1MP3A

L89t variant of s. enterica rmla
Total Genus 92
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
92
sequence length
289
structure length
289
Chain Sequence
MKTRKGIILAGGSGTRLYPVTMAVSQQLLPIYDKPMIYYPLSTLMLAGIRDILIISTPQDTPRFQQLLGDGSQWGLNLQYKVQPSPDGTAQAFIIGEEFIGHDDCALVLGDNIFYGHDLPKLMEAAVNKESGATVFAYHVNDPERYGVVEFDQAGTAVSLEEKPLQPKSNYAVTGLYFYDNSVVEMAKNLKPSARGELEITDINRIYMEQGRLSVAMMGRGYAWLDTGTHQSLIEASNFIATIEERQGLKVSCPEEIAFRKNFINAQQVIELAGPLSKNDYGKYLLKMV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords GLUCOSE-1-PHOSPHATE THYMIDYLYLTRANSFERASE
publication title Expanding pyrimidine diphosphosugar libraries via structure-based nucleotidylyltransferase engineering
pubmed doi rcsb
source organism Salmonella enterica
total genus 92
structure length 289
sequence length 289
chains with identical sequence B
ec nomenclature ec 2.7.7.24: Glucose-1-phosphate thymidylyltransferase.
pdb deposition date 2002-09-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00483 NTP_transferase Nucleotidyl transferase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.550.10 Alpha Beta Alpha-Beta Complex Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A 1mp3A00
3PNNA 4KRVA 1G2VA 1ZIZA 1ZCVA 2XWMA 3T7OA 1FGXA 2AE7A 1YROB 1MP4A 4FROA 3V0LA 2RJ5A 3O3PA 4FRPA 5AJNA 3OAMA 3USRA 4M28A 2XMEA 5C4BA 5L6SA 1R81A 2RIZA 3E25A 3OC9A 1G8OA 1H4EA 5C4CA 1ZJ2A 3K8EA 3OGZA 1H7QA 4NAKA 4ASYA 5CMJA 1ZI5A 2OI5A 3I0FA 1QGSA 4Y7GA 3I0CA 3RMVA 3QVBA 3Q4SA 3OKRA 2Y6PA 2OEGA 2RJ7A 2YC3A 1LZ7A 2O1GA 5CQOA 3N9WA 1FR9A 1KWSA 2I7BA 5IDSA 1H5SA 4L41C 2Z87A 1INIA 5FTVA 1FWYA 2RJ6A 4IRQA 3TZTA 1VZUA 1H5RA 4FRLA 3V8YA 4ASJA 1VGWA 1S4NA 3ZGGA 2WVLA 1R7UA 4BQHA 5C1LA 1EZIA 5C3AA 4XWIA 2AM5A 1TVYA 2RJ0A 1LL0A 3K8DA 2QGIA 2YESA 2UX8A 2JCLA 3U2WA 4B4BA 4Y9XA 1MP3A 2VSHA 2RJ1A 1LZIA 4ARWA 1ZJPA 3U0YA 3SXGA 1NF5B 1HM8A 3Q7UA 1ZDGA 2RIXA 3U2XA 1SS9A 4Y7VA 3SX5A 1VZTA 1ZJOA 2YC5A 5C4EA 4CJBA 2FYCB 4M2AA 3CGXA 3D8VA 1ZCUA 4B4MA 4EE5A 2VXLA 1G23A 1S4PA 1QG8A 2I5KA 5J49A 1ZHJA 1GQCA 3U2UA 1NQIB 1R7TA 2ZU8A 4FRAA 4B5BA 3CKOA 3RMWA 3V90A 4EEGA 4Y7UA 1LZ0A 3JUKA 2NXVA 1FO8A 4GBPA 2QKXA 1H7TA 1H5TB 4EE4A 1ZDFA 3CKJA 2AH9A 2VFZA 4KC1A 5FTSA 3ZLLA 1H4CA 2JCJA 2X5ZA 3V0PA 1H5SC 3I0JA 3IOIA 2E3DA 4DDZA 2OEFA 3DUVA 4G87A 4Y6UA 5EJ1A 4ZDQA 1NWGB 4FRDA 2Z86A 1R7YA 2VD4A 5EIYA 4Y7TA 3SXBA 1MP5A 4HCQA 4D0TA 4EEOA 2E8BA 4FRHA 1VH1A 2AM3A 2FFVA 3BRKX 3OH1A 1YP3A 3ZLKA 3T7MA 2QH5A 2VS5A 1H4DA 1V83A 1R82A 3V8ZA 5CMIA 4EE3A 2YQCA 4Y6NA 2JCKA 4Y62A 1H3MA 4AAWA 1GX4A 2BO6A 1VM8A 2FFUA 5C3BA 1NMMB 1JV1A 4B3UA 4KNRA 4HO5A 1H7HA 4DE7A 3R2WA 4J18A 3JTJA 5FV9A 1Z90A 3I0IX 1FXOA 4AYJA 3R3IA 4HO8A 1EYRA 1VZXA 4KPZA 3I0DA 2Y4KA 5L6VA 4HO2A 3SX8A 2BO4A 1ZJ1A 2Y7AA 2V0IA 2FYDB 1LZJA 5EJZA 1GWWA 3PKPA 4IRPA 5FYEA 4FCUA 4Y64A 1HV9A 2FYBA 1GX0A 3OH3A 2W0WA 4BMAA 2Y4LA 3CKQA 2PX7A 1ZJ0A 4M2BA 5CQNX 3FWWA 5C4FA 4EEAA 1FXJA 1TZFA 1WT2A 4YS8A 4G3PA 3V0NA 2V0KA 5C8RA 2W0VA 2P6WA 2BO7A 4MNDA 1G0RA 2OI7A 2P73A 4LW3A 1VICA 3EE5A 4JISA 1VGZA 1HM9A 2WAWA 2A8WA 4FRQA 4FREA 2VXMA 5DDVA 4Y63A 2WVMA 4G3SA 5AJOA 4D48A 1XHBA 1WSZA 2XWLA 4FRBA 4NAIA 3F1CA 3RSBA 1E5KA 1H5TA 4B42A 2VS4A 2WGZA 3SX7A 1V84A 2X5SA 1YP4A 1WT3A 1ON6A 3DJ4A 1MC3A 1FG5N 2RJ9A 3U0XA 3CKNA 1OMXA 3ZGFA 1JVDA 4HO6A 3USQA 2VS3A 5C38A 1IINA 2O1FA 1W77A 1ZI1A 4D0ZA 5BXCA 3CKVA 1G93A 3SX3A 1G1LA 1O0RA 5DDTA 4Y7FA 5C48A 3U2TA 3HL3A 1K4VA 3IOHA 3F1YA 2XMHA 1NHEB 2BO8A 1FO9A 3OH4A 3GUEA 4FCEA 3CU0A 3SXEA 1PZTA 2YCMA 3I0GA 2XWNA 2FYAA 3LW6A 4KXOA 4FRMA 3I0HA 2YQJA 2ICYA 5CQMX 3E26A 1O23B 1V82A 1JVGA 4K6RA 4MYBA 4D11A 5C1HA 2GGOA 3KIAA 2JCOA 2Y4MA 1ON8A 1JV3A 4KC2A 1W55A 1I52A 1ZI4A 2P72A 4UEGA 1G3LA 1WVCA 1ZCYA 1FOAA 1IIMA 1FGGA 1H5SD 2VSIA 3I0EA 1H7LA 3V0OA 4M4KA 3T7NA 4B2XA 1G9RA 4EVWA 4HO0A 2GGQA 5CQPA 2RIYA 2ZU7A 4KC4A 5AJPA 3SPTA 2I5EA 2AGDA 3D98A 2X60A 2V0JA 1LL2A 1G97A 1R7VA 4FQWA 4HO3A 3BCVA 1HJJA 1O7QA 4ECMA 1G95A 4EEMA 3V0QA 1QGQA 1WT0A 2V0LA 5IFYA 1LVWA 2RJ8A 1VGUA 2PGYA 3TQDA 2ZU9A 5CMHA 2FY7A 2D0JA 3SXAA 1WT1A 3U2VA 5HS2A 5JQQA 4JD0A 4B2WA 4C2SA 1H7GA 4HG6A 5I1FA 2PGVA 2MZBA 4E1KA 1ZJ3A 1VGTA 4D11C 2AM4A 2CU2A 1GWVA 1GQ9A 1FR8A 1R80A 1VH3A 4NANA 3Q80A 2RITA 1R7XA 4HO9A 1H5SB 5CMFX 3OH2A 4KNXA 1H5RB 2AESA 2WEEA 2RJ4A 1JYKA 1INJA 4R7PA 5C36A 1NKHB 3D5NA 2DPWA 4HO4A 2ICXA 1PZYB 1H7EA 4CJCA 2PA4A 4B4GA 1HJLA 3V91A 2AECA 4KT7A 3SXCA 1OQMB 2X65A 1H7FA 5FUHA 2D7RA 3IOJA 5C1GA 3OH0A 5CMGX 5C4DA 3ST8A 1HM0A 5FU0A 5C49A 3PKQA 4NALA 1W57A 3V0MA 3FOQA 2APCA 2D7IA 1YP2A 1GA8A 1ZI3A 4KQLA 2WVKA 1VPAA 2Q4JA 3I0KA 2Y4JA 2WE9A 1FZWA 4DECA 5CQLX 4CJ8A 5FU8A 4CVHA 3JUJA 1OMZA 1JYLA 2YQSA 4AC3A 5C47A 5IDTA 3SXDA 4AYLA 1O7OA 1FRWA 3POLA 1XZ6A 3DK5A 4G3QA 1ZCTA 5C3DA 3I0LA 1TW5A 1LL3A 1TW1A 4P02A 4P00A 4HOCA 2YQHA 3NGWA 2O1HA 1QWJA 2V0HA 2A8UA 3ZF8A 1S4OA 4KPXA 4LW6A 2OI6A
chains in the Genus database with same CATH superfamily
3PNNA 4KRVA 1G2VA 1ZIZA 1ZCVA 2XWMA 3T7OA 1FGXA 2AE7A 1YROB 1MP4A 4FROA 3V0LA 2RJ5A 3O3PA 4FRPA 5AJNA 3OAMA 3USRA 4M28A 2XMEA 5C4BA 5L6SA 1R81A 2RIZA 3E25A 3OC9A 1G8OA 1H4EA 5C4CA 1ZJ2A 3K8EA 3OGZA 1H7QA 4NAKA 4ASYA 5CMJA 1ZI5A 2OI5A 3I0FA 1QGSA 4Y7GA 3I0CA 3RMVA 3QVBA 3Q4SA 3OKRA 2Y6PA 2OEGA 2RJ7A 2YC3A 1LZ7A 2O1GA 5CQOA 3N9WA 1FR9A 1KWSA 2I7BA 5IDSA 1H5SA 4L41C 2Z87A 1INIA 5FTVA 1FWYA 2RJ6A 4IRQA 3TZTA 1VZUA 1H5RA 4FRLA 2VK9A 3V8YA 4ASJA 1VGWA 1S4NA 3ZGGA 2WVLA 1R7UA 4BQHA 5C1LA 1EZIA 5C3AA 4XWIA 2AM5A 1TVYA 2RJ0A 1LL0A 2J0BA 3K8DA 2QGIA 2YESA 2UX8A 2JCLA 3U2WA 4B4BA 4Y9XA 1MP3A 2VSHA 2RJ1A 1LZIA 4ARWA 1ZJPA 3U0YA 3SXGA 1NF5B 1HM8A 3Q7UA 1ZDGA 2RIXA 3U2XA 1SS9A 4FIXA 4Y7VA 3SX5A 1VZTA 1ZJOA 2YC5A 5C4EA 4CJBA 2FYCB 4M2AA 3CGXA 3D8VA 1ZCUA 4B4MA 4EE5A 2VXLA 1G23A 1S4PA 1QG8A 2I5KA 5J49A 1ZHJA 1GQCA 3U2UA 1NQIB 1R7TA 2ZU8A 4FRAA 4B5BA 3CKOA 3RMWA 3V90A 4EEGA 4Y7UA 1LZ0A 3JUKA 2NXVA 1FO8A 4GBPA 2QKXA 1H7TA 1H5TB 4O6MA 4EE4A 1ZDFA 3CKJA 2AH9A 2VFZA 4KC1A 5FTSA 3ZLLA 1H4CA 2JCJA 2X5ZA 3V0PA 1H5SC 3I0JA 3IOIA 2E3DA 4DDZA 2OEFA 3DUVA 4G87A 4Y6UA 4FIYA 5EJ1A 4ZDQA 1NWGB 4FRDA 2Z86A 1R7YA 2VD4A 5EIYA 4Y7TA 3SXBA 1MP5A 4HCQA 4D0TA 4EEOA 2E8BA 4FRHA 1VH1A 2AM3A 2FFVA 3BRKX 3OH1A 1YP3A 3ZLKA 3T7MA 2QH5A 2VS5A 1H4DA 1V83A 1R82A 3V8ZA 5CMIA 4EE3A 2YQCA 4Y6NA 2JCKA 4Y62A 1H3MA 4AAWA 1GX4A 2BO6A 1VM8A 2FFUA 5C3BA 1NMMB 1JV1A 4B3UA 4KNRA 4HO5A 1H7HA 4DE7A 3R2WA 4J18A 3JTJA 5FV9A 1Z90A 3I0IX 1FXOA 4AYJA 3R3IA 4HO8A 1EYRA 1VZXA 4KPZA 3I0DA 2Y4KA 5L6VA 4HO2A 3SX8A 2BO4A 1ZJ1A 2C0NA 2Y7AA 2V0IA 2FYDB 1LZJA 5EJZA 1GWWA 3PKPA 4IRPA 5FYEA 4FCUA 4Y64A 1HV9A 2FYBA 1GX0A 3OH3A 2W0WA 5D92A 4BMAA 2Y4LA 3CKQA 2PX7A 1ZJ0A 4M2BA 5CQNX 3FWWA 5C4FA 4EEAA 1FXJA 1TZFA 1WT2A 4YS8A 4G3PA 3V0NA 2V0KA 5C8RA 2W0VA 2P6WA 2BO7A 4MNDA 1G0RA 2OI7A 2P73A 4LW3A 1VICA 3EE5A 4JISA 1VGZA 1HM9A 2WAWA 2A8WA 4FRQA 4FREA 2VXMA 5DDVA 4Y63A 2WVMA 4O6NA 4G3SA 5AJOA 4D48A 1XHBA 1WSZA 2XWLA 4FRBA 4NAIA 3F1CA 3RSBA 1E5KA 1H5TA 4B42A 2VS4A 2WGZA 3SX7A 1V84A 2X5SA 1YP4A 1WT3A 1ON6A 3DJ4A 1MC3A 1FG5N 2RJ9A 3U0XA 3CKNA 1OMXA 3ZGFA 1JVDA 4HO6A 3USQA 2VS3A 5C38A 1IINA 2O1FA 1W77A 1ZI1A 4D0ZA 5BXCA 3CKVA 1G93A 3SX3A 1G1LA 1O0RA 5DDTA 4Y7FA 5C48A 3U2TA 3HL3A 1K4VA 4MIXA 3IOHA 3F1YA 2XMHA 1NHEB 2BO8A 1FO9A 3OH4A 3GUEA 4FCEA 3CU0A 3SXEA 1PZTA 2YCMA 3I0GA 2XWNA 2FYAA 3LW6A 4KXOA 4FRMA 3I0HA 2YQJA 2ICYA 5CQMX 3E26A 1O23B 1V82A 1JVGA 4K6RA 4MYBA 4D11A 5C1HA 2GGOA 3KIAA 2JCOA 2Y4MA 1ON8A 1JV3A 4KC2A 1W55A 1I52A 1ZI4A 2P72A 4UEGA 1G3LA 1WVCA 1ZCYA 1FOAA 1IIMA 1FGGA 1H5SD 2VSIA 3I0EA 1H7LA 3V0OA 4M4KA 3T7NA 4B2XA 1G9RA 4EVWA 2J0AA 4HO0A 2GGQA 5CQPA 2RIYA 2ZU7A 4KC4A 5AJPA 3SPTA 2I5EA 2AGDA 3D98A 2X60A 2V0JA 1LL2A 1G97A 1R7VA 4FQWA 4HO3A 3BCVA 1HJJA 1O7QA 4ECMA 1G95A 4EEMA 3V0QA 1QGQA 1WT0A 2V0LA 5IFYA 1LVWA 2RJ8A 1VGUA 2PGYA 3TQDA 2ZU9A 5CMHA 2FY7A 2D0JA 3SXAA 1WT1A 3U2VA 5HS2A 5JQQA 4JD0A 4B2WA 4C2SA 1H7GA 4HG6A 5I1FA 2PGVA 4Q7CA 2MZBA 4E1KA 1ZJ3A 1VGTA 4D11C 2AM4A 2CU2A 1GWVA 1GQ9A 1FR8A 1R80A 1VH3A 4NANA 3Q80A 2RITA 1R7XA 4HO9A 1H5SB 5CMFX 3OH2A 4KNXA 1H5RB 2AESA 2WEEA 2RJ4A 1JYKA 1INJA 4R7PA 5C36A 1NKHB 3D5NA 2DPWA 4HO4A 2ICXA 1PZYB 1H7EA 4CJCA 2PA4A 4B4GA 1HJLA 3V91A 2AECA 4KT7A 3SXCA 1OQMB 2X65A 1H7FA 5FUHA 2D7RA 3IOJA 5C1GA 3OH0A 5CMGX 5C4DA 3ST8A 1HM0A 5FU0A 5C49A 3PKQA 4NALA 1W57A 3V0MA 3FOQA 2APCA 2D7IA 1YP2A 1GA8A 1ZI3A 4KQLA 2WVKA 1VPAA 2Q4JA 3I0KA 2Y4JA 2WE9A 1FZWA 4DECA 5CQLX 4CJ8A 5FU8A 4CVHA 3JUJA 1OMZA 1JYLA 2YQSA 5D91A 5C47A 4AC3A 5IDTA 3SXDA 4AYLA 1O7OA 1FRWA 3POLA 1XZ6A 3DK5A 4G3QA 1ZCTA 5C3DA 3I0LA 1TW5A 1LL3A 1TW1A 4P02A 4P00A 4HOCA 2YQHA 3NGWA 2O1HA 1QWJA 2V0HA 2A8UA 3ZF8A 1S4OA 4KPXA 4LW6A 2OI6A
chains in the Genus database with same CATH topology
3PNNA 4KRVA 1G2VA 1ZIZA 1ZCVA 2XWMA 3T7OA 1FGXA 2AE7A 1YROB 1MP4A 4FROA 3V0LA 2RJ5A 3O3PA 4FRPA 5AJNA 3OAMA 3USRA 4M28A 2XMEA 5C4BA 5L6SA 1R81A 2RIZA 3E25A 3OC9A 1G8OA 1H4EA 5C4CA 1ZJ2A 3K8EA 3OGZA 1H7QA 4NAKA 4ASYA 5CMJA 1ZI5A 2OI5A 3I0FA 1QGSA 4Y7GA 3I0CA 3RMVA 3QVBA 3Q4SA 3OKRA 2Y6PA 2OEGA 2RJ7A 2YC3A 1LZ7A 2O1GA 5CQOA 3N9WA 1FR9A 1KWSA 2I7BA 5IDSA 1H5SA 4L41C 2Z87A 1INIA 5FTVA 1FWYA 2RJ6A 4IRQA 3TZTA 1VZUA 1H5RA 4FRLA 2VK9A 3V8YA 4ASJA 1VGWA 1S4NA 3ZGGA 2WVLA 1R7UA 4BQHA 5C1LA 1EZIA 5C3AA 4XWIA 2AM5A 1TVYA 2RJ0A 1LL0A 2J0BA 3K8DA 2QGIA 2YESA 2UX8A 2JCLA 3U2WA 4B4BA 4Y9XA 1MP3A 2VSHA 2RJ1A 1LZIA 4ARWA 1ZJPA 3U0YA 3SXGA 1NF5B 1HM8A 3Q7UA 1ZDGA 2RIXA 3U2XA 1SS9A 4FIXA 4Y7VA 3SX5A 1VZTA 1ZJOA 2YC5A 5C4EA 4CJBA 2FYCB 4M2AA 3CGXA 3D8VA 1ZCUA 4B4MA 4EE5A 2VXLA 1G23A 1S4PA 1QG8A 2I5KA 5J49A 1ZHJA 1GQCA 3U2UA 1NQIB 1R7TA 2ZU8A 4FRAA 4B5BA 3CKOA 3RMWA 3V90A 4EEGA 4Y7UA 1LZ0A 3JUKA 2NXVA 1FO8A 4GBPA 2QKXA 1H7TA 1H5TB 4O6MA 4EE4A 1ZDFA 3CKJA 2AH9A 2VFZA 4KC1A 5FTSA 3ZLLA 1H4CA 2JCJA 2X5ZA 3V0PA 1H5SC 3I0JA 3IOIA 2E3DA 4DDZA 2OEFA 3DUVA 4G87A 4Y6UA 4FIYA 5EJ1A 4ZDQA 1NWGB 4FRDA 2Z86A 1R7YA 2VD4A 5EIYA 4Y7TA 3SXBA 1MP5A 4HCQA 4D0TA 4EEOA 2E8BA 4FRHA 1VH1A 2AM3A 2FFVA 3BRKX 3OH1A 1YP3A 3ZLKA 3T7MA 2QH5A 2VS5A 1H4DA 1V83A 1R82A 3V8ZA 5CMIA 4EE3A 2YQCA 4Y6NA 2JCKA 4Y62A 1H3MA 4AAWA 1GX4A 2BO6A 1VM8A 2FFUA 5C3BA 1NMMB 1JV1A 4B3UA 4KNRA 4HO5A 1H7HA 4DE7A 3R2WA 4J18A 3JTJA 5FV9A 1Z90A 3I0IX 1FXOA 4AYJA 3R3IA 4HO8A 1EYRA 1VZXA 4KPZA 3I0DA 2Y4KA 5L6VA 4HO2A 3SX8A 2BO4A 1ZJ1A 2C0NA 2Y7AA 2V0IA 2FYDB 1LZJA 5EJZA 1GWWA 3PKPA 4IRPA 5FYEA 4FCUA 4Y64A 1HV9A 2FYBA 1GX0A 3OH3A 2W0WA 5D92A 4BMAA 2Y4LA 3CKQA 2PX7A 1ZJ0A 4M2BA 5CQNX 3FWWA 5C4FA 4EEAA 1FXJA 1TZFA 1WT2A 4YS8A 4G3PA 3V0NA 2V0KA 5C8RA 2W0VA 2P6WA 2BO7A 4MNDA 1G0RA 2OI7A 2P73A 4LW3A 1VICA 3EE5A 4JISA 1VGZA 1HM9A 2WAWA 2A8WA 4FRQA 4FREA 2VXMA 5DDVA 4Y63A 2WVMA 4O6NA 4G3SA 5AJOA 4D48A 1XHBA 1WSZA 2XWLA 4FRBA 4NAIA 3F1CA 3RSBA 1E5KA 1H5TA 4B42A 2VS4A 2WGZA 3SX7A 1V84A 2X5SA 1YP4A 1WT3A 1ON6A 3DJ4A 1MC3A 1FG5N 2RJ9A 3U0XA 3CKNA 1OMXA 3ZGFA 1JVDA 4HO6A 3USQA 2VS3A 5C38A 1IINA 2O1FA 1W77A 1ZI1A 4D0ZA 5BXCA 3CKVA 1G93A 3SX3A 1G1LA 1O0RA 5DDTA 4Y7FA 5C48A 3U2TA 3HL3A 1K4VA 4MIXA 3IOHA 3F1YA 2XMHA 1NHEB 2BO8A 1FO9A 3OH4A 3GUEA 4FCEA 3CU0A 3SXEA 1PZTA 2YCMA 3I0GA 2XWNA 2FYAA 3LW6A 4KXOA 4FRMA 3I0HA 2YQJA 2ICYA 5CQMX 3E26A 1O23B 1V82A 1JVGA 4K6RA 4MYBA 4D11A 5C1HA 2GGOA 3KIAA 2JCOA 2Y4MA 1ON8A 1JV3A 4KC2A 1W55A 1I52A 1ZI4A 2P72A 4UEGA 1G3LA 1WVCA 1ZCYA 1FOAA 1IIMA 1FGGA 1H5SD 2VSIA 3I0EA 1H7LA 3V0OA 4M4KA 3T7NA 4B2XA 1G9RA 4EVWA 2J0AA 4HO0A 2GGQA 5CQPA 2RIYA 2ZU7A 4KC4A 5AJPA 3SPTA 2I5EA 2AGDA 3D98A 2X60A 2V0JA 1LL2A 1G97A 1R7VA 4FQWA 4HO3A 3BCVA 1HJJA 1O7QA 4ECMA 1G95A 4EEMA 3V0QA 1QGQA 1WT0A 2V0LA 5IFYA 1LVWA 2RJ8A 1VGUA 2PGYA 3TQDA 2ZU9A 5CMHA 2FY7A 2D0JA 3SXAA 1WT1A 3U2VA 5HS2A 5JQQA 4JD0A 4B2WA 4C2SA 1H7GA 4HG6A 5I1FA 2PGVA 4Q7CA 2MZBA 4E1KA 1ZJ3A 1VGTA 4D11C 2AM4A 2CU2A 1GWVA 1GQ9A 1FR8A 1R80A 1VH3A 4NANA 3Q80A 2RITA 1R7XA 4HO9A 1H5SB 5CMFX 3OH2A 4KNXA 1H5RB 2AESA 2WEEA 2RJ4A 1JYKA 1INJA 4R7PA 5C36A 1NKHB 3D5NA 2DPWA 4HO4A 2ICXA 1PZYB 1H7EA 4CJCA 2PA4A 4B4GA 1HJLA 3V91A 2AECA 4KT7A 3SXCA 1OQMB 2X65A 1H7FA 5FUHA 2D7RA 3IOJA 5C1GA 3OH0A 5CMGX 5C4DA 3ST8A 1HM0A 5FU0A 5C49A 3PKQA 4NALA 1W57A 3V0MA 3FOQA 2APCA 2D7IA 1YP2A 1GA8A 1ZI3A 4KQLA 2WVKA 1VPAA 2Q4JA 3I0KA 2Y4JA 2WE9A 1FZWA 4DECA 5CQLX 4CJ8A 5FU8A 4CVHA 3JUJA 1OMZA 1JYLA 2YQSA 5D91A 5C47A 4AC3A 5IDTA 3SXDA 4AYLA 1O7OA 1FRWA 3POLA 1XZ6A 3DK5A 4G3QA 1ZCTA 5C3DA 3I0LA 1TW5A 1LL3A 1TW1A 4P02A 4P00A 4HOCA 2YQHA 3NGWA 2O1HA 1QWJA 2V0HA 2A8UA 3ZF8A 1S4OA 4KPXA 4LW6A 2OI6A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3PNN A;  4KRV A;  1G2V A;  1ZIZ A;  1ZCV A;  2XWM A;  3T7O A;  1FGX A;  2AE7 A;  1YRO B;  1MP4 A;  4FRO A;  3V0L A;  2RJ5 A;  3O3P A;  4FRP A;  5AJN A;  3OAM A;  3USR A;  4M28 A;  2XME A;  5C4B A;  5L6S A;  1R81 A;  2RIZ A;  3E25 A;  3OC9 A;  1G8O A;  1H4E A;  5C4C A;  1ZJ2 A;  3K8E A;  3OGZ A;  1H7Q A;  4NAK A;  4ASY A;  5CMJ A;  1ZI5 A;  2OI5 A;  3I0F A;  1QGS A;  4Y7G A;  3I0C A;  3RMV A;  3QVB A;  3Q4S A;  3OKR A;  2Y6P A;  2OEG A;  2RJ7 A;  2YC3 A;  1LZ7 A;  2O1G A;  5CQO A;  3N9W A;  1FR9 A;  1KWS A;  2I7B A;  5IDS A;  1H5S A;  4L41 C;  2Z87 A;  1INI A;  5FTV A;  1FWY A;  2RJ6 A;  4IRQ A;  3TZT A;  1VZU A;  1H5R A;  4FRL A;  3V8Y A;  4ASJ A;  1VGW A;  1S4N A;  3ZGG A;  2WVL A;  1R7U A;  4BQH A;  5C1L A;  1EZI A;  5C3A A;  4XWI A;  2AM5 A;  1TVY A;  2RJ0 A;  1LL0 A;  3K8D A;  2QGI A;  2YES A;  2UX8 A;  2JCL A;  3U2W A;  4B4B A;  4Y9X A;  1MP3 A;  2VSH A;  2RJ1 A;  1LZI A;  4ARW A;  1ZJP A;  3U0Y A;  3SXG A;  1NF5 B;  1HM8 A;  3Q7U A;  1ZDG A;  2RIX A;  3U2X A;  1SS9 A;  4Y7V A;  3SX5 A;  1VZT A;  1ZJO A;  2YC5 A;  5C4E A;  4CJB A;  2FYC B;  4M2A A;  3CGX A;  3D8V A;  1ZCU A;  4B4M A;  4EE5 A;  2VXL A;  1G23 A;  1S4P A;  1QG8 A;  2I5K A;  5J49 A;  1ZHJ A;  1GQC A;  3U2U A;  1NQI B;  1R7T A;  2ZU8 A;  4FRA A;  4B5B A;  3CKO A;  3RMW A;  3V90 A;  4EEG A;  4Y7U A;  1LZ0 A;  3JUK A;  2NXV A;  1FO8 A;  4GBP A;  2QKX A;  1H7T A;  1H5T B;  4EE4 A;  1ZDF A;  3CKJ A;  2AH9 A;  2VFZ A;  4KC1 A;  5FTS A;  3ZLL A;  1H4C A;  2JCJ A;  2X5Z A;  3V0P A;  1H5S C;  3I0J A;  3IOI A;  2E3D A;  4DDZ A;  2OEF A;  3DUV A;  4G87 A;  4Y6U A;  5EJ1 A;  4ZDQ A;  1NWG B;  4FRD A;  2Z86 A;  1R7Y A;  2VD4 A;  5EIY A;  4Y7T A;  3SXB A;  1MP5 A;  4HCQ A;  4D0T A;  4EEO A;  2E8B A;  4FRH A;  1VH1 A;  2AM3 A;  2FFV A;  3BRK X;  3OH1 A;  1YP3 A;  3ZLK A;  3T7M A;  2QH5 A;  2VS5 A;  1H4D A;  1V83 A;  1R82 A;  3V8Z A;  5CMI A;  4EE3 A;  2YQC A;  4Y6N A;  2JCK A;  4Y62 A;  1H3M A;  4AAW A;  1GX4 A;  2BO6 A;  1VM8 A;  2FFU A;  5C3B A;  1NMM B;  1JV1 A;  4B3U A;  4KNR A;  4HO5 A;  1H7H A;  4DE7 A;  3R2W A;  4J18 A;  3JTJ A;  5FV9 A;  1Z90 A;  3I0I X;  1FXO A;  4AYJ A;  3R3I A;  4HO8 A;  1EYR A;  1VZX A;  4KPZ A;  3I0D A;  2Y4K A;  5L6V A;  4HO2 A;  3SX8 A;  2BO4 A;  1ZJ1 A;  2Y7A A;  2V0I A;  2FYD B;  1LZJ A;  5EJZ A;  1GWW A;  3PKP A;  4IRP A;  5FYE A;  4FCU A;  4Y64 A;  1HV9 A;  2FYB A;  1GX0 A;  3OH3 A;  2W0W A;  4BMA A;  2Y4L A;  3CKQ A;  2PX7 A;  1ZJ0 A;  4M2B A;  5CQN X;  3FWW A;  5C4F A;  4EEA A;  1FXJ A;  1TZF A;  1WT2 A;  4YS8 A;  4G3P A;  3V0N A;  2V0K A;  5C8R A;  2W0V A;  2P6W A;  2BO7 A;  4MND A;  1G0R A;  2OI7 A;  2P73 A;  4LW3 A;  1VIC A;  3EE5 A;  4JIS A;  1VGZ A;  1HM9 A;  2WAW A;  2A8W A;  4FRQ A;  4FRE A;  2VXM A;  5DDV A;  4Y63 A;  2WVM A;  4G3S A;  5AJO A;  4D48 A;  1XHB A;  1WSZ A;  2XWL A;  4FRB A;  4NAI A;  3F1C A;  3RSB A;  1E5K A;  1H5T A;  4B42 A;  2VS4 A;  2WGZ A;  3SX7 A;  1V84 A;  2X5S A;  1YP4 A;  1WT3 A;  1ON6 A;  3DJ4 A;  1MC3 A;  1FG5 N;  2RJ9 A;  3U0X A;  3CKN A;  1OMX A;  3ZGF A;  1JVD A;  4HO6 A;  3USQ A;  2VS3 A;  5C38 A;  1IIN A;  2O1F A;  1W77 A;  1ZI1 A;  4D0Z A;  5BXC A;  3CKV A;  1G93 A;  3SX3 A;  1G1L A;  1O0R A;  5DDT A;  4Y7F A;  5C48 A;  3U2T A;  3HL3 A;  1K4V A;  3IOH A;  3F1Y A;  2XMH A;  1NHE B;  2BO8 A;  1FO9 A;  3OH4 A;  3GUE A;  4FCE A;  3CU0 A;  3SXE A;  1PZT A;  2YCM A;  3I0G A;  2XWN A;  2FYA A;  3LW6 A;  4KXO A;  4FRM A;  3I0H A;  2YQJ A;  2ICY A;  5CQM X;  3E26 A;  1O23 B;  1V82 A;  1JVG A;  4K6R A;  4MYB A;  4D11 A;  5C1H A;  2GGO A;  3KIA A;  2JCO A;  2Y4M A;  1ON8 A;  1JV3 A;  4KC2 A;  1W55 A;  1I52 A;  1ZI4 A;  2P72 A;  4UEG A;  1G3L A;  1WVC A;  1ZCY A;  1FOA A;  1IIM A;  1FGG A;  1H5S D;  2VSI A;  3I0E A;  1H7L A;  3V0O A;  4M4K A;  3T7N A;  4B2X A;  1G9R A;  4EVW A;  4HO0 A;  2GGQ A;  5CQP A;  2RIY A;  2ZU7 A;  4KC4 A;  5AJP A;  3SPT A;  2I5E A;  2AGD A;  3D98 A;  2X60 A;  2V0J A;  1LL2 A;  1G97 A;  1R7V A;  4FQW A;  4HO3 A;  3BCV A;  1HJJ A;  1O7Q A;  4ECM A;  1G95 A;  4EEM A;  3V0Q A;  1QGQ A;  1WT0 A;  2V0L A;  5IFY A;  1LVW A;  2RJ8 A;  1VGU A;  2PGY A;  3TQD A;  2ZU9 A;  5CMH A;  2FY7 A;  2D0J A;  3SXA A;  1WT1 A;  3U2V A;  5HS2 A;  5JQQ A;  4JD0 A;  4B2W A;  4C2S A;  1H7G A;  4HG6 A;  5I1F A;  2PGV A;  2MZB A;  4E1K A;  1ZJ3 A;  1VGT A;  4D11 C;  2AM4 A;  2CU2 A;  1GWV A;  1GQ9 A;  1FR8 A;  1R80 A;  1VH3 A;  4NAN A;  3Q80 A;  2RIT A;  1R7X A;  4HO9 A;  1H5S B;  5CMF X;  3OH2 A;  4KNX A;  1H5R B;  2AES A;  2WEE A;  2RJ4 A;  1JYK A;  1INJ A;  4R7P A;  5C36 A;  1NKH B;  3D5N A;  2DPW A;  4HO4 A;  2ICX A;  1PZY B;  1H7E A;  4CJC A;  2PA4 A;  4B4G A;  1HJL A;  3V91 A;  2AEC A;  4KT7 A;  3SXC A;  1OQM B;  2X65 A;  1H7F A;  5FUH A;  2D7R A;  3IOJ A;  5C1G A;  3OH0 A;  5CMG X;  5C4D A;  3ST8 A;  1HM0 A;  5FU0 A;  5C49 A;  3PKQ A;  4NAL A;  1W57 A;  3V0M A;  3FOQ A;  2APC A;  2D7I A;  1YP2 A;  1GA8 A;  1ZI3 A;  4KQL A;  2WVK A;  1VPA A;  2Q4J A;  3I0K A;  2Y4J A;  2WE9 A;  1FZW A;  4DEC A;  5CQL X;  4CJ8 A;  5FU8 A;  4CVH A;  3JUJ A;  1OMZ A;  1JYL A;  2YQS A;  4AC3 A;  5C47 A;  5IDT A;  3SXD A;  4AYL A;  1O7O A;  1FRW A;  3POL A;  1XZ6 A;  3DK5 A;  4G3Q A;  1ZCT A;  5C3D A;  3I0L A;  1TW5 A;  1LL3 A;  1TW1 A;  4P02 A;  4P00 A;  4HOC A;  2YQH A;  3NGW A;  2O1H A;  1QWJ A;  2V0H A;  2A8U A;  3ZF8 A;  1S4O A;  4KPX A;  4LW6 A;  2OI6 A; 
#chains in the Genus database with same CATH topology
 3PNN A;  4KRV A;  1G2V A;  1ZIZ A;  1ZCV A;  2XWM A;  3T7O A;  1FGX A;  2AE7 A;  1YRO B;  1MP4 A;  4FRO A;  3V0L A;  2RJ5 A;  3O3P A;  4FRP A;  5AJN A;  3OAM A;  3USR A;  4M28 A;  2XME A;  5C4B A;  5L6S A;  1R81 A;  2RIZ A;  3E25 A;  3OC9 A;  1G8O A;  1H4E A;  5C4C A;  1ZJ2 A;  3K8E A;  3OGZ A;  1H7Q A;  4NAK A;  4ASY A;  5CMJ A;  1ZI5 A;  2OI5 A;  3I0F A;  1QGS A;  4Y7G A;  3I0C A;  3RMV A;  3QVB A;  3Q4S A;  3OKR A;  2Y6P A;  2OEG A;  2RJ7 A;  2YC3 A;  1LZ7 A;  2O1G A;  5CQO A;  3N9W A;  1FR9 A;  1KWS A;  2I7B A;  5IDS A;  1H5S A;  4L41 C;  2Z87 A;  1INI A;  5FTV A;  1FWY A;  2RJ6 A;  4IRQ A;  3TZT A;  1VZU A;  1H5R A;  4FRL A;  2VK9 A;  3V8Y A;  4ASJ A;  1VGW A;  1S4N A;  3ZGG A;  2WVL A;  1R7U A;  4BQH A;  5C1L A;  1EZI A;  5C3A A;  4XWI A;  2AM5 A;  1TVY A;  2RJ0 A;  1LL0 A;  2J0B A;  3K8D A;  2QGI A;  2YES A;  2UX8 A;  2JCL A;  3U2W A;  4B4B A;  4Y9X A;  1MP3 A;  2VSH A;  2RJ1 A;  1LZI A;  4ARW A;  1ZJP A;  3U0Y A;  3SXG A;  1NF5 B;  1HM8 A;  3Q7U A;  1ZDG A;  2RIX A;  3U2X A;  1SS9 A;  4FIX A;  4Y7V A;  3SX5 A;  1VZT A;  1ZJO A;  2YC5 A;  5C4E A;  4CJB A;  2FYC B;  4M2A A;  3CGX A;  3D8V A;  1ZCU A;  4B4M A;  4EE5 A;  2VXL A;  1G23 A;  1S4P A;  1QG8 A;  2I5K A;  5J49 A;  1ZHJ A;  1GQC A;  3U2U A;  1NQI B;  1R7T A;  2ZU8 A;  4FRA A;  4B5B A;  3CKO A;  3RMW A;  3V90 A;  4EEG A;  4Y7U A;  1LZ0 A;  3JUK A;  2NXV A;  1FO8 A;  4GBP A;  2QKX A;  1H7T A;  1H5T B;  4O6M A;  4EE4 A;  1ZDF A;  3CKJ A;  2AH9 A;  2VFZ A;  4KC1 A;  5FTS A;  3ZLL A;  1H4C A;  2JCJ A;  2X5Z A;  3V0P A;  1H5S C;  3I0J A;  3IOI A;  2E3D A;  4DDZ A;  2OEF A;  3DUV A;  4G87 A;  4Y6U A;  4FIY A;  5EJ1 A;  4ZDQ A;  1NWG B;  4FRD A;  2Z86 A;  1R7Y A;  2VD4 A;  5EIY A;  4Y7T A;  3SXB A;  1MP5 A;  4HCQ A;  4D0T A;  4EEO A;  2E8B A;  4FRH A;  1VH1 A;  2AM3 A;  2FFV A;  3BRK X;  3OH1 A;  1YP3 A;  3ZLK A;  3T7M A;  2QH5 A;  2VS5 A;  1H4D A;  1V83 A;  1R82 A;  3V8Z A;  5CMI A;  4EE3 A;  2YQC A;  4Y6N A;  2JCK A;  4Y62 A;  1H3M A;  4AAW A;  1GX4 A;  2BO6 A;  1VM8 A;  2FFU A;  5C3B A;  1NMM B;  1JV1 A;  4B3U A;  4KNR A;  4HO5 A;  1H7H A;  4DE7 A;  3R2W A;  4J18 A;  3JTJ A;  5FV9 A;  1Z90 A;  3I0I X;  1FXO A;  4AYJ A;  3R3I A;  4HO8 A;  1EYR A;  1VZX A;  4KPZ A;  3I0D A;  2Y4K A;  5L6V A;  4HO2 A;  3SX8 A;  2BO4 A;  1ZJ1 A;  2C0N A;  2Y7A A;  2V0I A;  2FYD B;  1LZJ A;  5EJZ A;  1GWW A;  3PKP A;  4IRP A;  5FYE A;  4FCU A;  4Y64 A;  1HV9 A;  2FYB A;  1GX0 A;  3OH3 A;  2W0W A;  5D92 A;  4BMA A;  2Y4L A;  3CKQ A;  2PX7 A;  1ZJ0 A;  4M2B A;  5CQN X;  3FWW A;  5C4F A;  4EEA A;  1FXJ A;  1TZF A;  1WT2 A;  4YS8 A;  4G3P A;  3V0N A;  2V0K A;  5C8R A;  2W0V A;  2P6W A;  2BO7 A;  4MND A;  1G0R A;  2OI7 A;  2P73 A;  4LW3 A;  1VIC A;  3EE5 A;  4JIS A;  1VGZ A;  1HM9 A;  2WAW A;  2A8W A;  4FRQ A;  4FRE A;  2VXM A;  5DDV A;  4Y63 A;  2WVM A;  4O6N A;  4G3S A;  5AJO A;  4D48 A;  1XHB A;  1WSZ A;  2XWL A;  4FRB A;  4NAI A;  3F1C A;  3RSB A;  1E5K A;  1H5T A;  4B42 A;  2VS4 A;  2WGZ A;  3SX7 A;  1V84 A;  2X5S A;  1YP4 A;  1WT3 A;  1ON6 A;  3DJ4 A;  1MC3 A;  1FG5 N;  2RJ9 A;  3U0X A;  3CKN A;  1OMX A;  3ZGF A;  1JVD A;  4HO6 A;  3USQ A;  2VS3 A;  5C38 A;  1IIN A;  2O1F A;  1W77 A;  1ZI1 A;  4D0Z A;  5BXC A;  3CKV A;  1G93 A;  3SX3 A;  1G1L A;  1O0R A;  5DDT A;  4Y7F A;  5C48 A;  3U2T A;  3HL3 A;  1K4V A;  4MIX A;  3IOH A;  3F1Y A;  2XMH A;  1NHE B;  2BO8 A;  1FO9 A;  3OH4 A;  3GUE A;  4FCE A;  3CU0 A;  3SXE A;  1PZT A;  2YCM A;  3I0G A;  2XWN A;  2FYA A;  3LW6 A;  4KXO A;  4FRM A;  3I0H A;  2YQJ A;  2ICY A;  5CQM X;  3E26 A;  1O23 B;  1V82 A;  1JVG A;  4K6R A;  4MYB A;  4D11 A;  5C1H A;  2GGO A;  3KIA A;  2JCO A;  2Y4M A;  1ON8 A;  1JV3 A;  4KC2 A;  1W55 A;  1I52 A;  1ZI4 A;  2P72 A;  4UEG A;  1G3L A;  1WVC A;  1ZCY A;  1FOA A;  1IIM A;  1FGG A;  1H5S D;  2VSI A;  3I0E A;  1H7L A;  3V0O A;  4M4K A;  3T7N A;  4B2X A;  1G9R A;  4EVW A;  2J0A A;  4HO0 A;  2GGQ A;  5CQP A;  2RIY A;  2ZU7 A;  4KC4 A;  5AJP A;  3SPT A;  2I5E A;  2AGD A;  3D98 A;  2X60 A;  2V0J A;  1LL2 A;  1G97 A;  1R7V A;  4FQW A;  4HO3 A;  3BCV A;  1HJJ A;  1O7Q A;  4ECM A;  1G95 A;  4EEM A;  3V0Q A;  1QGQ A;  1WT0 A;  2V0L A;  5IFY A;  1LVW A;  2RJ8 A;  1VGU A;  2PGY A;  3TQD A;  2ZU9 A;  5CMH A;  2FY7 A;  2D0J A;  3SXA A;  1WT1 A;  3U2V A;  5HS2 A;  5JQQ A;  4JD0 A;  4B2W A;  4C2S A;  1H7G A;  4HG6 A;  5I1F A;  2PGV A;  4Q7C A;  2MZB A;  4E1K A;  1ZJ3 A;  1VGT A;  4D11 C;  2AM4 A;  2CU2 A;  1GWV A;  1GQ9 A;  1FR8 A;  1R80 A;  1VH3 A;  4NAN A;  3Q80 A;  2RIT A;  1R7X A;  4HO9 A;  1H5S B;  5CMF X;  3OH2 A;  4KNX A;  1H5R B;  2AES A;  2WEE A;  2RJ4 A;  1JYK A;  1INJ A;  4R7P A;  5C36 A;  1NKH B;  3D5N A;  2DPW A;  4HO4 A;  2ICX A;  1PZY B;  1H7E A;  4CJC A;  2PA4 A;  4B4G A;  1HJL A;  3V91 A;  2AEC A;  4KT7 A;  3SXC A;  1OQM B;  2X65 A;  1H7F A;  5FUH A;  2D7R A;  3IOJ A;  5C1G A;  3OH0 A;  5CMG X;  5C4D A;  3ST8 A;  1HM0 A;  5FU0 A;  5C49 A;  3PKQ A;  4NAL A;  1W57 A;  3V0M A;  3FOQ A;  2APC A;  2D7I A;  1YP2 A;  1GA8 A;  1ZI3 A;  4KQL A;  2WVK A;  1VPA A;  2Q4J A;  3I0K A;  2Y4J A;  2WE9 A;  1FZW A;  4DEC A;  5CQL X;  4CJ8 A;  5FU8 A;  4CVH A;  3JUJ A;  1OMZ A;  1JYL A;  2YQS A;  5D91 A;  5C47 A;  4AC3 A;  5IDT A;  3SXD A;  4AYL A;  1O7O A;  1FRW A;  3POL A;  1XZ6 A;  3DK5 A;  4G3Q A;  1ZCT A;  5C3D A;  3I0L A;  1TW5 A;  1LL3 A;  1TW1 A;  4P02 A;  4P00 A;  4HOC A;  2YQH A;  3NGW A;  2O1H A;  1QWJ A;  2V0H A;  2A8U A;  3ZF8 A;  1S4O A;  4KPX A;  4LW6 A;  2OI6 A; 
#chains in the Genus database with same CATH homology
 3PNN A;  4KRV A;  1G2V A;  1ZIZ A;  1ZCV A;  2XWM A;  3T7O A;  1FGX A;  2AE7 A;  1YRO B;  1MP4 A;  4FRO A;  3V0L A;  2RJ5 A;  3O3P A;  4FRP A;  5AJN A;  3OAM A;  3USR A;  4M28 A;  2XME A;  5C4B A;  5L6S A;  1R81 A;  2RIZ A;  3E25 A;  3OC9 A;  1G8O A;  1H4E A;  5C4C A;  1ZJ2 A;  3K8E A;  3OGZ A;  1H7Q A;  4NAK A;  4ASY A;  5CMJ A;  1ZI5 A;  2OI5 A;  3I0F A;  1QGS A;  4Y7G A;  3I0C A;  3RMV A;  3QVB A;  3Q4S A;  3OKR A;  2Y6P A;  2OEG A;  2RJ7 A;  2YC3 A;  1LZ7 A;  2O1G A;  5CQO A;  3N9W A;  1FR9 A;  1KWS A;  2I7B A;  5IDS A;  1H5S A;  4L41 C;  2Z87 A;  1INI A;  5FTV A;  1FWY A;  2RJ6 A;  4IRQ A;  3TZT A;  1VZU A;  1H5R A;  4FRL A;  2VK9 A;  3V8Y A;  4ASJ A;  1VGW A;  1S4N A;  3ZGG A;  2WVL A;  1R7U A;  4BQH A;  5C1L A;  1EZI A;  5C3A A;  4XWI A;  2AM5 A;  1TVY A;  2RJ0 A;  1LL0 A;  2J0B A;  3K8D A;  2QGI A;  2YES A;  2UX8 A;  2JCL A;  3U2W A;  4B4B A;  4Y9X A;  1MP3 A;  2VSH A;  2RJ1 A;  1LZI A;  4ARW A;  1ZJP A;  3U0Y A;  3SXG A;  1NF5 B;  1HM8 A;  3Q7U A;  1ZDG A;  2RIX A;  3U2X A;  1SS9 A;  4FIX A;  4Y7V A;  3SX5 A;  1VZT A;  1ZJO A;  2YC5 A;  5C4E A;  4CJB A;  2FYC B;  4M2A A;  3CGX A;  3D8V A;  1ZCU A;  4B4M A;  4EE5 A;  2VXL A;  1G23 A;  1S4P A;  1QG8 A;  2I5K A;  5J49 A;  1ZHJ A;  1GQC A;  3U2U A;  1NQI B;  1R7T A;  2ZU8 A;  4FRA A;  4B5B A;  3CKO A;  3RMW A;  3V90 A;  4EEG A;  4Y7U A;  1LZ0 A;  3JUK A;  2NXV A;  1FO8 A;  4GBP A;  2QKX A;  1H7T A;  1H5T B;  4O6M A;  4EE4 A;  1ZDF A;  3CKJ A;  2AH9 A;  2VFZ A;  4KC1 A;  5FTS A;  3ZLL A;  1H4C A;  2JCJ A;  2X5Z A;  3V0P A;  1H5S C;  3I0J A;  3IOI A;  2E3D A;  4DDZ A;  2OEF A;  3DUV A;  4G87 A;  4Y6U A;  4FIY A;  5EJ1 A;  4ZDQ A;  1NWG B;  4FRD A;  2Z86 A;  1R7Y A;  2VD4 A;  5EIY A;  4Y7T A;  3SXB A;  1MP5 A;  4HCQ A;  4D0T A;  4EEO A;  2E8B A;  4FRH A;  1VH1 A;  2AM3 A;  2FFV A;  3BRK X;  3OH1 A;  1YP3 A;  3ZLK A;  3T7M A;  2QH5 A;  2VS5 A;  1H4D A;  1V83 A;  1R82 A;  3V8Z A;  5CMI A;  4EE3 A;  2YQC A;  4Y6N A;  2JCK A;  4Y62 A;  1H3M A;  4AAW A;  1GX4 A;  2BO6 A;  1VM8 A;  2FFU A;  5C3B A;  1NMM B;  1JV1 A;  4B3U A;  4KNR A;  4HO5 A;  1H7H A;  4DE7 A;  3R2W A;  4J18 A;  3JTJ A;  5FV9 A;  1Z90 A;  3I0I X;  1FXO A;  4AYJ A;  3R3I A;  4HO8 A;  1EYR A;  1VZX A;  4KPZ A;  3I0D A;  2Y4K A;  5L6V A;  4HO2 A;  3SX8 A;  2BO4 A;  1ZJ1 A;  2C0N A;  2Y7A A;  2V0I A;  2FYD B;  1LZJ A;  5EJZ A;  1GWW A;  3PKP A;  4IRP A;  5FYE A;  4FCU A;  4Y64 A;  1HV9 A;  2FYB A;  1GX0 A;  3OH3 A;  2W0W A;  5D92 A;  4BMA A;  2Y4L A;  3CKQ A;  2PX7 A;  1ZJ0 A;  4M2B A;  5CQN X;  3FWW A;  5C4F A;  4EEA A;  1FXJ A;  1TZF A;  1WT2 A;  4YS8 A;  4G3P A;  3V0N A;  2V0K A;  5C8R A;  2W0V A;  2P6W A;  2BO7 A;  4MND A;  1G0R A;  2OI7 A;  2P73 A;  4LW3 A;  1VIC A;  3EE5 A;  4JIS A;  1VGZ A;  1HM9 A;  2WAW A;  2A8W A;  4FRQ A;  4FRE A;  2VXM A;  5DDV A;  4Y63 A;  2WVM A;  4O6N A;  4G3S A;  5AJO A;  4D48 A;  1XHB A;  1WSZ A;  2XWL A;  4FRB A;  4NAI A;  3F1C A;  3RSB A;  1E5K A;  1H5T A;  4B42 A;  2VS4 A;  2WGZ A;  3SX7 A;  1V84 A;  2X5S A;  1YP4 A;  1WT3 A;  1ON6 A;  3DJ4 A;  1MC3 A;  1FG5 N;  2RJ9 A;  3U0X A;  3CKN A;  1OMX A;  3ZGF A;  1JVD A;  4HO6 A;  3USQ A;  2VS3 A;  5C38 A;  1IIN A;  2O1F A;  1W77 A;  1ZI1 A;  4D0Z A;  5BXC A;  3CKV A;  1G93 A;  3SX3 A;  1G1L A;  1O0R A;  5DDT A;  4Y7F A;  5C48 A;  3U2T A;  3HL3 A;  1K4V A;  4MIX A;  3IOH A;  3F1Y A;  2XMH A;  1NHE B;  2BO8 A;  1FO9 A;  3OH4 A;  3GUE A;  4FCE A;  3CU0 A;  3SXE A;  1PZT A;  2YCM A;  3I0G A;  2XWN A;  2FYA A;  3LW6 A;  4KXO A;  4FRM A;  3I0H A;  2YQJ A;  2ICY A;  5CQM X;  3E26 A;  1O23 B;  1V82 A;  1JVG A;  4K6R A;  4MYB A;  4D11 A;  5C1H A;  2GGO A;  3KIA A;  2JCO A;  2Y4M A;  1ON8 A;  1JV3 A;  4KC2 A;  1W55 A;  1I52 A;  1ZI4 A;  2P72 A;  4UEG A;  1G3L A;  1WVC A;  1ZCY A;  1FOA A;  1IIM A;  1FGG A;  1H5S D;  2VSI A;  3I0E A;  1H7L A;  3V0O A;  4M4K A;  3T7N A;  4B2X A;  1G9R A;  4EVW A;  2J0A A;  4HO0 A;  2GGQ A;  5CQP A;  2RIY A;  2ZU7 A;  4KC4 A;  5AJP A;  3SPT A;  2I5E A;  2AGD A;  3D98 A;  2X60 A;  2V0J A;  1LL2 A;  1G97 A;  1R7V A;  4FQW A;  4HO3 A;  3BCV A;  1HJJ A;  1O7Q A;  4ECM A;  1G95 A;  4EEM A;  3V0Q A;  1QGQ A;  1WT0 A;  2V0L A;  5IFY A;  1LVW A;  2RJ8 A;  1VGU A;  2PGY A;  3TQD A;  2ZU9 A;  5CMH A;  2FY7 A;  2D0J A;  3SXA A;  1WT1 A;  3U2V A;  5HS2 A;  5JQQ A;  4JD0 A;  4B2W A;  4C2S A;  1H7G A;  4HG6 A;  5I1F A;  2PGV A;  4Q7C A;  2MZB A;  4E1K A;  1ZJ3 A;  1VGT A;  4D11 C;  2AM4 A;  2CU2 A;  1GWV A;  1GQ9 A;  1FR8 A;  1R80 A;  1VH3 A;  4NAN A;  3Q80 A;  2RIT A;  1R7X A;  4HO9 A;  1H5S B;  5CMF X;  3OH2 A;  4KNX A;  1H5R B;  2AES A;  2WEE A;  2RJ4 A;  1JYK A;  1INJ A;  4R7P A;  5C36 A;  1NKH B;  3D5N A;  2DPW A;  4HO4 A;  2ICX A;  1PZY B;  1H7E A;  4CJC A;  2PA4 A;  4B4G A;  1HJL A;  3V91 A;  2AEC A;  4KT7 A;  3SXC A;  1OQM B;  2X65 A;  1H7F A;  5FUH A;  2D7R A;  3IOJ A;  5C1G A;  3OH0 A;  5CMG X;  5C4D A;  3ST8 A;  1HM0 A;  5FU0 A;  5C49 A;  3PKQ A;  4NAL A;  1W57 A;  3V0M A;  3FOQ A;  2APC A;  2D7I A;  1YP2 A;  1GA8 A;  1ZI3 A;  4KQL A;  2WVK A;  1VPA A;  2Q4J A;  3I0K A;  2Y4J A;  2WE9 A;  1FZW A;  4DEC A;  5CQL X;  4CJ8 A;  5FU8 A;  4CVH A;  3JUJ A;  1OMZ A;  1JYL A;  2YQS A;  5D91 A;  5C47 A;  4AC3 A;  5IDT A;  3SXD A;  4AYL A;  1O7O A;  1FRW A;  3POL A;  1XZ6 A;  3DK5 A;  4G3Q A;  1ZCT A;  5C3D A;  3I0L A;  1TW5 A;  1LL3 A;  1TW1 A;  4P02 A;  4P00 A;  4HOC A;  2YQH A;  3NGW A;  2O1H A;  1QWJ A;  2V0H A;  2A8U A;  3ZF8 A;  1S4O A;  4KPX A;  4LW6 A;  2OI6 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...