4ASYA

Pseudomonas aeruginosa rmla in complex with allosteric inhibitor
Total Genus 95
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
95
sequence length
293
structure length
293
Chain Sequence
MKRKGIILAGGSGTRLHPATLAISKQLLPVYDKPMIYYPLSTLMLAGIREILIISTPQDTPRFQQLLGDGSNWGLDLQYAVQPSPDGLAQAFLIGESFIGNDLSALVLGDNLYYGHDFHELLGSASQRQTGASVFAYHVLDPERYGVVEFDQGGKAISLEEKPLEPKSNYAVTGLYFYDQQVVDIARDLKPSPRGELEITDVNRAYLERGQLSVEIMGRGYAWLDTGTHDSLLEAGQFIATLENRQGLKVACPEEIAYRQKWIDAAQLEKLAAPLAKNGYGQYLKRLLTETVY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords GLUCOSE-1-PHOSPHATE THYMIDYLYLTRANSFERASE
publication title Allosteric competitive inhibitors of the glucose-1-phosphate thymidylyltransferase (RmlA) from Pseudomonas aeruginosa.
pubmed doi rcsb
source organism Pseudomonas aeruginosa
molecule tags Transferase
total genus 95
structure length 293
sequence length 293
chains with identical sequence B, C, D
ec nomenclature ec 2.7.7.74: 1L-myo-inositol 1-phosphate cytidylyltransferase.
pdb deposition date 2012-05-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00483 NTP_transferase Nucleotidyl transferase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.550.10 Alpha Beta Alpha-Beta Complex Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A 4asyA00
3TQDA 3R2WA 2AGDA 5C47A 4EEAA 5C1GA 4EE5A 5CMHA 4D0ZA 2V0KA 4BMAA 1ZJPA 2BO6A 2RJ1A 4HO0A 3OKRA 4P02A 1MP5A 4B5BA 1LL2A 3I0JA 2RIXA 5AJNA 2PX7A 3I0IX 3EE5A 2P73A 2BO7A 1H5SC 3ST8A 3I0DA 4M4KA 1FRWA 1KWSA 4D0TA 2A8WA 1WVCA 1GWVA 1HM9A 3FOQA 4ASJA 5C3DA 4Y7VA 1G23A 1MC3A 2OI6A 3JUKA 3F1YA 3OH0A 4AYLA 1NKHB 2XWNA 2AM3A 2AE7A 2ZU8A 1LL3A 1YP4A 5FTSA 2CU2A 4HO8A 1VICA 1G0RA 2VSIA 4B42A 1NHEB 5CMJA 3I0HA 1LVWA 1G97A 2FYDB 5CMIA 1JYKA 3ZLLA 3USRA 1JVDA 4FRLA 2VXMA 3OH1A 2AECA 2XMHA 3SX3A 4EVWA 5C4CA 4MNDA 2X5ZA 2YCMA 1H7HA 4Y7GA 2RJ6A 2RITA 1VGUA 4HO9A 1TVYA 2Z86A 5FTVA 2O1GA 1H7FA 2Q4JA 2I5KA 1FO9A 1XZ6A 1R7XA 4HO2A 1H4DA 2WEEA 3Q4SA 3U2UA 1INJA 1QGQA 1FZWA 2RJ0A 5CMGX 2WAWA 1VZXA 2X60A 1ZI3A 3DJ4A 3V8ZA 4R7PA 4HCQA 2Y7AA 2Y4MA 5C48A 1R82A 2OEFA 5DDVA 1EZIA 4ARWA 1FOAA 2AM4A 1H7GA 1QWJA 5CQNX 3SX8A 1MP3A 3V0PA 2PA4A 3IOIA 1HM0A 4KT7A 4KC4A 3I0EA 4FREA 4P00A 4G3PA 2YC5A 4AYJA 3K8DA 1S4PA 3K8EA 4Y6UA 2YQHA 5DDTA 2XWMA 2GGQA 3IOJA 2VSHA 2ICYA 5FU0A 4IRPA 1YP2A 4B4GA 2RJ9A 4B2XA 2D0JA 1G3LA 1ZJ3A 2X5SA 5HS2A 4EE4A 5JQQA 2UX8A 3POLA 3V0OA 3SPTA 3T7OA 1ON8A 1ZCVA 4G3SA 2VD4A 5CQLX 3T7MA 1ZHJA 2JCLA 1H7EA 2YC3A 4D11C 1R7YA 1FGXA 5C1HA 2XWLA 3I0CA 1I52A 1YP3A 2X65A 3HL3A 1FXOA 4KPXA 4NAKA 1FXJA 2QH5A 1V83A 1OMXA 4C2SA 5C4FA 5C4EA 4HO6A 5EJZA 2AESA 1VH3A 4DECA 3IOHA 3SXAA 1ZJOA 2WVLA 4BQHA 3SX7A 3V8YA 1G9RA 3DK5A 3V0LA 5L6SA 1G1LA 1JV3A 2JCKA 5C36A 1HM8A 1ZI1A 5IDTA 1E5KA 2AH9A 2WVMA 3PNNA 3U2TA 4KRVA 2ZU7A 4NANA 3R3IA 1WT2A 4EEOA 4HO5A 2ICXA 4M2AA 4B2WA 3T7NA 3I0GA 1VPAA 2I5EA 4EE3A 2MZBA 4JD0A 1R7TA 2BO4A 5C49A 2I7BA 4EEGA 1TZFA 2OI5A 1NF5B 1ZDFA 1PZYB 4ZDQA 3SXBA 2D7RA 5I1FA 1GX0A 4KNXA 5IFYA 5J49A 3SXCA 3QVBA 1FR8A 5CQPA 3F1CA 2Y4LA 4Y6NA 4JISA 3PKQA 2APCA 5CMFX 1O7QA 2AM5A 2RJ7A 1IIMA 3U0XA 4CJ8A 1LZ7A 2RIZA 1S4OA 4AC3A 3PKPA 3SXGA 4FRAA 4FRDA 4KXOA 2D7IA 2V0LA 1IINA 4FRMA 3RMWA 4KNRA 2RJ8A 3D5NA 3Q7UA 2ZU9A 2JCOA 4Y62A 1NQIB 4G87A 4CJCA 1QG8A 3U2VA 4HOCA 3GUEA 1VGTA 1MP4A 1QGSA 3CGXA 3CKNA 1EYRA 1LZJA 2W0WA 1H5TB 2QGIA 4LW3A 1FGGA 1JV1A 1TW1A 4D11A 3OH3A 2NXVA 4Y64A 2VFZA 2PGVA 2YQSA 4B3UA 3OC9A 4K6RA 3U0YA 2WVKA 3CKJA 3U2WA 1W57A 1GQCA 3I0KA 1R81A 5C3AA 1R80A 1R7VA 3OH2A 3DUVA 3U2XA 3N9WA 4FCEA 2Z87A 4CJBA 2BO8A 4HG6A 2QKXA 3V0MA 3SXEA 1WSZA 4FROA 4ASYA 2RJ5A 1YROB 3ZLKA 4G3QA 2XMEA 2A8UA 1FG5N 4ECMA 1NMMB 2YQCA 1W77A 1H4EA 3V0QA 3Q80A 1HJJA 4HO3A 1XHBA 2FYBA 1VZTA 5EJ1A 1O7OA 2RJ4A 4IRQA 2Y6PA 4L41C 1OMZA 1ZIZA 5CQOA 4FRBA 3SXDA 1GWWA 4B4MA 2V0HA 4KQLA 4GBPA 3CKQA 5C4BA 4NAIA 2V0IA 1JYLA 5L6VA 1H7TA 1PZTA 4DDZA 3V90A 1WT3A 1V84A 3V91A 1SS9A 2RIYA 3KIAA 5C4DA 5AJPA 1VH1A 1O23B 4LW6A 1ZCYA 2FFUA 2E8BA 1H3MA 2VS5A 5BXCA 1TW5A 3ZGFA 4FRPA 4UEGA 2DPWA 4J18A 3OH4A 2Y4KA 3CKVA 1ZCTA 3V0NA 3SX5A 2PGYA 2GGOA 1V82A 2WGZA 1ZI5A 1HJLA 4D48A 1HV9A 3ZGGA 2WE9A 5C3BA 2W0VA 2VXLA 4B4BA 1FR9A 4XWIA 4CVHA 2E3DA 4Y7TA 1ZCUA 1Z90A 5FYEA 3NGWA 3O3PA 1G93A 2P72A 1H5SD 1VM8A 3D8VA 4Y9XA 2FFVA 4FQWA 3I0FA 2FY7A 1GA8A 2VS4A 4FRQA 1H7LA 2Y4JA 2FYCB 2P6WA 1H7QA 1NWGB 4FRHA 3OGZA 3E25A 1W55A 3USQA 3RMVA 5IDSA 4NALA 5EIYA 4Y7UA 3LW6A 1GQ9A 1S4NA 1ON6A 3CU0A 3ZF8A 4MYBA 3BCVA 1ZDGA 1FO8A 1VGWA 1INIA 1O0RA 2FYAA 1ZI4A 1VGZA 2JCJA 2YESA 5FU8A 1H5TA 3JUJA 4Y63A 1LL0A 1K4VA 1ZJ0A 2OEGA 4YS8A 1R7UA 1G95A 5FUHA 4AAWA 1WT0A 4E1KA 4FCUA 5FV9A 1H4CA 5CQMX 4KC1A 1LZ0A 2VS3A 5C38A 3I0LA 4HO4A 3JTJA 1VZUA 4Y7FA 3BRKX 3RSBA 1FWYA 3E26A 2YQJA 1JVGA 1WT1A 5C8RA 2O1HA 4M2BA 1H5RB 4KPZA 1H5SB 4DE7A 1LZIA 1ZJ2A 4EEMA 3D98A 1G8OA 1ZJ1A 1GX4A 2OI7A 3TZTA 2O1FA 4M28A 1H5RA 5AJOA 1H5SA 1G2VA 5C1LA 1OQMB 3FWWA 2V0JA 4KC2A 3OAMA 3CKOA
chains in the Genus database with same CATH superfamily
3TQDA 3R2WA 2AGDA 5C47A 4EEAA 5C1GA 2VK9A 4EE5A 5CMHA 4D0ZA 2V0KA 4BMAA 1ZJPA 2BO6A 2RJ1A 4HO0A 3OKRA 4P02A 1MP5A 4B5BA 1LL2A 3I0JA 2RIXA 5AJNA 2PX7A 3I0IX 3EE5A 2P73A 2BO7A 1H5SC 3ST8A 3I0DA 4M4KA 1FRWA 1KWSA 4D0TA 2J0AA 2A8WA 1WVCA 1GWVA 1HM9A 4O6NA 3FOQA 4ASJA 5C3DA 4Y7VA 1G23A 1MC3A 2OI6A 3JUKA 3F1YA 3OH0A 4AYLA 1NKHB 2XWNA 2AM3A 2AE7A 2ZU8A 1LL3A 1YP4A 5FTSA 2CU2A 4HO8A 1VICA 1G0RA 2VSIA 4B42A 1NHEB 5CMJA 3I0HA 1LVWA 1G97A 2FYDB 5CMIA 1JYKA 3ZLLA 3USRA 1JVDA 4FRLA 2VXMA 3OH1A 2AECA 2XMHA 3SX3A 4EVWA 5C4CA 4MNDA 2X5ZA 4FIYA 2YCMA 1H7HA 4Y7GA 2RJ6A 2RITA 1VGUA 4HO9A 1TVYA 2Z86A 5FTVA 2O1GA 1H7FA 2Q4JA 2I5KA 1FO9A 1XZ6A 1R7XA 4HO2A 1H4DA 2WEEA 3Q4SA 3U2UA 1INJA 1QGQA 1FZWA 2RJ0A 5CMGX 2WAWA 1VZXA 2X60A 1ZI3A 3DJ4A 3V8ZA 4R7PA 4HCQA 2Y7AA 2Y4MA 5C48A 1R82A 2OEFA 5DDVA 1EZIA 4ARWA 1FOAA 2AM4A 1H7GA 1QWJA 5CQNX 3SX8A 1MP3A 3V0PA 2PA4A 3IOIA 1HM0A 4KT7A 4KC4A 3I0EA 4FREA 4P00A 4G3PA 2YC5A 4AYJA 3K8DA 1S4PA 3K8EA 4Y6UA 2YQHA 5DDTA 2XWMA 2GGQA 3IOJA 2VSHA 2ICYA 5FU0A 4IRPA 5D92A 1YP2A 4B4GA 2RJ9A 4B2XA 2D0JA 1G3LA 1ZJ3A 2X5SA 5HS2A 4EE4A 5JQQA 2UX8A 3POLA 3V0OA 3SPTA 4O6MA 3T7OA 1ON8A 1ZCVA 4G3SA 2VD4A 5CQLX 3T7MA 1ZHJA 2JCLA 1H7EA 2YC3A 4D11C 1R7YA 1FGXA 5C1HA 2XWLA 3I0CA 1I52A 1YP3A 2X65A 3HL3A 1FXOA 4KPXA 4NAKA 1FXJA 2QH5A 1V83A 1OMXA 4C2SA 5C4FA 5C4EA 4HO6A 5EJZA 4MIXA 2AESA 1VH3A 4DECA 3IOHA 3SXAA 1ZJOA 2WVLA 4BQHA 3SX7A 3V8YA 1G9RA 3DK5A 3V0LA 5L6SA 1G1LA 1JV3A 2JCKA 5C36A 1HM8A 1ZI1A 5IDTA 1E5KA 2AH9A 2WVMA 3PNNA 3U2TA 4KRVA 2ZU7A 4NANA 3R3IA 1WT2A 4EEOA 4HO5A 2ICXA 4M2AA 4B2WA 3T7NA 3I0GA 1VPAA 2I5EA 4EE3A 2MZBA 4JD0A 1R7TA 2BO4A 5C49A 2I7BA 4EEGA 1TZFA 2OI5A 1NF5B 1ZDFA 1PZYB 4ZDQA 3SXBA 2D7RA 5I1FA 1GX0A 4KNXA 5IFYA 5J49A 3SXCA 3QVBA 1FR8A 5CQPA 3F1CA 2Y4LA 4Y6NA 4JISA 3PKQA 2APCA 5CMFX 1O7QA 2AM5A 2RJ7A 1IIMA 3U0XA 4CJ8A 1LZ7A 2RIZA 1S4OA 4AC3A 3PKPA 3SXGA 4FRAA 4FRDA 4KXOA 2D7IA 2V0LA 1IINA 4FRMA 3RMWA 4KNRA 2RJ8A 3D5NA 3Q7UA 2ZU9A 2JCOA 4Y62A 1NQIB 4G87A 4CJCA 1QG8A 3U2VA 4HOCA 3GUEA 1VGTA 1MP4A 1QGSA 3CGXA 3CKNA 1EYRA 1LZJA 2W0WA 1H5TB 2QGIA 4LW3A 1FGGA 1JV1A 1TW1A 4D11A 3OH3A 2NXVA 4Y64A 2VFZA 2PGVA 2YQSA 4B3UA 3OC9A 4K6RA 3U0YA 2WVKA 3CKJA 3U2WA 1W57A 1GQCA 3I0KA 1R81A 5C3AA 1R80A 1R7VA 3OH2A 3DUVA 3U2XA 3N9WA 4FCEA 2Z87A 4CJBA 2BO8A 4HG6A 2QKXA 3V0MA 3SXEA 1WSZA 4FROA 4ASYA 2RJ5A 5D91A 1YROB 3ZLKA 4G3QA 2XMEA 2A8UA 1FG5N 4ECMA 1NMMB 2YQCA 1W77A 1H4EA 3V0QA 3Q80A 1HJJA 4HO3A 1XHBA 2FYBA 1VZTA 5EJ1A 1O7OA 2RJ4A 4IRQA 2Y6PA 4L41C 1OMZA 1ZIZA 5CQOA 2C0NA 4FRBA 3SXDA 1GWWA 4B4MA 2V0HA 4KQLA 4GBPA 3CKQA 5C4BA 4NAIA 2V0IA 1JYLA 5L6VA 1H7TA 1PZTA 4DDZA 3V90A 1WT3A 1V84A 3V91A 1SS9A 2RIYA 3KIAA 5C4DA 5AJPA 1VH1A 1O23B 4LW6A 1ZCYA 2FFUA 2E8BA 1H3MA 2VS5A 5BXCA 1TW5A 3ZGFA 4FRPA 4UEGA 2DPWA 4J18A 3OH4A 2Y4KA 3CKVA 1ZCTA 3V0NA 3SX5A 2PGYA 2GGOA 1V82A 2WGZA 1ZI5A 1HJLA 4D48A 1HV9A 3ZGGA 2WE9A 5C3BA 2W0VA 2VXLA 4B4BA 1FR9A 4XWIA 4CVHA 2E3DA 4Y7TA 1ZCUA 1Z90A 5FYEA 3NGWA 3O3PA 1G93A 2P72A 1H5SD 1VM8A 3D8VA 4Y9XA 2FFVA 4FQWA 3I0FA 2FY7A 1GA8A 2VS4A 4FRQA 1H7LA 2Y4JA 2FYCB 2J0BA 1H7QA 2P6WA 1NWGB 4FRHA 3OGZA 3E25A 1W55A 3USQA 3RMVA 5IDSA 4NALA 5EIYA 4Y7UA 3LW6A 1GQ9A 1S4NA 1ON6A 3CU0A 3ZF8A 4MYBA 3BCVA 1ZDGA 1FO8A 1VGWA 1INIA 1O0RA 2FYAA 1ZI4A 1VGZA 2JCJA 2YESA 5FU8A 1H5TA 3JUJA 4Y63A 1LL0A 1K4VA 4Q7CA 1ZJ0A 2OEGA 4YS8A 1R7UA 1G95A 5FUHA 4AAWA 1WT0A 4E1KA 4FCUA 5FV9A 1H4CA 5CQMX 4KC1A 1LZ0A 2VS3A 5C38A 3I0LA 4HO4A 3JTJA 1VZUA 4Y7FA 3BRKX 4FIXA 3RSBA 1FWYA 3E26A 2YQJA 1JVGA 1WT1A 5C8RA 2O1HA 4M2BA 1H5RB 4KPZA 1H5SB 4DE7A 1LZIA 1ZJ2A 4EEMA 3D98A 1G8OA 1ZJ1A 1GX4A 2OI7A 3TZTA 2O1FA 4M28A 1H5RA 5AJOA 1H5SA 1G2VA 5C1LA 1OQMB 3FWWA 2V0JA 4KC2A 3OAMA 3CKOA
chains in the Genus database with same CATH topology
3TQDA 3R2WA 2AGDA 5C47A 4EEAA 5C1GA 2VK9A 4EE5A 5CMHA 4D0ZA 2V0KA 4BMAA 1ZJPA 2BO6A 2RJ1A 4HO0A 3OKRA 4P02A 1MP5A 4B5BA 1LL2A 3I0JA 2RIXA 5AJNA 2PX7A 3I0IX 3EE5A 2P73A 2BO7A 1H5SC 3ST8A 3I0DA 4M4KA 1FRWA 1KWSA 4D0TA 2J0AA 2A8WA 1WVCA 1GWVA 1HM9A 4O6NA 3FOQA 4ASJA 5C3DA 4Y7VA 1G23A 1MC3A 2OI6A 3JUKA 3F1YA 3OH0A 4AYLA 1NKHB 2XWNA 2AM3A 2AE7A 2ZU8A 1LL3A 1YP4A 5FTSA 2CU2A 4HO8A 1VICA 1G0RA 2VSIA 4B42A 1NHEB 5CMJA 3I0HA 1LVWA 1G97A 2FYDB 5CMIA 1JYKA 3ZLLA 3USRA 1JVDA 4FRLA 2VXMA 3OH1A 2AECA 2XMHA 3SX3A 4EVWA 5C4CA 4MNDA 2X5ZA 4FIYA 2YCMA 1H7HA 4Y7GA 2RJ6A 2RITA 1VGUA 4HO9A 1TVYA 2Z86A 5FTVA 2O1GA 1H7FA 2Q4JA 2I5KA 1FO9A 1XZ6A 1R7XA 4HO2A 1H4DA 2WEEA 3Q4SA 3U2UA 1INJA 1QGQA 1FZWA 2RJ0A 5CMGX 2WAWA 1VZXA 2X60A 1ZI3A 3DJ4A 3V8ZA 4R7PA 4HCQA 2Y7AA 2Y4MA 5C48A 1R82A 2OEFA 5DDVA 1EZIA 4ARWA 1FOAA 2AM4A 1H7GA 1QWJA 5CQNX 3SX8A 1MP3A 3V0PA 2PA4A 3IOIA 1HM0A 4KT7A 4KC4A 3I0EA 4FREA 4P00A 4G3PA 2YC5A 4AYJA 3K8DA 1S4PA 3K8EA 4Y6UA 2YQHA 5DDTA 2XWMA 2GGQA 3IOJA 2VSHA 2ICYA 5FU0A 4IRPA 5D92A 1YP2A 4B4GA 2RJ9A 4B2XA 2D0JA 1G3LA 1ZJ3A 2X5SA 5HS2A 4EE4A 5JQQA 2UX8A 3POLA 3V0OA 3SPTA 4O6MA 3T7OA 1ON8A 1ZCVA 4G3SA 2VD4A 5CQLX 3T7MA 1ZHJA 2JCLA 1H7EA 2YC3A 4D11C 1R7YA 1FGXA 5C1HA 2XWLA 3I0CA 1I52A 1YP3A 2X65A 3HL3A 1FXOA 4KPXA 4NAKA 1FXJA 2QH5A 1V83A 1OMXA 4C2SA 5C4FA 5C4EA 4HO6A 5EJZA 4MIXA 2AESA 1VH3A 4DECA 3IOHA 3SXAA 1ZJOA 2WVLA 4BQHA 3SX7A 3V8YA 1G9RA 3DK5A 3V0LA 5L6SA 1G1LA 1JV3A 2JCKA 5C36A 1HM8A 1ZI1A 5IDTA 1E5KA 2AH9A 2WVMA 3PNNA 3U2TA 4KRVA 2ZU7A 4NANA 3R3IA 1WT2A 4EEOA 4HO5A 2ICXA 4M2AA 4B2WA 3T7NA 3I0GA 1VPAA 2I5EA 4EE3A 2MZBA 4JD0A 1R7TA 2BO4A 5C49A 2I7BA 4EEGA 1TZFA 2OI5A 1NF5B 1ZDFA 1PZYB 4ZDQA 3SXBA 2D7RA 5I1FA 1GX0A 4KNXA 5IFYA 5J49A 3SXCA 3QVBA 1FR8A 5CQPA 3F1CA 2Y4LA 4Y6NA 4JISA 3PKQA 2APCA 5CMFX 1O7QA 2AM5A 2RJ7A 1IIMA 3U0XA 4CJ8A 1LZ7A 2RIZA 1S4OA 4AC3A 3PKPA 3SXGA 4FRAA 4FRDA 4KXOA 2D7IA 2V0LA 1IINA 4FRMA 3RMWA 4KNRA 2RJ8A 3D5NA 3Q7UA 2ZU9A 2JCOA 4Y62A 1NQIB 4G87A 4CJCA 1QG8A 3U2VA 4HOCA 3GUEA 1VGTA 1MP4A 1QGSA 3CGXA 3CKNA 1EYRA 1LZJA 2W0WA 1H5TB 2QGIA 4LW3A 1FGGA 1JV1A 1TW1A 4D11A 3OH3A 2NXVA 4Y64A 2VFZA 2PGVA 2YQSA 4B3UA 3OC9A 4K6RA 3U0YA 2WVKA 3CKJA 3U2WA 1W57A 1GQCA 3I0KA 1R81A 5C3AA 1R80A 1R7VA 3OH2A 3DUVA 3U2XA 3N9WA 4FCEA 2Z87A 4CJBA 2BO8A 4HG6A 2QKXA 3V0MA 3SXEA 1WSZA 4FROA 4ASYA 2RJ5A 5D91A 1YROB 3ZLKA 4G3QA 2XMEA 2A8UA 1FG5N 4ECMA 1NMMB 2YQCA 1W77A 1H4EA 3V0QA 3Q80A 1HJJA 4HO3A 1XHBA 2FYBA 1VZTA 5EJ1A 1O7OA 2RJ4A 4IRQA 2Y6PA 4L41C 1OMZA 1ZIZA 5CQOA 2C0NA 4FRBA 3SXDA 1GWWA 4B4MA 2V0HA 4KQLA 4GBPA 3CKQA 5C4BA 4NAIA 2V0IA 1JYLA 5L6VA 1H7TA 1PZTA 4DDZA 3V90A 1WT3A 1V84A 3V91A 1SS9A 2RIYA 3KIAA 5C4DA 5AJPA 1VH1A 1O23B 4LW6A 1ZCYA 2FFUA 2E8BA 1H3MA 2VS5A 5BXCA 1TW5A 3ZGFA 4FRPA 4UEGA 2DPWA 4J18A 3OH4A 2Y4KA 3CKVA 1ZCTA 3V0NA 3SX5A 2PGYA 2GGOA 1V82A 2WGZA 1ZI5A 1HJLA 4D48A 1HV9A 3ZGGA 2WE9A 5C3BA 2W0VA 2VXLA 4B4BA 1FR9A 4XWIA 4CVHA 2E3DA 4Y7TA 1ZCUA 1Z90A 5FYEA 3NGWA 3O3PA 1G93A 2P72A 1H5SD 1VM8A 3D8VA 4Y9XA 2FFVA 4FQWA 3I0FA 2FY7A 1GA8A 2VS4A 4FRQA 1H7LA 2Y4JA 2FYCB 2J0BA 1H7QA 2P6WA 1NWGB 4FRHA 3OGZA 3E25A 1W55A 3USQA 3RMVA 5IDSA 4NALA 5EIYA 4Y7UA 3LW6A 1GQ9A 1S4NA 1ON6A 3CU0A 3ZF8A 4MYBA 3BCVA 1ZDGA 1FO8A 1VGWA 1INIA 1O0RA 2FYAA 1ZI4A 1VGZA 2JCJA 2YESA 5FU8A 1H5TA 3JUJA 4Y63A 1LL0A 1K4VA 4Q7CA 1ZJ0A 2OEGA 4YS8A 1R7UA 1G95A 5FUHA 4AAWA 1WT0A 4E1KA 4FCUA 5FV9A 1H4CA 5CQMX 4KC1A 1LZ0A 2VS3A 5C38A 3I0LA 4HO4A 3JTJA 1VZUA 4Y7FA 3BRKX 4FIXA 3RSBA 1FWYA 3E26A 2YQJA 1JVGA 1WT1A 5C8RA 2O1HA 4M2BA 1H5RB 4KPZA 1H5SB 4DE7A 1LZIA 1ZJ2A 4EEMA 3D98A 1G8OA 1ZJ1A 1GX4A 2OI7A 3TZTA 2O1FA 4M28A 1H5RA 5AJOA 1H5SA 1G2VA 5C1LA 1OQMB 3FWWA 2V0JA 4KC2A 3OAMA 3CKOA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3TQD A;  3R2W A;  2AGD A;  5C47 A;  4EEA A;  5C1G A;  4EE5 A;  5CMH A;  4D0Z A;  2V0K A;  4BMA A;  1ZJP A;  2BO6 A;  2RJ1 A;  4HO0 A;  3OKR A;  4P02 A;  1MP5 A;  4B5B A;  1LL2 A;  3I0J A;  2RIX A;  5AJN A;  2PX7 A;  3I0I X;  3EE5 A;  2P73 A;  2BO7 A;  1H5S C;  3ST8 A;  3I0D A;  4M4K A;  1FRW A;  1KWS A;  4D0T A;  2A8W A;  1WVC A;  1GWV A;  1HM9 A;  3FOQ A;  4ASJ A;  5C3D A;  4Y7V A;  1G23 A;  1MC3 A;  2OI6 A;  3JUK A;  3F1Y A;  3OH0 A;  4AYL A;  1NKH B;  2XWN A;  2AM3 A;  2AE7 A;  2ZU8 A;  1LL3 A;  1YP4 A;  5FTS A;  2CU2 A;  4HO8 A;  1VIC A;  1G0R A;  2VSI A;  4B42 A;  1NHE B;  5CMJ A;  3I0H A;  1LVW A;  1G97 A;  2FYD B;  5CMI A;  1JYK A;  3ZLL A;  3USR A;  1JVD A;  4FRL A;  2VXM A;  3OH1 A;  2AEC A;  2XMH A;  3SX3 A;  4EVW A;  5C4C A;  4MND A;  2X5Z A;  2YCM A;  1H7H A;  4Y7G A;  2RJ6 A;  2RIT A;  1VGU A;  4HO9 A;  1TVY A;  2Z86 A;  5FTV A;  2O1G A;  1H7F A;  2Q4J A;  2I5K A;  1FO9 A;  1XZ6 A;  1R7X A;  4HO2 A;  1H4D A;  2WEE A;  3Q4S A;  3U2U A;  1INJ A;  1QGQ A;  1FZW A;  2RJ0 A;  5CMG X;  2WAW A;  1VZX A;  2X60 A;  1ZI3 A;  3DJ4 A;  3V8Z A;  4R7P A;  4HCQ A;  2Y7A A;  2Y4M A;  5C48 A;  1R82 A;  2OEF A;  5DDV A;  1EZI A;  4ARW A;  1FOA A;  2AM4 A;  1H7G A;  1QWJ A;  5CQN X;  3SX8 A;  1MP3 A;  3V0P A;  2PA4 A;  3IOI A;  1HM0 A;  4KT7 A;  4KC4 A;  3I0E A;  4FRE A;  4P00 A;  4G3P A;  2YC5 A;  4AYJ A;  3K8D A;  1S4P A;  3K8E A;  4Y6U A;  2YQH A;  5DDT A;  2XWM A;  2GGQ A;  3IOJ A;  2VSH A;  2ICY A;  5FU0 A;  4IRP A;  1YP2 A;  4B4G A;  2RJ9 A;  4B2X A;  2D0J A;  1G3L A;  1ZJ3 A;  2X5S A;  5HS2 A;  4EE4 A;  5JQQ A;  2UX8 A;  3POL A;  3V0O A;  3SPT A;  3T7O A;  1ON8 A;  1ZCV A;  4G3S A;  2VD4 A;  5CQL X;  3T7M A;  1ZHJ A;  2JCL A;  1H7E A;  2YC3 A;  4D11 C;  1R7Y A;  1FGX A;  5C1H A;  2XWL A;  3I0C A;  1I52 A;  1YP3 A;  2X65 A;  3HL3 A;  1FXO A;  4KPX A;  4NAK A;  1FXJ A;  2QH5 A;  1V83 A;  1OMX A;  4C2S A;  5C4F A;  5C4E A;  4HO6 A;  5EJZ A;  2AES A;  1VH3 A;  4DEC A;  3IOH A;  3SXA A;  1ZJO A;  2WVL A;  4BQH A;  3SX7 A;  3V8Y A;  1G9R A;  3DK5 A;  3V0L A;  5L6S A;  1G1L A;  1JV3 A;  2JCK A;  5C36 A;  1HM8 A;  1ZI1 A;  5IDT A;  1E5K A;  2AH9 A;  2WVM A;  3PNN A;  3U2T A;  4KRV A;  2ZU7 A;  4NAN A;  3R3I A;  1WT2 A;  4EEO A;  4HO5 A;  2ICX A;  4M2A A;  4B2W A;  3T7N A;  3I0G A;  1VPA A;  2I5E A;  4EE3 A;  2MZB A;  4JD0 A;  1R7T A;  2BO4 A;  5C49 A;  2I7B A;  4EEG A;  1TZF A;  2OI5 A;  1NF5 B;  1ZDF A;  1PZY B;  4ZDQ A;  3SXB A;  2D7R A;  5I1F A;  1GX0 A;  4KNX A;  5IFY A;  5J49 A;  3SXC A;  3QVB A;  1FR8 A;  5CQP A;  3F1C A;  2Y4L A;  4Y6N A;  4JIS A;  3PKQ A;  2APC A;  5CMF X;  1O7Q A;  2AM5 A;  2RJ7 A;  1IIM A;  3U0X A;  4CJ8 A;  1LZ7 A;  2RIZ A;  1S4O A;  4AC3 A;  3PKP A;  3SXG A;  4FRA A;  4FRD A;  4KXO A;  2D7I A;  2V0L A;  1IIN A;  4FRM A;  3RMW A;  4KNR A;  2RJ8 A;  3D5N A;  3Q7U A;  2ZU9 A;  2JCO A;  4Y62 A;  1NQI B;  4G87 A;  4CJC A;  1QG8 A;  3U2V A;  4HOC A;  3GUE A;  1VGT A;  1MP4 A;  1QGS A;  3CGX A;  3CKN A;  1EYR A;  1LZJ A;  2W0W A;  1H5T B;  2QGI A;  4LW3 A;  1FGG A;  1JV1 A;  1TW1 A;  4D11 A;  3OH3 A;  2NXV A;  4Y64 A;  2VFZ A;  2PGV A;  2YQS A;  4B3U A;  3OC9 A;  4K6R A;  3U0Y A;  2WVK A;  3CKJ A;  3U2W A;  1W57 A;  1GQC A;  3I0K A;  1R81 A;  5C3A A;  1R80 A;  1R7V A;  3OH2 A;  3DUV A;  3U2X A;  3N9W A;  4FCE A;  2Z87 A;  4CJB A;  2BO8 A;  4HG6 A;  2QKX A;  3V0M A;  3SXE A;  1WSZ A;  4FRO A;  4ASY A;  2RJ5 A;  1YRO B;  3ZLK A;  4G3Q A;  2XME A;  2A8U A;  1FG5 N;  4ECM A;  1NMM B;  2YQC A;  1W77 A;  1H4E A;  3V0Q A;  3Q80 A;  1HJJ A;  4HO3 A;  1XHB A;  2FYB A;  1VZT A;  5EJ1 A;  1O7O A;  2RJ4 A;  4IRQ A;  2Y6P A;  4L41 C;  1OMZ A;  1ZIZ A;  5CQO A;  4FRB A;  3SXD A;  1GWW A;  4B4M A;  2V0H A;  4KQL A;  4GBP A;  3CKQ A;  5C4B A;  4NAI A;  2V0I A;  1JYL A;  5L6V A;  1H7T A;  1PZT A;  4DDZ A;  3V90 A;  1WT3 A;  1V84 A;  3V91 A;  1SS9 A;  2RIY A;  3KIA A;  5C4D A;  5AJP A;  1VH1 A;  1O23 B;  4LW6 A;  1ZCY A;  2FFU A;  2E8B A;  1H3M A;  2VS5 A;  5BXC A;  1TW5 A;  3ZGF A;  4FRP A;  4UEG A;  2DPW A;  4J18 A;  3OH4 A;  2Y4K A;  3CKV A;  1ZCT A;  3V0N A;  3SX5 A;  2PGY A;  2GGO A;  1V82 A;  2WGZ A;  1ZI5 A;  1HJL A;  4D48 A;  1HV9 A;  3ZGG A;  2WE9 A;  5C3B A;  2W0V A;  2VXL A;  4B4B A;  1FR9 A;  4XWI A;  4CVH A;  2E3D A;  4Y7T A;  1ZCU A;  1Z90 A;  5FYE A;  3NGW A;  3O3P A;  1G93 A;  2P72 A;  1H5S D;  1VM8 A;  3D8V A;  4Y9X A;  2FFV A;  4FQW A;  3I0F A;  2FY7 A;  1GA8 A;  2VS4 A;  4FRQ A;  1H7L A;  2Y4J A;  2FYC B;  2P6W A;  1H7Q A;  1NWG B;  4FRH A;  3OGZ A;  3E25 A;  1W55 A;  3USQ A;  3RMV A;  5IDS A;  4NAL A;  5EIY A;  4Y7U A;  3LW6 A;  1GQ9 A;  1S4N A;  1ON6 A;  3CU0 A;  3ZF8 A;  4MYB A;  3BCV A;  1ZDG A;  1FO8 A;  1VGW A;  1INI A;  1O0R A;  2FYA A;  1ZI4 A;  1VGZ A;  2JCJ A;  2YES A;  5FU8 A;  1H5T A;  3JUJ A;  4Y63 A;  1LL0 A;  1K4V A;  1ZJ0 A;  2OEG A;  4YS8 A;  1R7U A;  1G95 A;  5FUH A;  4AAW A;  1WT0 A;  4E1K A;  4FCU A;  5FV9 A;  1H4C A;  5CQM X;  4KC1 A;  1LZ0 A;  2VS3 A;  5C38 A;  3I0L A;  4HO4 A;  3JTJ A;  1VZU A;  4Y7F A;  3BRK X;  3RSB A;  1FWY A;  3E26 A;  2YQJ A;  1JVG A;  1WT1 A;  5C8R A;  2O1H A;  4M2B A;  1H5R B;  4KPZ A;  1H5S B;  4DE7 A;  1LZI A;  1ZJ2 A;  4EEM A;  3D98 A;  1G8O A;  1ZJ1 A;  1GX4 A;  2OI7 A;  3TZT A;  2O1F A;  4M28 A;  1H5R A;  5AJO A;  1H5S A;  1G2V A;  5C1L A;  1OQM B;  3FWW A;  2V0J A;  4KC2 A;  3OAM A;  3CKO A; 
#chains in the Genus database with same CATH topology
 3TQD A;  3R2W A;  2AGD A;  5C47 A;  4EEA A;  5C1G A;  2VK9 A;  4EE5 A;  5CMH A;  4D0Z A;  2V0K A;  4BMA A;  1ZJP A;  2BO6 A;  2RJ1 A;  4HO0 A;  3OKR A;  4P02 A;  1MP5 A;  4B5B A;  1LL2 A;  3I0J A;  2RIX A;  5AJN A;  2PX7 A;  3I0I X;  3EE5 A;  2P73 A;  2BO7 A;  1H5S C;  3ST8 A;  3I0D A;  4M4K A;  1FRW A;  1KWS A;  4D0T A;  2J0A A;  2A8W A;  1WVC A;  1GWV A;  1HM9 A;  4O6N A;  3FOQ A;  4ASJ A;  5C3D A;  4Y7V A;  1G23 A;  1MC3 A;  2OI6 A;  3JUK A;  3F1Y A;  3OH0 A;  4AYL A;  1NKH B;  2XWN A;  2AM3 A;  2AE7 A;  2ZU8 A;  1LL3 A;  1YP4 A;  5FTS A;  2CU2 A;  4HO8 A;  1VIC A;  1G0R A;  2VSI A;  4B42 A;  1NHE B;  5CMJ A;  3I0H A;  1LVW A;  1G97 A;  2FYD B;  5CMI A;  1JYK A;  3ZLL A;  3USR A;  1JVD A;  4FRL A;  2VXM A;  3OH1 A;  2AEC A;  2XMH A;  3SX3 A;  4EVW A;  5C4C A;  4MND A;  2X5Z A;  4FIY A;  2YCM A;  1H7H A;  4Y7G A;  2RJ6 A;  2RIT A;  1VGU A;  4HO9 A;  1TVY A;  2Z86 A;  5FTV A;  2O1G A;  1H7F A;  2Q4J A;  2I5K A;  1FO9 A;  1XZ6 A;  1R7X A;  4HO2 A;  1H4D A;  2WEE A;  3Q4S A;  3U2U A;  1INJ A;  1QGQ A;  1FZW A;  2RJ0 A;  5CMG X;  2WAW A;  1VZX A;  2X60 A;  1ZI3 A;  3DJ4 A;  3V8Z A;  4R7P A;  4HCQ A;  2Y7A A;  2Y4M A;  5C48 A;  1R82 A;  2OEF A;  5DDV A;  1EZI A;  4ARW A;  1FOA A;  2AM4 A;  1H7G A;  1QWJ A;  5CQN X;  3SX8 A;  1MP3 A;  3V0P A;  2PA4 A;  3IOI A;  1HM0 A;  4KT7 A;  4KC4 A;  3I0E A;  4FRE A;  4P00 A;  4G3P A;  2YC5 A;  4AYJ A;  3K8D A;  1S4P A;  3K8E A;  4Y6U A;  2YQH A;  5DDT A;  2XWM A;  2GGQ A;  3IOJ A;  2VSH A;  2ICY A;  5FU0 A;  4IRP A;  5D92 A;  1YP2 A;  4B4G A;  2RJ9 A;  4B2X A;  2D0J A;  1G3L A;  1ZJ3 A;  2X5S A;  5HS2 A;  4EE4 A;  5JQQ A;  2UX8 A;  3POL A;  3V0O A;  3SPT A;  4O6M A;  3T7O A;  1ON8 A;  1ZCV A;  4G3S A;  2VD4 A;  5CQL X;  3T7M A;  1ZHJ A;  2JCL A;  1H7E A;  2YC3 A;  4D11 C;  1R7Y A;  1FGX A;  5C1H A;  2XWL A;  3I0C A;  1I52 A;  1YP3 A;  2X65 A;  3HL3 A;  1FXO A;  4KPX A;  4NAK A;  1FXJ A;  2QH5 A;  1V83 A;  1OMX A;  4C2S A;  5C4F A;  5C4E A;  4HO6 A;  5EJZ A;  4MIX A;  2AES A;  1VH3 A;  4DEC A;  3IOH A;  3SXA A;  1ZJO A;  2WVL A;  4BQH A;  3SX7 A;  3V8Y A;  1G9R A;  3DK5 A;  3V0L A;  5L6S A;  1G1L A;  1JV3 A;  2JCK A;  5C36 A;  1HM8 A;  1ZI1 A;  5IDT A;  1E5K A;  2AH9 A;  2WVM A;  3PNN A;  3U2T A;  4KRV A;  2ZU7 A;  4NAN A;  3R3I A;  1WT2 A;  4EEO A;  4HO5 A;  2ICX A;  4M2A A;  4B2W A;  3T7N A;  3I0G A;  1VPA A;  2I5E A;  4EE3 A;  2MZB A;  4JD0 A;  1R7T A;  2BO4 A;  5C49 A;  2I7B A;  4EEG A;  1TZF A;  2OI5 A;  1NF5 B;  1ZDF A;  1PZY B;  4ZDQ A;  3SXB A;  2D7R A;  5I1F A;  1GX0 A;  4KNX A;  5IFY A;  5J49 A;  3SXC A;  3QVB A;  1FR8 A;  5CQP A;  3F1C A;  2Y4L A;  4Y6N A;  4JIS A;  3PKQ A;  2APC A;  5CMF X;  1O7Q A;  2AM5 A;  2RJ7 A;  1IIM A;  3U0X A;  4CJ8 A;  1LZ7 A;  2RIZ A;  1S4O A;  4AC3 A;  3PKP A;  3SXG A;  4FRA A;  4FRD A;  4KXO A;  2D7I A;  2V0L A;  1IIN A;  4FRM A;  3RMW A;  4KNR A;  2RJ8 A;  3D5N A;  3Q7U A;  2ZU9 A;  2JCO A;  4Y62 A;  1NQI B;  4G87 A;  4CJC A;  1QG8 A;  3U2V A;  4HOC A;  3GUE A;  1VGT A;  1MP4 A;  1QGS A;  3CGX A;  3CKN A;  1EYR A;  1LZJ A;  2W0W A;  1H5T B;  2QGI A;  4LW3 A;  1FGG A;  1JV1 A;  1TW1 A;  4D11 A;  3OH3 A;  2NXV A;  4Y64 A;  2VFZ A;  2PGV A;  2YQS A;  4B3U A;  3OC9 A;  4K6R A;  3U0Y A;  2WVK A;  3CKJ A;  3U2W A;  1W57 A;  1GQC A;  3I0K A;  1R81 A;  5C3A A;  1R80 A;  1R7V A;  3OH2 A;  3DUV A;  3U2X A;  3N9W A;  4FCE A;  2Z87 A;  4CJB A;  2BO8 A;  4HG6 A;  2QKX A;  3V0M A;  3SXE A;  1WSZ A;  4FRO A;  4ASY A;  2RJ5 A;  5D91 A;  1YRO B;  3ZLK A;  4G3Q A;  2XME A;  2A8U A;  1FG5 N;  4ECM A;  1NMM B;  2YQC A;  1W77 A;  1H4E A;  3V0Q A;  3Q80 A;  1HJJ A;  4HO3 A;  1XHB A;  2FYB A;  1VZT A;  5EJ1 A;  1O7O A;  2RJ4 A;  4IRQ A;  2Y6P A;  4L41 C;  1OMZ A;  1ZIZ A;  5CQO A;  2C0N A;  4FRB A;  3SXD A;  1GWW A;  4B4M A;  2V0H A;  4KQL A;  4GBP A;  3CKQ A;  5C4B A;  4NAI A;  2V0I A;  1JYL A;  5L6V A;  1H7T A;  1PZT A;  4DDZ A;  3V90 A;  1WT3 A;  1V84 A;  3V91 A;  1SS9 A;  2RIY A;  3KIA A;  5C4D A;  5AJP A;  1VH1 A;  1O23 B;  4LW6 A;  1ZCY A;  2FFU A;  2E8B A;  1H3M A;  2VS5 A;  5BXC A;  1TW5 A;  3ZGF A;  4FRP A;  4UEG A;  2DPW A;  4J18 A;  3OH4 A;  2Y4K A;  3CKV A;  1ZCT A;  3V0N A;  3SX5 A;  2PGY A;  2GGO A;  1V82 A;  2WGZ A;  1ZI5 A;  1HJL A;  4D48 A;  1HV9 A;  3ZGG A;  2WE9 A;  5C3B A;  2W0V A;  2VXL A;  4B4B A;  1FR9 A;  4XWI A;  4CVH A;  2E3D A;  4Y7T A;  1ZCU A;  1Z90 A;  5FYE A;  3NGW A;  3O3P A;  1G93 A;  2P72 A;  1H5S D;  1VM8 A;  3D8V A;  4Y9X A;  2FFV A;  4FQW A;  3I0F A;  2FY7 A;  1GA8 A;  2VS4 A;  4FRQ A;  1H7L A;  2Y4J A;  2FYC B;  2J0B A;  1H7Q A;  2P6W A;  1NWG B;  4FRH A;  3OGZ A;  3E25 A;  1W55 A;  3USQ A;  3RMV A;  5IDS A;  4NAL A;  5EIY A;  4Y7U A;  3LW6 A;  1GQ9 A;  1S4N A;  1ON6 A;  3CU0 A;  3ZF8 A;  4MYB A;  3BCV A;  1ZDG A;  1FO8 A;  1VGW A;  1INI A;  1O0R A;  2FYA A;  1ZI4 A;  1VGZ A;  2JCJ A;  2YES A;  5FU8 A;  1H5T A;  3JUJ A;  4Y63 A;  1LL0 A;  1K4V A;  4Q7C A;  1ZJ0 A;  2OEG A;  4YS8 A;  1R7U A;  1G95 A;  5FUH A;  4AAW A;  1WT0 A;  4E1K A;  4FCU A;  5FV9 A;  1H4C A;  5CQM X;  4KC1 A;  1LZ0 A;  2VS3 A;  5C38 A;  3I0L A;  4HO4 A;  3JTJ A;  1VZU A;  4Y7F A;  3BRK X;  4FIX A;  3RSB A;  1FWY A;  3E26 A;  2YQJ A;  1JVG A;  1WT1 A;  5C8R A;  2O1H A;  4M2B A;  1H5R B;  4KPZ A;  1H5S B;  4DE7 A;  1LZI A;  1ZJ2 A;  4EEM A;  3D98 A;  1G8O A;  1ZJ1 A;  1GX4 A;  2OI7 A;  3TZT A;  2O1F A;  4M28 A;  1H5R A;  5AJO A;  1H5S A;  1G2V A;  5C1L A;  1OQM B;  3FWW A;  2V0J A;  4KC2 A;  3OAM A;  3CKO A; 
#chains in the Genus database with same CATH homology
 3TQD A;  3R2W A;  2AGD A;  5C47 A;  4EEA A;  5C1G A;  2VK9 A;  4EE5 A;  5CMH A;  4D0Z A;  2V0K A;  4BMA A;  1ZJP A;  2BO6 A;  2RJ1 A;  4HO0 A;  3OKR A;  4P02 A;  1MP5 A;  4B5B A;  1LL2 A;  3I0J A;  2RIX A;  5AJN A;  2PX7 A;  3I0I X;  3EE5 A;  2P73 A;  2BO7 A;  1H5S C;  3ST8 A;  3I0D A;  4M4K A;  1FRW A;  1KWS A;  4D0T A;  2J0A A;  2A8W A;  1WVC A;  1GWV A;  1HM9 A;  4O6N A;  3FOQ A;  4ASJ A;  5C3D A;  4Y7V A;  1G23 A;  1MC3 A;  2OI6 A;  3JUK A;  3F1Y A;  3OH0 A;  4AYL A;  1NKH B;  2XWN A;  2AM3 A;  2AE7 A;  2ZU8 A;  1LL3 A;  1YP4 A;  5FTS A;  2CU2 A;  4HO8 A;  1VIC A;  1G0R A;  2VSI A;  4B42 A;  1NHE B;  5CMJ A;  3I0H A;  1LVW A;  1G97 A;  2FYD B;  5CMI A;  1JYK A;  3ZLL A;  3USR A;  1JVD A;  4FRL A;  2VXM A;  3OH1 A;  2AEC A;  2XMH A;  3SX3 A;  4EVW A;  5C4C A;  4MND A;  2X5Z A;  4FIY A;  2YCM A;  1H7H A;  4Y7G A;  2RJ6 A;  2RIT A;  1VGU A;  4HO9 A;  1TVY A;  2Z86 A;  5FTV A;  2O1G A;  1H7F A;  2Q4J A;  2I5K A;  1FO9 A;  1XZ6 A;  1R7X A;  4HO2 A;  1H4D A;  2WEE A;  3Q4S A;  3U2U A;  1INJ A;  1QGQ A;  1FZW A;  2RJ0 A;  5CMG X;  2WAW A;  1VZX A;  2X60 A;  1ZI3 A;  3DJ4 A;  3V8Z A;  4R7P A;  4HCQ A;  2Y7A A;  2Y4M A;  5C48 A;  1R82 A;  2OEF A;  5DDV A;  1EZI A;  4ARW A;  1FOA A;  2AM4 A;  1H7G A;  1QWJ A;  5CQN X;  3SX8 A;  1MP3 A;  3V0P A;  2PA4 A;  3IOI A;  1HM0 A;  4KT7 A;  4KC4 A;  3I0E A;  4FRE A;  4P00 A;  4G3P A;  2YC5 A;  4AYJ A;  3K8D A;  1S4P A;  3K8E A;  4Y6U A;  2YQH A;  5DDT A;  2XWM A;  2GGQ A;  3IOJ A;  2VSH A;  2ICY A;  5FU0 A;  4IRP A;  5D92 A;  1YP2 A;  4B4G A;  2RJ9 A;  4B2X A;  2D0J A;  1G3L A;  1ZJ3 A;  2X5S A;  5HS2 A;  4EE4 A;  5JQQ A;  2UX8 A;  3POL A;  3V0O A;  3SPT A;  4O6M A;  3T7O A;  1ON8 A;  1ZCV A;  4G3S A;  2VD4 A;  5CQL X;  3T7M A;  1ZHJ A;  2JCL A;  1H7E A;  2YC3 A;  4D11 C;  1R7Y A;  1FGX A;  5C1H A;  2XWL A;  3I0C A;  1I52 A;  1YP3 A;  2X65 A;  3HL3 A;  1FXO A;  4KPX A;  4NAK A;  1FXJ A;  2QH5 A;  1V83 A;  1OMX A;  4C2S A;  5C4F A;  5C4E A;  4HO6 A;  5EJZ A;  4MIX A;  2AES A;  1VH3 A;  4DEC A;  3IOH A;  3SXA A;  1ZJO A;  2WVL A;  4BQH A;  3SX7 A;  3V8Y A;  1G9R A;  3DK5 A;  3V0L A;  5L6S A;  1G1L A;  1JV3 A;  2JCK A;  5C36 A;  1HM8 A;  1ZI1 A;  5IDT A;  1E5K A;  2AH9 A;  2WVM A;  3PNN A;  3U2T A;  4KRV A;  2ZU7 A;  4NAN A;  3R3I A;  1WT2 A;  4EEO A;  4HO5 A;  2ICX A;  4M2A A;  4B2W A;  3T7N A;  3I0G A;  1VPA A;  2I5E A;  4EE3 A;  2MZB A;  4JD0 A;  1R7T A;  2BO4 A;  5C49 A;  2I7B A;  4EEG A;  1TZF A;  2OI5 A;  1NF5 B;  1ZDF A;  1PZY B;  4ZDQ A;  3SXB A;  2D7R A;  5I1F A;  1GX0 A;  4KNX A;  5IFY A;  5J49 A;  3SXC A;  3QVB A;  1FR8 A;  5CQP A;  3F1C A;  2Y4L A;  4Y6N A;  4JIS A;  3PKQ A;  2APC A;  5CMF X;  1O7Q A;  2AM5 A;  2RJ7 A;  1IIM A;  3U0X A;  4CJ8 A;  1LZ7 A;  2RIZ A;  1S4O A;  4AC3 A;  3PKP A;  3SXG A;  4FRA A;  4FRD A;  4KXO A;  2D7I A;  2V0L A;  1IIN A;  4FRM A;  3RMW A;  4KNR A;  2RJ8 A;  3D5N A;  3Q7U A;  2ZU9 A;  2JCO A;  4Y62 A;  1NQI B;  4G87 A;  4CJC A;  1QG8 A;  3U2V A;  4HOC A;  3GUE A;  1VGT A;  1MP4 A;  1QGS A;  3CGX A;  3CKN A;  1EYR A;  1LZJ A;  2W0W A;  1H5T B;  2QGI A;  4LW3 A;  1FGG A;  1JV1 A;  1TW1 A;  4D11 A;  3OH3 A;  2NXV A;  4Y64 A;  2VFZ A;  2PGV A;  2YQS A;  4B3U A;  3OC9 A;  4K6R A;  3U0Y A;  2WVK A;  3CKJ A;  3U2W A;  1W57 A;  1GQC A;  3I0K A;  1R81 A;  5C3A A;  1R80 A;  1R7V A;  3OH2 A;  3DUV A;  3U2X A;  3N9W A;  4FCE A;  2Z87 A;  4CJB A;  2BO8 A;  4HG6 A;  2QKX A;  3V0M A;  3SXE A;  1WSZ A;  4FRO A;  4ASY A;  2RJ5 A;  5D91 A;  1YRO B;  3ZLK A;  4G3Q A;  2XME A;  2A8U A;  1FG5 N;  4ECM A;  1NMM B;  2YQC A;  1W77 A;  1H4E A;  3V0Q A;  3Q80 A;  1HJJ A;  4HO3 A;  1XHB A;  2FYB A;  1VZT A;  5EJ1 A;  1O7O A;  2RJ4 A;  4IRQ A;  2Y6P A;  4L41 C;  1OMZ A;  1ZIZ A;  5CQO A;  2C0N A;  4FRB A;  3SXD A;  1GWW A;  4B4M A;  2V0H A;  4KQL A;  4GBP A;  3CKQ A;  5C4B A;  4NAI A;  2V0I A;  1JYL A;  5L6V A;  1H7T A;  1PZT A;  4DDZ A;  3V90 A;  1WT3 A;  1V84 A;  3V91 A;  1SS9 A;  2RIY A;  3KIA A;  5C4D A;  5AJP A;  1VH1 A;  1O23 B;  4LW6 A;  1ZCY A;  2FFU A;  2E8B A;  1H3M A;  2VS5 A;  5BXC A;  1TW5 A;  3ZGF A;  4FRP A;  4UEG A;  2DPW A;  4J18 A;  3OH4 A;  2Y4K A;  3CKV A;  1ZCT A;  3V0N A;  3SX5 A;  2PGY A;  2GGO A;  1V82 A;  2WGZ A;  1ZI5 A;  1HJL A;  4D48 A;  1HV9 A;  3ZGG A;  2WE9 A;  5C3B A;  2W0V A;  2VXL A;  4B4B A;  1FR9 A;  4XWI A;  4CVH A;  2E3D A;  4Y7T A;  1ZCU A;  1Z90 A;  5FYE A;  3NGW A;  3O3P A;  1G93 A;  2P72 A;  1H5S D;  1VM8 A;  3D8V A;  4Y9X A;  2FFV A;  4FQW A;  3I0F A;  2FY7 A;  1GA8 A;  2VS4 A;  4FRQ A;  1H7L A;  2Y4J A;  2FYC B;  2J0B A;  1H7Q A;  2P6W A;  1NWG B;  4FRH A;  3OGZ A;  3E25 A;  1W55 A;  3USQ A;  3RMV A;  5IDS A;  4NAL A;  5EIY A;  4Y7U A;  3LW6 A;  1GQ9 A;  1S4N A;  1ON6 A;  3CU0 A;  3ZF8 A;  4MYB A;  3BCV A;  1ZDG A;  1FO8 A;  1VGW A;  1INI A;  1O0R A;  2FYA A;  1ZI4 A;  1VGZ A;  2JCJ A;  2YES A;  5FU8 A;  1H5T A;  3JUJ A;  4Y63 A;  1LL0 A;  1K4V A;  4Q7C A;  1ZJ0 A;  2OEG A;  4YS8 A;  1R7U A;  1G95 A;  5FUH A;  4AAW A;  1WT0 A;  4E1K A;  4FCU A;  5FV9 A;  1H4C A;  5CQM X;  4KC1 A;  1LZ0 A;  2VS3 A;  5C38 A;  3I0L A;  4HO4 A;  3JTJ A;  1VZU A;  4Y7F A;  3BRK X;  4FIX A;  3RSB A;  1FWY A;  3E26 A;  2YQJ A;  1JVG A;  1WT1 A;  5C8R A;  2O1H A;  4M2B A;  1H5R B;  4KPZ A;  1H5S B;  4DE7 A;  1LZI A;  1ZJ2 A;  4EEM A;  3D98 A;  1G8O A;  1ZJ1 A;  1GX4 A;  2OI7 A;  3TZT A;  2O1F A;  4M28 A;  1H5R A;  5AJO A;  1H5S A;  1G2V A;  5C1L A;  1OQM B;  3FWW A;  2V0J A;  4KC2 A;  3OAM A;  3CKO A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...