ A;  3U2W A;  1HM9 A;  1WT3 A;  1W77 A;  2OI6 A;  4EEO A;  2JCJ A;  1HV9 A;  3JUJ A;  3IOI A;  1W55 A;  2VD4 A;  1INJ A;  1ZI1 A;  3SXB A;  1G3L A;  2UX8 A;  3F1Y A;  2V0J A;  2WVL A;  3E25 A;  2I5K A;  2ZU7 A;  4EEG A;  2RIY A;  2V0H A;  5C4E A;  2V0L A;  4AYL A;  3U2V A;  1H7E A;  1VZU A;  3SXA A;  1VGW A;  1YP4 A;  2RJ6 A;  3ST8 A;  2FYC B;  1PZY B;  3FOQ A;  4HCQ A;  2O1G A;  1G23 A;  2P6W A;  2JCO A;  1H5S B;  1H5R A;  3PKQ A;  3I0G A;  1LL3 A;  2FY7 A;  1R7Y A;  2Y4K A;  1FR9 A;  2WVM A;  2P72 A;  2AH9 A;  1G8O A;  1VZT A;  3TQD A;  2WGZ A;  1OMX A;  1NKH B;  4FCE A;  1TW1 A;  5CQO A;  2GGQ A;  4G3S A;  4AC3 A;  3I0K A;  2NXV A;  3R3I A;  2X65 A;  4NAL A;  1H5T A;  2OEG A;  4B4M A;  1LZI A;  2V0K A;  2Y4J A;  4UEG A;  4HO4 A;  1NWG B;  3RMW A;  3T7M A;  1ZCV A;  3ZLK A;  1WVC A;  4FRE A;  4KT7 A;  2QH5 A;  3K8E A;  4NAK A;  1H5R B;  1VPA A;  1JVG A;  1NF5 B;  3JTJ A;  4L41 C;  1YP2 A;  4KPZ A;  2RJ8 A;  4LW6 A;  1XHB A;  1QGS A;  1ZJ2 A;  3OH1 A;  3V0P A;  1LZJ A;  2JCL A;  1XZ6 A;  3U0Y A;  3ZGF A;  5C4D A;  1ZJ1 A;  2AM5 A;  4KC4 A;  1S4O A;  1H5T B;  4J18 A;  4HO9 A;  4D11 A;  1KWS A;  1FXO A;  3F1C A;  3SX8 A;  1R7X A;  4EE4 A;  4B3U A;  3QVB A;  2WVK A;  3T7O A;  1MP4 A;  4KNR A;  4IRQ A;  5C36 A;  5FYE A;  1H7F A;  1SS9 A;  3O3P A;  4Y9X A;  1ZHJ A;  2I7B A;  2PGV A;  4HO8 A;  1FOA A;  5C1G A;  3V91 A;  5FTS A;  3I0H A;  2Y6P A;  3DJ4 A;  1IIN A;  4G3P A;  5HS2 A;  3RMV A;  2AGD A;  2OI5 A;  2BO8 A;  3I0C A;  3K8D A;  5C38 A;  2BO4 A;  4Y62 A;  4Y7T A;  1FGG A;  2O1F A;  1MP5 A;  5IFY A;  4JIS A;  2WEE A;  4M2A A;  3OC9 A;  1MC3 A;  3D98 A;  3ZGG A;  3CKO A;  1S4P A;  2O1H A;  1JV3 A;  1LZ7 A;  1I52 A;  3LW6 A;  4Y63 A;  2AM3 A;  3Q7U A;  1GA8 A;  5AJO A;  4D11 C;  4FRB A;  4ASY A;  3SX7 A;  3I0L A;  4R7P A;  4KNX A;  1ZJ3 A;  1HM8 A;  4HO3 A;  5FU0 A;  1VH3 A;  1GX4 A;  5CQM X;  4IRP A;  1R80 A;  3POL A;  5FUH A;  2VS5 A;  3ZLL A;  4HO5 A;  2VSH A;  4Y7G A;  3BRK X;  4Y7F A;  5IDT A;  5C4C A;  5FV9 A;  3U2T A;  3SXG A;  4CVH A;  3PKP A;  4M4K A;  4EEM A;  5CMH A;  4DDZ A;  4DEC A;  5BXC A;  2A8W A;  4EE3 A;  1PZT A;  1ZIZ A;  1FZW A;  2ICX A;  2RJ5 A;  1ZJP A;  4M2B A;  4CJC A;  2ICY A;  3V8Y A;  3EE5 A;  1LL0 A;  4B2W A;  1WSZ A;  4BMA A;  1FO9 A;  1ZJO A;  4KC2 A;  4B42 A;  2D7R A;  1VH1 A;  1OMZ A;  2QGI A;  2VS4 A;  1GWV A;  2DPW A;  2XWL A;  3OGZ A;  3PNN A;  1S4N A;  5C47 A;  1JYK A;  1G95 A;  1ZCT A;  4B2X A;  3U2U A;  2XWN A;  1IIM A;  4Y6U A;  5AJN A;  4P00 A;  1FO8 A;  3E26 A;  4AAW A;  2VSI A;  2ZU9 A;  3CKQ A;  1ZDG A;  4JD0 A;  4B4G A;  4BQH A;  1TZF A;  2ZU8 A;  4EEA A;  5I1F A;  2APC A;  3CKJ A;  2FFU A;  5CMJ A;  3IOH A;  3SX3 A;  1ZDF A;  1ZCY A;  2QKX A;  1LZ0 A;  3OAM A;  5DDV A;  4FRQ A;  1R82 A;  5CMG X;  3CGX A;  1VGT A;  2P73 A;  2VS3 A;  3D5N A;  1R7V A;  3CU0 A;  2VXL A;  1ZI3 A;  3SX5 A;  4D0Z A;  5EJ1 A;  1G1L A;  4XWI A;  5DDT A;  1K4V A;  2OEF A;  1VIC A;  2YQJ A;  2Y4M A;  4B5B A;  2E8B A;  1FG5 N;  2E3D A;  1H7L A;  1EYR A;  4AYJ A;  2BO6 A;  3OKR A;  3V0O A;  5C48 A;  3Q4S A;  4P02 A;  1ZI4 A;  4MND A;  2YQH A;  4Y6N A;  3ZF8 A;  1H7Q A;  1ON6 A;  1JV1 A;  1WT2 A;  5AJP A;  2CU2 A;  4FQW A;  3V8Z A;  5IDS A;  2RJ4 A;  3GUE A;  4B4B A;  3U0X A;  3Q80 A;  3R2W A;  4FRM A;  2XWM A;  1R7U A;  2XMH A;  2D0J A;  2I5E A;  1H5S D;  5C1L A;  4KRV A;  4CJB A;  1Z90 A;  4FRO A;  2YES A;  1YP3 A;  1H5S A;  2FYA A;  3I0J A;  3OH4 A;  2V0I A;  1INI A;  5L6S A;  4FRP A;  1GQC A;  1NQI B;  3KIA A;  4HG6 A;  4YS8 A;  3NGW A;  3I0I X;  1OQM B;  1LL2 A;  5CMI A;  5C3B A;  4Y7V A;  3V0Q A;  2FYB A;  2X5S A;  3V0M A;  4FRD A;  4DE7 A;  4Y64 A;  1FWY A;  2JCK A;  1HJJ A;  3USR A;  5CQL X;  3V0L A;  4KQL A;  4M28 A;  1V82 A;  4ASJ A;  1GQ9 A;  5C4F A;  2RJ9 A;  3I0E A;  3CKV A;  1VM8 A;  4ECM A;  5C49 A;  3U2X A;  5FTV A;  1JYL A;  1MP3 A;  2YQS A;  2FYD B;  4NAI A;  5C1H A;  2WAW A;  2Z87 A;  3SXE A;  3V90 A;  2RIZ A;  5L6V A;  4FCU A;  4D48 A;  2MZB A;  2YCM A;  5EJZ A;  5C3D A;  2Z86 A;  1W57 A;  1FRW A;  3FWW A;  5CMF X;  1WT0 A;  4HOC A;  1TVY A;  1H5S C;  3HL3 A;  2VXM A;  3V0N A;  5CQP A;  3CKN A;  4G87 A;  2W0W A;  2WE9 A;  2AEC A;  2X60 A;  1VGU A;  4EVW A;  3DUV A;  2Q4J A;  3I0D A;  2YC5 A;  2YQC A;  1H4D A;  1R81 A;  3RSB A;  1G0R A;  2VFZ A;  1H4E A;  3TZT A;  1ZI5 A;  2PX7 A;  2RJ7 A;  4G3Q A;  1R7T A;  2W0V A;  3N9W A;  1HJL A;  1H7T A;  4E1K A;  1QG8 A;  2AE7 A;  3SXC A;  3SPT A;  2AES A;  4HO2 A;  1O7O A;  4HO0 A;  1GWW A;  2XME A;  1E5K A;  3SXD A;  4HO6 A;  1H3M A;  4CJ8 A;  1H7H A;  5JQQ A;  2OI7 A;  1ZCU A;  2AM4 A;  4FRH A;  5C8R A;  3DK5 A;  1GX0 A;  1H4C A;  5FU8 A;  2PGY A;  2Y4L A;  1O23 B;  5EIY A; 
#chains in the Genus database with same CATH topology
 1FGX A;  1FXJ A;  4K6R A;  3OH2 A;  3OH0 A;  2RIX A;  1NMM B;  1G9R A;  4D0T A;  1O0R A;  3OH3 A;  1QGQ A;  2D7I A;  1NHE B;  3T7N A;  4LW3 A;  1V83 A;  1EZI A;  4KPX A;  1O7Q A;  1H7G A;  2J0B A;  1HM0 A;  2C0N A;  1JVD A;  1ZJ0 A;  4FRL A;  2X5Z A;  2RJ0 A;  3JUK A;  1VGZ A;  2FFV A;  2RJ1 A;  4EE5 A;  3IOJ A;  3I0F A;  4KXO A;  1FR8 A;  4ARW A;  1G93 A;  1VZX A;  2Y7A A;  5C4B A;  1G97 A;  1ON8 A;  1G2V A;  4MYB A;  1V84 A;  1WT1 A;  2GGO A;  4KC1 A;  2PA4 A;  5C3A A;  3USQ A;  2A8U A;  1QWJ A;  4C2S A;  1TW5 A;  2YC3 A;  3D8V A;  2RIT A;  5J49 A;  4Y7U A;  4GBP A;  1YRO B;  4FRA A;  4NAN A;  2BO7 A;  1LVW A;  3BCV A;  5CQN X;  4ZDQ A;  3U2W A;  1HM9 A;  1WT3 A;  1W77 A;  2OI6 A;  4EEO A;  2JCJ A;  1HV9 A;  3JUJ A;  3IOI A;  1W55 A;  2VD4 A;  1INJ A;  1ZI1 A;  3SXB A;  1G3L A;  2UX8 A;  3F1Y A;  2V0J A;  2WVL A;  3E25 A;  2I5K A;  2ZU7 A;  4EEG A;  2RIY A;  2V0H A;  5C4E A;  2V0L A;  4AYL A;  3U2V A;  1H7E A;  1VZU A;  3SXA A;  1VGW A;  1YP4 A;  2RJ6 A;  3ST8 A;  2FYC B;  1PZY B;  3FOQ A;  4HCQ A;  2O1G A;  1G23 A;  2P6W A;  2JCO A;  1H5S B;  1H5R A;  3PKQ A;  3I0G A;  1LL3 A;  2FY7 A;  1R7Y A;  2Y4K A;  1FR9 A;  2WVM A;  2P72 A;  2AH9 A;  1G8O A;  1VZT A;  3TQD A;  2WGZ A;  1OMX A;  1NKH B;  4FCE A;  1TW1 A;  5CQO A;  2GGQ A;  4G3S A;  4AC3 A;  3I0K A;  2NXV A;  3R3I A;  2X65 A;  4NAL A;  1H5T A;  2OEG A;  4B4M A;  1LZI A;  2V0K A;  2Y4J A;  4UEG A;  4HO4 A;  1NWG B;  3RMW A;  3T7M A;  1ZCV A;  3ZLK A;  1WVC A;  4FRE A;  4KT7 A;  2QH5 A;  3K8E A;  4NAK A;  1H5R B;  1VPA A;  1JVG A;  1NF5 B;  3JTJ A;  4L41 C;  2VK9 A;  1YP2 A;  4KPZ A;  2RJ8 A;  4LW6 A;  1XHB A;  1QGS A;  1ZJ2 A;  3OH1 A;  3V0P A;  1LZJ A;  2JCL A;  1XZ6 A;  3U0Y A;  3ZGF A;  5C4D A;  1ZJ1 A;  2AM5 A;  4KC4 A;  1S4O A;  1H5T B;  4J18 A;  4HO9 A;  4D11 A;  1KWS A;  1FXO A;  3F1C A;  3SX8 A;  1R7X A;  4EE4 A;  4B3U A;  3QVB A;  2WVK A;  3T7O A;  1MP4 A;  4KNR A;  4IRQ A;  5C36 A;  5FYE A;  1H7F A;  1SS9 A;  3O3P A;  4Y9X A;  1ZHJ A;  2I7B A;  2PGV A;  4HO8 A;  1FOA A;  5C1G A;  3V91 A;  5FTS A;  3I0H A;  2Y6P A;  3DJ4 A;  1IIN A;  4G3P A;  5HS2 A;  3RMV A;  2AGD A;  2OI5 A;  2BO8 A;  3I0C A;  3K8D A;  4O6M A;  5C38 A;  2BO4 A;  4Y62 A;  4Y7T A;  1FGG A;  2O1F A;  1MP5 A;  5IFY A;  4JIS A;  2WEE A;  4M2A A;  3OC9 A;  1MC3 A;  3D98 A;  3ZGG A;  3CKO A;  1S4P A;  2O1H A;  1JV3 A;  1LZ7 A;  1I52 A;  5D92 A;  3LW6 A;  4Y63 A;  2AM3 A;  3Q7U A;  1GA8 A;  5AJO A;  4D11 C;  4FRB A;  4ASY A;  3SX7 A;  3I0L A;  4R7P A;  4KNX A;  1ZJ3 A;  1HM8 A;  4HO3 A;  5FU0 A;  1VH3 A;  1GX4 A;  5CQM X;  4IRP A;  1R80 A;  4FIY A;  3POL A;  5FUH A;  2VS5 A;  3ZLL A;  4HO5 A;  2VSH A;  4Y7G A;  3BRK X;  4Y7F A;  5IDT A;  5C4C A;  5FV9 A;  3U2T A;  3SXG A;  4CVH A;  3PKP A;  4M4K A;  4EEM A;  5CMH A;  4DDZ A;  4DEC A;  5BXC A;  2A8W A;  4EE3 A;  1PZT A;  1ZIZ A;  1FZW A;  2ICX A;  2RJ5 A;  1ZJP A;  4M2B A;  4CJC A;  2ICY A;  3V8Y A;  3EE5 A;  1LL0 A;  4B2W A;  1WSZ A;  4BMA A;  1FO9 A;  1ZJO A;  4KC2 A;  4B42 A;  2D7R A;  1VH1 A;  1OMZ A;  2QGI A;  2VS4 A;  1GWV A;  2DPW A;  2XWL A;  3OGZ A;  3PNN A;  1S4N A;  5C47 A;  1JYK A;  1G95 A;  1ZCT A;  4B2X A;  3U2U A;  2XWN A;  1IIM A;  4Y6U A;  5AJN A;  4P00 A;  1FO8 A;  3E26 A;  4AAW A;  2VSI A;  2ZU9 A;  3CKQ A;  1ZDG A;  4MIX A;  4JD0 A;  4B4G A;  4BQH A;  1TZF A;  2ZU8 A;  4EEA A;  5I1F A;  2APC A;  3CKJ A;  2FFU A;  5CMJ A;  3IOH A;  3SX3 A;  1ZDF A;  1ZCY A;  2J0A A;  2QKX A;  1LZ0 A;  3OAM A;  5DDV A;  4FRQ A;  1R82 A;  5CMG X;  3CGX A;  1VGT A;  2P73 A;  2VS3 A;  3D5N A;  1R7V A;  3CU0 A;  2VXL A;  1ZI3 A;  3SX5 A;  4D0Z A;  5EJ1 A;  1G1L A;  4XWI A;  5DDT A;  1K4V A;  2OEF A;  1VIC A;  2YQJ A;  2Y4M A;  4B5B A;  2E8B A;  1FG5 N;  2E3D A;  1H7L A;  1EYR A;  4AYJ A;  2BO6 A;  3OKR A;  3V0O A;  5C48 A;  3Q4S A;  4P02 A;  1ZI4 A;  4MND A;  2YQH A;  4Y6N A;  3ZF8 A;  1H7Q A;  1ON6 A;  1JV1 A;  1WT2 A;  5AJP A;  2CU2 A;  4FQW A;  3V8Z A;  5IDS A;  2RJ4 A;  3GUE A;  4B4B A;  3U0X A;  3Q80 A;  3R2W A;  4FRM A;  2XWM A;  1R7U A;  2XMH A;  2D0J A;  2I5E A;  1H5S D;  5C1L A;  4KRV A;  4CJB A;  1Z90 A;  4FRO A;  2YES A;  1YP3 A;  1H5S A;  2FYA A;  3I0J A;  3OH4 A;  2V0I A;  1INI A;  5L6S A;  4FRP A;  1GQC A;  1NQI B;  3KIA A;  4HG6 A;  4YS8 A;  3NGW A;  4Q7C A;  3I0I X;  1OQM B;  1LL2 A;  5CMI A;  5C3B A;  4Y7V A;  3V0Q A;  2FYB A;  2X5S A;  3V0M A;  4FRD A;  4DE7 A;  4Y64 A;  1FWY A;  2JCK A;  1HJJ A;  3USR A;  5CQL X;  3V0L A;  4KQL A;  4M28 A;  1V82 A;  4ASJ A;  1GQ9 A;  5C4F A;  2RJ9 A;  3I0E A;  3CKV A;  1VM8 A;  4ECM A;  5C49 A;  3U2X A;  5FTV A;  1JYL A;  1MP3 A;  2YQS A;  2FYD B;  4NAI A;  5C1H A;  2WAW A;  2Z87 A;  3SXE A;  4FIX A;  3V90 A;  2RIZ A;  5L6V A;  4FCU A;  4D48 A;  2MZB A;  2YCM A;  5EJZ A;  5C3D A;  2Z86 A;  1W57 A;  1FRW A;  3FWW A;  5CMF X;  1WT0 A;  4HOC A;  1TVY A;  1H5S C;  3HL3 A;  2VXM A;  3V0N A;  5CQP A;  3CKN A;  4G87 A;  5D91 A;  2W0W A;  2WE9 A;  2AEC A;  2X60 A;  1VGU A;  4EVW A;  3DUV A;  2Q4J A;  3I0D A;  2YC5 A;  2YQC A;  1H4D A;  1R81 A;  3RSB A;  1G0R A;  2VFZ A;  1H4E A;  3TZT A;  1ZI5 A;  2PX7 A;  2RJ7 A;  4G3Q A;  1R7T A;  2W0V A;  3N9W A;  1HJL A;  1H7T A;  4E1K A;  1QG8 A;  2AE7 A;  3SXC A;  3SPT A;  2AES A;  4HO2 A;  1O7O A;  4HO0 A;  4O6N A;  1GWW A;  2XME A;  1E5K A;  3SXD A;  4HO6 A;  1H3M A;  4CJ8 A;  1H7H A;  5JQQ A;  2OI7 A;  1ZCU A;  2AM4 A;  4FRH A;  5C8R A;  3DK5 A;  1GX0 A;  1H4C A;  5FU8 A;  2PGY A;  2Y4L A;  1O23 B;  5EIY A; 
#chains in the Genus database with same CATH homology
 1FGX A;  1FXJ A;  4K6R A;  3OH2 A;  3OH0 A;  2RIX A;  1NMM B;  1G9R A;  4D0T A;  1O0R A;  3OH3 A;  1QGQ A;  2D7I A;  1NHE B;  3T7N A;  4LW3 A;  1V83 A;  1EZI A;  4KPX A;  1O7Q A;  1H7G A;  2J0B A;  1HM0 A;  2C0N A;  1JVD A;  1ZJ0 A;  4FRL A;  2X5Z A;  2RJ0 A;  3JUK A;  1VGZ A;  2FFV A;  2RJ1 A;  4EE5 A;  3IOJ A;  3I0F A;  4KXO A;  1FR8 A;  4ARW A;  1G93 A;  1VZX A;  2Y7A A;  5C4B A;  1G97 A;  1ON8 A;  1G2V A;  4MYB A;  1V84 A;  1WT1 A;  2GGO A;  4KC1 A;  2PA4 A;  5C3A A;  3USQ A;  2A8U A;  1QWJ A;  4C2S A;  1TW5 A;  2YC3 A;  3D8V A;  2RIT A;  5J49 A;  4Y7U A;  4GBP A;  1YRO B;  4FRA A;  4NAN A;  2BO7 A;  1LVW A;  3BCV A;  5CQN X;  4ZDQ A;  3U2W A;  1HM9 A;  1WT3 A;  1W77 A;  2OI6 A;  4EEO A;  2JCJ A;  1HV9 A;  3JUJ A;  3IOI A;  1W55 A;  2VD4 A;  1INJ A;  1ZI1 A;  3SXB A;  1G3L A;  2UX8 A;  3F1Y A;  2V0J A;  2WVL A;  3E25 A;  2I5K A;  2ZU7 A;  4EEG A;  2RIY A;  2V0H A;  5C4E A;  2V0L A;  4AYL A;  3U2V A;  1H7E A;  1VZU A;  3SXA A;  1VGW A;  1YP4 A;  2RJ6 A;  3ST8 A;  2FYC B;  1PZY B;  3FOQ A;  4HCQ A;  2O1G A;  1G23 A;  2P6W A;  2JCO A;  1H5S B;  1H5R A;  3PKQ A;  3I0G A;  1LL3 A;  2FY7 A;  1R7Y A;  2Y4K A;  1FR9 A;  2WVM A;  2P72 A;  2AH9 A;  1G8O A;  1VZT A;  3TQD A;  2WGZ A;  1OMX A;  1NKH B;  4FCE A;  1TW1 A;  5CQO A;  2GGQ A;  4G3S A;  4AC3 A;  3I0K A;  2NXV A;  3R3I A;  2X65 A;  4NAL A;  1H5T A;  2OEG A;  4B4M A;  1LZI A;  2V0K A;  2Y4J A;  4UEG A;  4HO4 A;  1NWG B;  3RMW A;  3T7M A;  1ZCV A;  3ZLK A;  1WVC A;  4FRE A;  4KT7 A;  2QH5 A;  3K8E A;  4NAK A;  1H5R B;  1VPA A;  1JVG A;  1NF5 B;  3JTJ A;  4L41 C;  2VK9 A;  1YP2 A;  4KPZ A;  2RJ8 A;  4LW6 A;  1XHB A;  1QGS A;  1ZJ2 A;  3OH1 A;  3V0P A;  1LZJ A;  2JCL A;  1XZ6 A;  3U0Y A;  3ZGF A;  5C4D A;  1ZJ1 A;  2AM5 A;  4KC4 A;  1S4O A;  1H5T B;  4J18 A;  4HO9 A;  4D11 A;  1KWS A;  1FXO A;  3F1C A;  3SX8 A;  1R7X A;  4EE4 A;  4B3U A;  3QVB A;  2WVK A;  3T7O A;  1MP4 A;  4KNR A;  4IRQ A;  5C36 A;  5FYE A;  1H7F A;  1SS9 A;  3O3P A;  4Y9X A;  1ZHJ A;  2I7B A;  2PGV A;  4HO8 A;  1FOA A;  5C1G A;  3V91 A;  5FTS A;  3I0H A;  2Y6P A;  3DJ4 A;  1IIN A;  4G3P A;  5HS2 A;  3RMV A;  2AGD A;  2OI5 A;  2BO8 A;  3I0C A;  3K8D A;  4O6M A;  5C38 A;  2BO4 A;  4Y62 A;  4Y7T A;  1FGG A;  2O1F A;  1MP5 A;  5IFY A;  4JIS A;  2WEE A;  4M2A A;  3OC9 A;  1MC3 A;  3D98 A;  3ZGG A;  3CKO A;  1S4P A;  2O1H A;  1JV3 A;  1LZ7 A;  1I52 A;  5D92 A;  3LW6 A;  4Y63 A;  2AM3 A;  3Q7U A;  1GA8 A;  5AJO A;  4D11 C;  4FRB A;  4ASY A;  3SX7 A;  3I0L A;  4R7P A;  4KNX A;  1ZJ3 A;  1HM8 A;  4HO3 A;  5FU0 A;  1VH3 A;  1GX4 A;  5CQM X;  4IRP A;  1R80 A;  4FIY A;  3POL A;  5FUH A;  2VS5 A;  3ZLL A;  4HO5 A;  2VSH A;  4Y7G A;  3BRK X;  4Y7F A;  5IDT A;  5C4C A;  5FV9 A;  3U2T A;  3SXG A;  4CVH A;  3PKP A;  4M4K A;  4EEM A;  5CMH A;  4DDZ A;  4DEC A;  5BXC A;  2A8W A;  4EE3 A;  1PZT A;  1ZIZ A;  1FZW A;  2ICX A;  2RJ5 A;  1ZJP A;  4M2B A;  4CJC A;  2ICY A;  3V8Y A;  3EE5 A;  1LL0 A;  4B2W A;  1WSZ A;  4BMA A;  1FO9 A;  1ZJO A;  4KC2 A;  4B42 A;  2D7R A;  1VH1 A;  1OMZ A;  2QGI A;  2VS4 A;  1GWV A;  2DPW A;  2XWL A;  3OGZ A;  3PNN A;  1S4N A;  5C47 A;  1JYK A;  1G95 A;  1ZCT A;  4B2X A;  3U2U A;  2XWN A;  1IIM A;  4Y6U A;  5AJN A;  4P00 A;  1FO8 A;  3E26 A;  4AAW A;  2VSI A;  2ZU9 A;  3CKQ A;  1ZDG A;  4MIX A;  4JD0 A;  4B4G A;  4BQH A;  1TZF A;  2ZU8 A;  4EEA A;  5I1F A;  2APC A;  3CKJ A;  2FFU A;  5CMJ A;  3IOH A;  3SX3 A;  1ZDF A;  1ZCY A;  2J0A A;  2QKX A;  1LZ0 A;  3OAM A;  5DDV A;  4FRQ A;  1R82 A;  5CMG X;  3CGX A;  1VGT A;  2P73 A;  2VS3 A;  3D5N A;  1R7V A;  3CU0 A;  2VXL A;  1ZI3 A;  3SX5 A;  4D0Z A;  5EJ1 A;  1G1L A;  4XWI A;  5DDT A;  1K4V A;  2OEF A;  1VIC A;  2YQJ A;  2Y4M A;  4B5B A;  2E8B A;  1FG5 N;  2E3D A;  1H7L A;  1EYR A;  4AYJ A;  2BO6 A;  3OKR A;  3V0O A;  5C48 A;  3Q4S A;  4P02 A;  1ZI4 A;  4MND A;  2YQH A;  4Y6N A;  3ZF8 A;  1H7Q A;  1ON6 A;  1JV1 A;  1WT2 A;  5AJP A;  2CU2 A;  4FQW A;  3V8Z A;  5IDS A;  2RJ4 A;  3GUE A;  4B4B A;  3U0X A;  3Q80 A;  3R2W A;  4FRM A;  2XWM A;  1R7U A;  2XMH A;  2D0J A;  2I5E A;  1H5S D;  5C1L A;  4KRV A;  4CJB A;  1Z90 A;  4FRO A;  2YES A;  1YP3 A;  1H5S A;  2FYA A;  3I0J A;  3OH4 A;  2V0I A;  1INI A;  5L6S A;  4FRP A;  1GQC A;  1NQI B;  3KIA A;  4HG6 A;  4YS8 A;  3NGW A;  4Q7C A;  3I0I X;  1OQM B;  1LL2 A;  5CMI A;  5C3B A;  4Y7V A;  3V0Q A;  2FYB A;  2X5S A;  3V0M A;  4FRD A;  4DE7 A;  4Y64 A;  1FWY A;  2JCK A;  1HJJ A;  3USR A;  5CQL X;  3V0L A;  4KQL A;  4M28 A;  1V82 A;  4ASJ A;  1GQ9 A;  5C4F A;  2RJ9 A;  3I0E A;  3CKV A;  1VM8 A;  4ECM A;  5C49 A;  3U2X A;  5FTV A;  1JYL A;  1MP3 A;  2YQS A;  2FYD B;  4NAI A;  5C1H A;  2WAW A;  2Z87 A;  3SXE A;  4FIX A;  3V90 A;  2RIZ A;  5L6V A;  4FCU A;  4D48 A;  2MZB A;  2YCM A;  5EJZ A;  5C3D A;  2Z86 A;  1W57 A;  1FRW A;  3FWW A;  5CMF X;  1WT0 A;  4HOC A;  1TVY A;  1H5S C;  3HL3 A;  2VXM A;  3V0N A;  5CQP A;  3CKN A;  4G87 A;  5D91 A;  2W0W A;  2WE9 A;  2AEC A;  2X60 A;  1VGU A;  4EVW A;  3DUV A;  2Q4J A;  3I0D A;  2YC5 A;  2YQC A;  1H4D A;  1R81 A;  3RSB A;  1G0R A;  2VFZ A;  1H4E A;  3TZT A;  1ZI5 A;  2PX7 A;  2RJ7 A;  4G3Q A;  1R7T A;  2W0V A;  3N9W A;  1HJL A;  1H7T A;  4E1K A;  1QG8 A;  2AE7 A;  3SXC A;  3SPT A;  2AES A;  4HO2 A;  1O7O A;  4HO0 A;  4O6N A;  1GWW A;  2XME A;  1E5K A;  3SXD A;  4HO6 A;  1H3M A;  4CJ8 A;  1H7H A;  5JQQ A;  2OI7 A;  1ZCU A;  2AM4 A;  4FRH A;  5C8R A;  3DK5 A;  1GX0 A;  1H4C A;  5FU8 A;  2PGY A;  2Y4L A;  1O23 B;  5EIY A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...