5I1FA

Crystal structure of utp-glucose-1-phosphate uridylyltransferase from burkholderia vietnamiensis in complex with uridine-5'-diphosphate-glucose
Total Genus 97
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
97
sequence length
290
structure length
290
Chain Sequence
HMLKVTKAVFPVAGLGTRFLPATKASPKEMLPVVDKPLIQYAVEEAIEAGITEMIFVTGRSKRAIEDHFDKSYEIEAELEARGKEKLLSLVRSIKPSHVDCFYVRQAEALGLGHAVLCAEKLVGDNPFAVILADDLLDGPTPVLRQMIDVFDHYHASVIGVEEIAPADSKSYGVIDGKRWEDDLFKLSGIVEKPEPAQAPSNFGVVGRYVLKPKIFKHLRGLKPGAGGELQLTDAIQSLLTDEQVLAYRYDGTRFDCGSKLGYLKATVEFALRHPEVAADFERYLLARMS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords UTP--glucose-1-phosphate uridylyltransferase
publication title Crystal structure of UTP-glucose-1-phosphate uridylyltransferase from Burkholderia vietnamiensis in complex with Uridine-5'-diphosphate-glucose
rcsb
source organism Burkholderia vietnamiensis (strain g4 / lmg 22486)
total genus 97
structure length 290
sequence length 290
ec nomenclature ec 2.7.7.9: UTP--glucose-1-phosphate uridylyltransferase.
pdb deposition date 2016-02-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00483 NTP_transferase Nucleotidyl transferase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.550.10 Alpha Beta Alpha-Beta Complex Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A 5i1fA00
1ZI4A 3SPTA 1PZYB 3I0LA 4JD0A 1QGQA 1TZFA 4ASYA 2BO7A 2VXLA 1O0RA 3GUEA 2FYBA 1R80A 1ZI1A 1R7UA 5HS2A 2VSHA 3DUVA 4HO3A 3R2WA 4IRQA 2AM5A 5C4FA 1IINA 2XWMA 1FZWA 1LZJA 3SXGA 4KNRA 1VZTA 2YC3A 4B4GA 4NALA 4B2WA 1G2VA 4B4MA 4CJCA 1QG8A 2Y6PA 2E3DA 1GQ9A 2W0VA 2MZBA 5CQMX 5C8RA 1R81A 3V8ZA 4DECA 1FWYA 4P00A 5CQOA 3SX7A 4D11A 1R7TA 4E1KA 2Q4JA 4GBPA 4B5BA 4IRPA 2OI6A 2DPWA 1LVWA 2ZU9A 4FCUA 3ZF8A 2Y7AA 4EEAA 5L6VA 2FFVA 4NAIA 2YQHA 4ARWA 2OEGA 1ZJ1A 5C3AA 3POLA 4FRPA 3USRA 2RJ0A 1LL0A 2BO8A 1JVDA 1ZI3A 1MP4A 2AGDA 1ZCTA 1YP2A 5CQNX 3I0GA 5C1HA 1WVCA 2AECA 4KNXA 3I0KA 2I5KA 2YESA 1H7HA 3CKNA 4Y62A 3T7OA 1G9RA 4EEGA 5C49A 1LZIA 3HL3A 4AAWA 3Q80A 1JVGA 2WAWA 2WVLA 4M2AA 5CQPA 3FOQA 2Y4MA 3JUJA 4DDZA 5C38A 2RJ1A 2XMEA 5FYEA 3PKQA 2Z87A 5FTVA 3D98A 3OGZA 2A8WA 1H7EA 4KRVA 2YQCA 5AJNA 3NGWA 3OH1A 4Y63A 4AC3A 4CVHA 1O7QA 4YS8A 2XMHA 1EZIA 5CMGX 3U0YA 1H5SB 3K8DA 4D0TA 1FXOA 3I0IX 3JUKA 4HO8A 1FO9A 2E8BA 3I0JA 3JTJA 1VM8A 2BO4A 3SXCA 2FFUA 1H5SA 3OC9A 1H7GA 1HM0A 1NQIB 1R7YA 2OI5A 1H7FA 1S4OA 5C4CA 3PKPA 1VH3A 3F1CA 5FV9A 1ZDFA 4KC2A 1LL3A 4EVWA 4R7PA 1GQCA 4KPZA 1G95A 2FYAA 4Y7UA 5C3BA 2RIZA 2ZU8A 3T7MA 1NKHB 1GX4A 5C1LA 2WEEA 1E5KA 4J18A 3N9WA 5FUHA 4HO0A 2ZU7A 4MYBA 1OMXA 2X5ZA 1MP3A 1VGTA 1ZCYA 2P6WA 1FOAA 1OMZA 2YCMA 3U0XA 5C47A 2PX7A 2JCKA 2AM4A 1HV9A 2XWNA 3SXBA 4G3SA 4FROA 3SXDA 1ZJ3A 2RIXA 4M2BA 1IIMA 2A8UA 1I52A 1R7XA 4HG6A 1FGXA 2PGVA 3U2VA 5EJZA 3R3IA 3V0QA 2GGOA 4FRAA 1ZIZA 1H4EA 3I0FA 4Y64A 4FCEA 2O1GA 3I0CA 2RJ9A 1TVYA 1INJA 1G97A 5C4EA 4FRQA 2UX8A 2X60A 1H5TB 3ZLLA 3I0EA 1LZ0A 1PZTA 3LW6A 5C3DA 2JCLA 4LW6A 3SX8A 1ZJ0A 1WT0A 3O3PA 4DE7A 2ICYA 4Y7GA 1H5TA 3BCVA 2CU2A 4KQLA 3T7NA 1FO8A 2QH5A 4HO4A 4BQHA 1ZCUA 1KWSA 3V91A 1W55A 5DDVA 5I1FA 2D0JA 5FU0A 4AYJA 2WVKA 4C2SA 2PGYA 1JYLA 1G93A 5JQQA 3D8VA 1ON8A 3SXAA 1WT1A 2D7RA 2RITA 4HO2A 2VXMA 4D11C 2I7BA 2V0LA 4EE5A 3V0PA 1S4NA 4M28A 1VZUA 5IDTA 4B42A 1MC3A 4CJBA 1ZHJA 5C4DA 4JISA 2QGIA 1VGUA 5CMHA 2O1FA 2RIYA 5IFYA 4HO6A 1ON6A 2VS5A 2D7IA 5C1GA 4BMAA 1FXJA 1FR8A 2VFZA 2X65A 4MNDA 3V0OA 4ASJA 1XHBA 2QKXA 2Y4JA 1V83A 3OH2A 1YP3A 1G3LA 4XWIA 4UEGA 3V0MA 3ZLKA 3CKQA 2P73A 3ZGFA 3IOIA 5EJ1A 2WE9A 1QGSA 3SXEA 4Y9XA 4NAKA 1NWGB 5FTSA 1G0RA 4EEMA 5DDTA 3SX3A 1VH1A 1O23B 1VZXA 2OEFA 4HCQA 4G3PA 3TZTA 1ZJOA 1NHEB 2NXVA 2JCOA 5C36A 4KT7A 1WT3A 3SX5A 2V0JA 1ZDGA 4KC4A 1MP5A 2ICXA 4HOCA 5FU8A 4L41C 2AE7A 1NMMB 2FY7A 3TQDA 2GGQA 1H5SC 1FG5N 3FWWA 2OI7A 2X5SA 4FQWA 1G8OA 2AM3A 2V0KA 2FYCB 3Q7UA 4FREA 3USQA 2PA4A 5J49A 5CQLX 3U2UA 1JV3A 5EIYA 1K4VA 3U2TA 4FRBA 3OH0A 4HO5A 2Z86A 4D48A 4G87A 3D5NA 1VGZA 5L6SA 2RJ6A 3IOHA 3Q4SA 3RSBA 1VICA 1JYKA 2VS3A 3ST8A 4HO9A 1G23A 3V0LA 4NANA 3RMWA 1SS9A 2P72A 5CMJA 4ECMA 2APCA 3E25A 1INIA 1ZCVA 1LZ7A 4K6RA 1ZJ2A 2WVMA 5AJPA 3I0HA 2W0WA 4B2XA 3OH3A 3V90A 5CMIA 1H5RB 2I5EA 3U2WA 1LL2A 5AJOA 5CMFX 4KPXA 3I0DA 4EE4A 1H4DA 1EYRA 2V0HA 2AH9A 2RJ7A 3EE5A 1XZ6A 1H5RA 1H7LA 1H7TA 3BRKX 4LW3A 1H3MA 2YQJA 4D0ZA 1GWWA 4KXOA 3DK5A 2YQSA 1FGGA 1YROB 4EEOA 2YC5A 4B4BA 4FRDA 4Y7FA 2Y4LA 3K8EA 1V82A 1GX0A 1W57A 1ZI5A 2FYDB 1V84A 3V8YA 1HM8A 1ZJPA 3KIAA 2O1HA 1NF5B 2JCJA 4AYLA 2VS4A 4CJ8A 5IDSA 2Y4KA 1G1LA 1H7QA 3ZGGA 1VPAA 1H5SD 1S4PA 3OH4A 4Y6NA 1FR9A 3DJ4A 2XWLA 1R82A 1HM9A 2AESA 3IOJA 1HJJA 5C4BA 1TW1A 1QWJA 3CKOA 1FRWA 4FRMA 3F1YA 3U2XA 5C48A 2V0IA 1YP4A 1H4CA 1TW5A 4G3QA 1WSZA 3E26A 3CKVA 3CGXA 1R7VA 1WT2A 3OAMA 2WGZA 1OQMB 3V0NA 1JV1A 4EE3A 2BO6A 1O7OA 4FRHA 2VD4A 2RJ4A 1HJLA 3QVBA 4M4KA 4Y6UA 4Y7VA 5BXCA 4P02A 3OKRA 3RMVA 4B3UA 3PNNA 1VGWA 1GWVA 1W77A 1GA8A 2VSIA 4KC1A 4FRLA 4Y7TA 2RJ8A 3CU0A 2RJ5A 1Z90A 3CKJA 4ZDQA
chains in the Genus database with same CATH superfamily
1ZI4A 3SPTA 1PZYB 3I0LA 4JD0A 1QGQA 1TZFA 4ASYA 2BO7A 2VXLA 1O0RA 3GUEA 2FYBA 1R80A 1ZI1A 1R7UA 5HS2A 2VSHA 3DUVA 4HO3A 3R2WA 4IRQA 2AM5A 5C4FA 1IINA 2XWMA 1FZWA 1LZJA 3SXGA 4MIXA 4KNRA 1VZTA 2YC3A 4B4GA 4NALA 4B2WA 1G2VA 4B4MA 4CJCA 1QG8A 2Y6PA 2E3DA 1GQ9A 2W0VA 2MZBA 5CQMX 5C8RA 1R81A 3V8ZA 4DECA 1FWYA 4P00A 5CQOA 3SX7A 4D11A 1R7TA 4E1KA 2Q4JA 4GBPA 4B5BA 4IRPA 2OI6A 2DPWA 1LVWA 2ZU9A 4FCUA 3ZF8A 2Y7AA 4EEAA 5L6VA 2FFVA 4NAIA 2YQHA 4ARWA 2OEGA 1ZJ1A 5C3AA 3POLA 4FRPA 3USRA 2RJ0A 1LL0A 2BO8A 1JVDA 1ZI3A 1MP4A 2AGDA 1ZCTA 1YP2A 5CQNX 3I0GA 5C1HA 1WVCA 2AECA 4KNXA 3I0KA 2I5KA 2YESA 1H7HA 3CKNA 4Y62A 3T7OA 1G9RA 4EEGA 5C49A 1LZIA 3HL3A 4AAWA 3Q80A 1JVGA 2WAWA 2WVLA 4M2AA 5CQPA 3FOQA 2Y4MA 3JUJA 4DDZA 5C38A 2RJ1A 2XMEA 5FYEA 4O6MA 3PKQA 2Z87A 5FTVA 3D98A 3OGZA 2A8WA 1H7EA 4KRVA 2YQCA 5AJNA 3NGWA 3OH1A 4Y63A 4AC3A 4CVHA 1O7QA 4FIYA 4YS8A 2XMHA 1EZIA 5CMGX 3U0YA 1H5SB 3K8DA 4D0TA 1FXOA 3I0IX 3JUKA 4HO8A 1FO9A 2E8BA 3I0JA 3JTJA 1VM8A 2BO4A 3SXCA 2FFUA 1H5SA 3OC9A 1H7GA 1HM0A 1NQIB 1R7YA 2OI5A 1H7FA 1S4OA 5C4CA 3PKPA 1VH3A 3F1CA 5FV9A 1ZDFA 4KC2A 1LL3A 4EVWA 4R7PA 1GQCA 4KPZA 1G95A 2FYAA 4Y7UA 5C3BA 2RIZA 2ZU8A 3T7MA 1NKHB 1GX4A 5C1LA 2WEEA 1E5KA 4J18A 3N9WA 5FUHA 4HO0A 2ZU7A 4MYBA 1OMXA 2X5ZA 1MP3A 1VGTA 1ZCYA 2P6WA 1FOAA 1OMZA 2YCMA 3U0XA 5C47A 2PX7A 2JCKA 2AM4A 1HV9A 2XWNA 3SXBA 4G3SA 4FROA 3SXDA 1ZJ3A 2RIXA 4M2BA 1IIMA 2A8UA 1I52A 1R7XA 4HG6A 1FGXA 2PGVA 3U2VA 5EJZA 3R3IA 3V0QA 2GGOA 4FRAA 1ZIZA 1H4EA 3I0FA 4Y64A 4FCEA 2O1GA 3I0CA 2RJ9A 1TVYA 1INJA 1G97A 5C4EA 4FRQA 2UX8A 2X60A 1H5TB 3ZLLA 3I0EA 1LZ0A 1PZTA 3LW6A 5C3DA 2JCLA 4LW6A 3SX8A 1ZJ0A 1WT0A 3O3PA 4DE7A 2ICYA 4Y7GA 1H5TA 3BCVA 2CU2A 4KQLA 3T7NA 1FO8A 2QH5A 4HO4A 4BQHA 1ZCUA 1KWSA 3V91A 1W55A 5DDVA 5I1FA 2D0JA 5FU0A 2J0AA 4AYJA 2WVKA 4C2SA 2PGYA 1JYLA 1G93A 5JQQA 3D8VA 1ON8A 3SXAA 1WT1A 2D7RA 2RITA 4HO2A 2VXMA 4D11C 2I7BA 2V0LA 4Q7CA 2VK9A 4EE5A 3V0PA 1S4NA 4M28A 1VZUA 5IDTA 4B42A 1MC3A 4CJBA 1ZHJA 5C4DA 4JISA 2QGIA 1VGUA 5CMHA 2O1FA 2RIYA 5IFYA 4HO6A 1ON6A 2VS5A 2D7IA 5C1GA 4BMAA 5D92A 1FXJA 1FR8A 2VFZA 2X65A 4MNDA 3V0OA 4ASJA 1XHBA 2QKXA 2Y4JA 1V83A 3OH2A 1YP3A 1G3LA 4XWIA 4UEGA 3V0MA 3ZLKA 3CKQA 2P73A 3ZGFA 3IOIA 5EJ1A 2WE9A 1QGSA 3SXEA 4Y9XA 4NAKA 1NWGB 5FTSA 1G0RA 4EEMA 5DDTA 3SX3A 1VH1A 1O23B 1VZXA 2OEFA 4HCQA 4G3PA 3TZTA 1ZJOA 1NHEB 2NXVA 2JCOA 5C36A 4O6NA 4KT7A 1WT3A 3SX5A 2V0JA 1ZDGA 4KC4A 1MP5A 2ICXA 4HOCA 5FU8A 4L41C 2AE7A 1NMMB 2FY7A 3TQDA 2GGQA 1H5SC 1FG5N 3FWWA 2OI7A 2X5SA 4FQWA 1G8OA 2AM3A 2V0KA 2FYCB 3Q7UA 4FREA 3USQA 2PA4A 5J49A 5CQLX 3U2UA 1JV3A 5D91A 5EIYA 1K4VA 3U2TA 4FRBA 3OH0A 4HO5A 2Z86A 4D48A 4G87A 3D5NA 1VGZA 5L6SA 2RJ6A 3IOHA 3Q4SA 3RSBA 1VICA 1JYKA 2VS3A 3ST8A 4HO9A 1G23A 3V0LA 4NANA 3RMWA 1SS9A 2P72A 5CMJA 4ECMA 2APCA 3E25A 1INIA 1ZCVA 1LZ7A 4K6RA 1ZJ2A 2WVMA 5AJPA 3I0HA 2W0WA 4B2XA 3OH3A 3V90A 5CMIA 1H5RB 2I5EA 3U2WA 1LL2A 2C0NA 5AJOA 5CMFX 4KPXA 3I0DA 4EE4A 1H4DA 1EYRA 2V0HA 2AH9A 2RJ7A 3EE5A 1XZ6A 1H5RA 1H7LA 1H7TA 3BRKX 4LW3A 1H3MA 2YQJA 4D0ZA 1GWWA 4KXOA 3DK5A 2YQSA 1FGGA 1YROB 4EEOA 2YC5A 4B4BA 4FRDA 4Y7FA 2Y4LA 3K8EA 1V82A 1GX0A 1W57A 1ZI5A 2FYDB 1V84A 3V8YA 1HM8A 1ZJPA 3KIAA 2O1HA 1NF5B 2JCJA 4AYLA 2VS4A 4CJ8A 5IDSA 2Y4KA 1G1LA 1H7QA 3ZGGA 1VPAA 1H5SD 1S4PA 3OH4A 4Y6NA 1FR9A 3DJ4A 2XWLA 2J0BA 1R82A 1HM9A 2AESA 3IOJA 1HJJA 5C4BA 1TW1A 1QWJA 3CKOA 1FRWA 4FRMA 3F1YA 3U2XA 5C48A 2V0IA 1YP4A 1H4CA 1TW5A 4G3QA 1WSZA 3E26A 3CKVA 3CGXA 1R7VA 1WT2A 3OAMA 2WGZA 1OQMB 3V0NA 1JV1A 4EE3A 2BO6A 1O7OA 4FRHA 2VD4A 2RJ4A 1HJLA 3QVBA 4M4KA 4Y6UA 4Y7VA 5BXCA 4FIXA 4P02A 3OKRA 3RMVA 4B3UA 3PNNA 1VGWA 1GWVA 1W77A 1GA8A 2VSIA 4KC1A 4FRLA 4Y7TA 2RJ8A 3CU0A 2RJ5A 1Z90A 3CKJA 4ZDQA
chains in the Genus database with same CATH topology
1ZI4A 3SPTA 1PZYB 3I0LA 4JD0A 1QGQA 1TZFA 4ASYA 2BO7A 2VXLA 1O0RA 3GUEA 2FYBA 1R80A 1ZI1A 1R7UA 5HS2A 2VSHA 3DUVA 4HO3A 3R2WA 4IRQA 2AM5A 5C4FA 1IINA 2XWMA 1FZWA 1LZJA 3SXGA 4MIXA 4KNRA 1VZTA 2YC3A 4B4GA 4NALA 4B2WA 1G2VA 4B4MA 4CJCA 1QG8A 2Y6PA 2E3DA 1GQ9A 2W0VA 2MZBA 5CQMX 5C8RA 1R81A 3V8ZA 4DECA 1FWYA 4P00A 5CQOA 3SX7A 4D11A 1R7TA 4E1KA 2Q4JA 4GBPA 4B5BA 4IRPA 2OI6A 2DPWA 1LVWA 2ZU9A 4FCUA 3ZF8A 2Y7AA 4EEAA 5L6VA 2FFVA 4NAIA 2YQHA 4ARWA 2OEGA 1ZJ1A 5C3AA 3POLA 4FRPA 3USRA 2RJ0A 1LL0A 2BO8A 1JVDA 1ZI3A 1MP4A 2AGDA 1ZCTA 1YP2A 5CQNX 3I0GA 5C1HA 1WVCA 2AECA 4KNXA 3I0KA 2I5KA 2YESA 1H7HA 3CKNA 4Y62A 3T7OA 1G9RA 4EEGA 5C49A 1LZIA 3HL3A 4AAWA 3Q80A 1JVGA 2WAWA 2WVLA 4M2AA 5CQPA 3FOQA 2Y4MA 3JUJA 4DDZA 5C38A 2RJ1A 2XMEA 5FYEA 4O6MA 3PKQA 2Z87A 5FTVA 3D98A 3OGZA 2A8WA 1H7EA 4KRVA 2YQCA 5AJNA 3NGWA 3OH1A 4Y63A 4AC3A 4CVHA 1O7QA 4FIYA 4YS8A 2XMHA 1EZIA 5CMGX 3U0YA 1H5SB 3K8DA 4D0TA 1FXOA 3I0IX 3JUKA 4HO8A 1FO9A 2E8BA 3I0JA 3JTJA 1VM8A 2BO4A 3SXCA 2FFUA 1H5SA 3OC9A 1H7GA 1HM0A 1NQIB 1R7YA 2OI5A 1H7FA 1S4OA 5C4CA 3PKPA 1VH3A 3F1CA 5FV9A 1ZDFA 4KC2A 1LL3A 4EVWA 4R7PA 1GQCA 4KPZA 1G95A 2FYAA 4Y7UA 5C3BA 2RIZA 2ZU8A 3T7MA 1NKHB 1GX4A 5C1LA 2WEEA 1E5KA 4J18A 3N9WA 5FUHA 4HO0A 2ZU7A 4MYBA 1OMXA 2X5ZA 1MP3A 1VGTA 1ZCYA 2P6WA 1FOAA 1OMZA 2YCMA 3U0XA 5C47A 2PX7A 2JCKA 2AM4A 1HV9A 2XWNA 3SXBA 4G3SA 4FROA 3SXDA 1ZJ3A 2RIXA 4M2BA 1IIMA 2A8UA 1I52A 1R7XA 4HG6A 1FGXA 2PGVA 3U2VA 5EJZA 3R3IA 3V0QA 2GGOA 4FRAA 1ZIZA 1H4EA 3I0FA 4Y64A 4FCEA 2O1GA 3I0CA 2RJ9A 1TVYA 1INJA 1G97A 5C4EA 4FRQA 2UX8A 2X60A 1H5TB 3ZLLA 3I0EA 1LZ0A 1PZTA 3LW6A 5C3DA 2JCLA 4LW6A 3SX8A 1ZJ0A 1WT0A 3O3PA 4DE7A 2ICYA 4Y7GA 1H5TA 3BCVA 2CU2A 4KQLA 3T7NA 1FO8A 2QH5A 4HO4A 4BQHA 1ZCUA 1KWSA 3V91A 1W55A 5DDVA 5I1FA 2D0JA 5FU0A 2J0AA 4AYJA 2WVKA 4C2SA 2PGYA 1JYLA 1G93A 5JQQA 3D8VA 1ON8A 3SXAA 1WT1A 2D7RA 2RITA 4HO2A 2VXMA 4D11C 2I7BA 2V0LA 4Q7CA 2VK9A 4EE5A 3V0PA 1S4NA 4M28A 1VZUA 5IDTA 4B42A 1MC3A 4CJBA 1ZHJA 5C4DA 4JISA 2QGIA 1VGUA 5CMHA 2O1FA 2RIYA 5IFYA 4HO6A 1ON6A 2VS5A 2D7IA 5C1GA 4BMAA 5D92A 1FXJA 1FR8A 2VFZA 2X65A 4MNDA 3V0OA 4ASJA 1XHBA 2QKXA 2Y4JA 1V83A 3OH2A 1YP3A 1G3LA 4XWIA 4UEGA 3V0MA 3ZLKA 3CKQA 2P73A 3ZGFA 3IOIA 5EJ1A 2WE9A 1QGSA 3SXEA 4Y9XA 4NAKA 1NWGB 5FTSA 1G0RA 4EEMA 5DDTA 3SX3A 1VH1A 1O23B 1VZXA 2OEFA 4HCQA 4G3PA 3TZTA 1ZJOA 1NHEB 2NXVA 2JCOA 5C36A 4O6NA 4KT7A 1WT3A 3SX5A 2V0JA 1ZDGA 4KC4A 1MP5A 2ICXA 4HOCA 5FU8A 4L41C 2AE7A 1NMMB 2FY7A 3TQDA 2GGQA 1H5SC 1FG5N 3FWWA 2OI7A 2X5SA 4FQWA 1G8OA 2AM3A 2V0KA 2FYCB 3Q7UA 4FREA 3USQA 2PA4A 5J49A 5CQLX 3U2UA 1JV3A 5D91A 5EIYA 1K4VA 3U2TA 4FRBA 3OH0A 4HO5A 2Z86A 4D48A 4G87A 3D5NA 1VGZA 5L6SA 2RJ6A 3IOHA 3Q4SA 3RSBA 1VICA 1JYKA 2VS3A 3ST8A 4HO9A 1G23A 3V0LA 4NANA 3RMWA 1SS9A 2P72A 5CMJA 4ECMA 2APCA 3E25A 1INIA 1ZCVA 1LZ7A 4K6RA 1ZJ2A 2WVMA 5AJPA 3I0HA 2W0WA 4B2XA 3OH3A 3V90A 5CMIA 1H5RB 2I5EA 3U2WA 1LL2A 2C0NA 5AJOA 5CMFX 4KPXA 3I0DA 4EE4A 1H4DA 1EYRA 2V0HA 2AH9A 2RJ7A 3EE5A 1XZ6A 1H5RA 1H7LA 1H7TA 3BRKX 4LW3A 1H3MA 2YQJA 4D0ZA 1GWWA 4KXOA 3DK5A 2YQSA 1FGGA 1YROB 4EEOA 2YC5A 4B4BA 4FRDA 4Y7FA 2Y4LA 3K8EA 1V82A 1GX0A 1W57A 1ZI5A 2FYDB 1V84A 3V8YA 1HM8A 1ZJPA 3KIAA 2O1HA 1NF5B 2JCJA 4AYLA 2VS4A 4CJ8A 5IDSA 2Y4KA 1G1LA 1H7QA 3ZGGA 1VPAA 1H5SD 1S4PA 3OH4A 4Y6NA 1FR9A 3DJ4A 2XWLA 2J0BA 1R82A 1HM9A 2AESA 3IOJA 1HJJA 5C4BA 1TW1A 1QWJA 3CKOA 1FRWA 4FRMA 3F1YA 3U2XA 5C48A 2V0IA 1YP4A 1H4CA 1TW5A 4G3QA 1WSZA 3E26A 3CKVA 3CGXA 1R7VA 1WT2A 3OAMA 2WGZA 1OQMB 3V0NA 1JV1A 4EE3A 2BO6A 1O7OA 4FRHA 2VD4A 2RJ4A 1HJLA 3QVBA 4M4KA 4Y6UA 4Y7VA 5BXCA 4FIXA 4P02A 3OKRA 3RMVA 4B3UA 3PNNA 1VGWA 1GWVA 1W77A 1GA8A 2VSIA 4KC1A 4FRLA 4Y7TA 2RJ8A 3CU0A 2RJ5A 1Z90A 3CKJA 4ZDQA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1ZI4 A;  3SPT A;  1PZY B;  3I0L A;  4JD0 A;  1QGQ A;  1TZF A;  4ASY A;  2BO7 A;  2VXL A;  1O0R A;  3GUE A;  2FYB A;  1R80 A;  1ZI1 A;  1R7U A;  5HS2 A;  2VSH A;  3DUV A;  4HO3 A;  3R2W A;  4IRQ A;  2AM5 A;  5C4F A;  1IIN A;  2XWM A;  1FZW A;  1LZJ A;  3SXG A;  4KNR A;  1VZT A;  2YC3 A;  4B4G A;  4NAL A;  4B2W A;  1G2V A;  4B4M A;  4CJC A;  1QG8 A;  2Y6P A;  2E3D A;  1GQ9 A;  2W0V A;  2MZB A;  5CQM X;  5C8R A;  1R81 A;  3V8Z A;  4DEC A;  1FWY A;  4P00 A;  5CQO A;  3SX7 A;  4D11 A;  1R7T A;  4E1K A;  2Q4J A;  4GBP A;  4B5B A;  4IRP A;  2OI6 A;  2DPW A;  1LVW A;  2ZU9 A;  4FCU A;  3ZF8 A;  2Y7A A;  4EEA A;  5L6V A;  2FFV A;  4NAI A;  2YQH A;  4ARW A;  2OEG A;  1ZJ1 A;  5C3A A;  3POL A;  4FRP A;  3USR A;  2RJ0 A;  1LL0 A;  2BO8 A;  1JVD A;  1ZI3 A;  1MP4 A;  2AGD A;  1ZCT A;  1YP2 A;  5CQN X;  3I0G A;  5C1H A;  1WVC A;  2AEC A;  4KNX A;  3I0K A;  2I5K A;  2YES A;  1H7H A;  3CKN A;  4Y62 A;  3T7O A;  1G9R A;  4EEG A;  5C49 A;  1LZI A;  3HL3 A;  4AAW A;  3Q80 A;  1JVG A;  2WAW A;  2WVL A;  4M2A A;  5CQP A;  3FOQ A;  2Y4M A;  3JUJ A;  4DDZ A;  5C38 A;  2RJ1 A;  2XME A;  5FYE A;  3PKQ A;  2Z87 A;  5FTV A;  3D98 A;  3OGZ A;  2A8W A;  1H7E A;  4KRV A;  2YQC A;  5AJN A;  3NGW A;  3OH1 A;  4Y63 A;  4AC3 A;  4CVH A;  1O7Q A;  4YS8 A;  2XMH A;  1EZI A;  5CMG X;  3U0Y A;  1H5S B;  3K8D A;  4D0T A;  1FXO A;  3I0I X;  3JUK A;  4HO8 A;  1FO9 A;  2E8B A;  3I0J A;  3JTJ A;  1VM8 A;  2BO4 A;  3SXC A;  2FFU A;  1H5S A;  3OC9 A;  1H7G A;  1HM0 A;  1NQI B;  1R7Y A;  2OI5 A;  1H7F A;  1S4O A;  5C4C A;  3PKP A;  1VH3 A;  3F1C A;  5FV9 A;  1ZDF A;  4KC2 A;  1LL3 A;  4EVW A;  4R7P A;  1GQC A;  4KPZ A;  1G95 A;  2FYA A;  4Y7U A;  5C3B A;  2RIZ A;  2ZU8 A;  3T7M A;  1NKH B;  1GX4 A;  5C1L A;  2WEE A;  1E5K A;  4J18 A;  3N9W A;  5FUH A;  4HO0 A;  2ZU7 A;  4MYB A;  1OMX A;  2X5Z A;  1MP3 A;  1VGT A;  1ZCY A;  2P6W A;  1FOA A;  1OMZ A;  2YCM A;  3U0X A;  5C47 A;  2PX7 A;  2JCK A;  2AM4 A;  1HV9 A;  2XWN A;  3SXB A;  4G3S A;  4FRO A;  3SXD A;  1ZJ3 A;  2RIX A;  4M2B A;  1IIM A;  2A8U A;  1I52 A;  1R7X A;  4HG6 A;  1FGX A;  2PGV A;  3U2V A;  5EJZ A;  3R3I A;  3V0Q A;  2GGO A;  4FRA A;  1ZIZ A;  1H4E A;  3I0F A;  4Y64 A;  4FCE A;  2O1G A;  3I0C A;  2RJ9 A;  1TVY A;  1INJ A;  1G97 A;  5C4E A;  4FRQ A;  2UX8 A;  2X60 A;  1H5T B;  3ZLL A;  3I0E A;  1LZ0 A;  1PZT A;  3LW6 A;  5C3D A;  2JCL A;  4LW6 A;  3SX8 A;  1ZJ0 A;  1WT0 A;  3O3P A;  4DE7 A;  2ICY A;  4Y7G A;  1H5T A;  3BCV A;  2CU2 A;  4KQL A;  3T7N A;  1FO8 A;  2QH5 A;  4HO4 A;  4BQH A;  1ZCU A;  1KWS A;  3V91 A;  1W55 A;  5DDV A;  5I1F A;  2D0J A;  5FU0 A;  4AYJ A;  2WVK A;  4C2S A;  2PGY A;  1JYL A;  1G93 A;  5JQQ A;  3D8V A;  1ON8 A;  3SXA A;  1WT1 A;  2D7R A;  2RIT A;  4HO2 A;  2VXM A;  4D11 C;  2I7B A;  2V0L A;  4EE5 A;  3V0P A;  1S4N A;  4M28 A;  1VZU A;  5IDT A;  4B42 A;  1MC3 A;  4CJB A;  1ZHJ A;  5C4D A;  4JIS A;  2QGI A;  1VGU A;  5CMH A;  2O1F A;  2RIY A;  5IFY A;  4HO6 A;  1ON6 A;  2VS5 A;  2D7I A;  5C1G A;  4BMA A;  1FXJ A;  1FR8 A;  2VFZ A;  2X65 A;  4MND A;  3V0O A;  4ASJ A;  1XHB A;  2QKX A;  2Y4J A;  1V83 A;  3OH2 A;  1YP3 A;  1G3L A;  4XWI A;  4UEG A;  3V0M A;  3ZLK A;  3CKQ A;  2P73 A;  3ZGF A;  3IOI A;  5EJ1 A;  2WE9 A;  1QGS A;  3SXE A;  4Y9X A;  4NAK A;  1NWG B;  5FTS A;  1G0R A;  4EEM A;  5DDT A;  3SX3 A;  1VH1 A;  1O23 B;  1VZX A;  2OEF A;  4HCQ A;  4G3P A;  3TZT A;  1ZJO A;  1NHE B;  2NXV A;  2JCO A;  5C36 A;  4KT7 A;  1WT3 A;  3SX5 A;  2V0J A;  1ZDG A;  4KC4 A;  1MP5 A;  2ICX A;  4HOC A;  5FU8 A;  4L41 C;  2AE7 A;  1NMM B;  2FY7 A;  3TQD A;  2GGQ A;  1H5S C;  1FG5 N;  3FWW A;  2OI7 A;  2X5S A;  4FQW A;  1G8O A;  2AM3 A;  2V0K A;  2FYC B;  3Q7U A;  4FRE A;  3USQ A;  2PA4 A;  5J49 A;  5CQL X;  3U2U A;  1JV3 A;  5EIY A;  1K4V A;  3U2T A;  4FRB A;  3OH0 A;  4HO5 A;  2Z86 A;  4D48 A;  4G87 A;  3D5N A;  1VGZ A;  5L6S A;  2RJ6 A;  3IOH A;  3Q4S A;  3RSB A;  1VIC A;  1JYK A;  2VS3 A;  3ST8 A;  4HO9 A;  1G23 A;  3V0L A;  4NAN A;  3RMW A;  1SS9 A;  2P72 A;  5CMJ A;  4ECM A;  2APC A;  3E25 A;  1INI A;  1ZCV A;  1LZ7 A;  4K6R A;  1ZJ2 A;  2WVM A;  5AJP A;  3I0H A;  2W0W A;  4B2X A;  3OH3 A;  3V90 A;  5CMI A;  1H5R B;  2I5E A;  3U2W A;  1LL2 A;  5AJO A;  5CMF X;  4KPX A;  3I0D A;  4EE4 A;  1H4D A;  1EYR A;  2V0H A;  2AH9 A;  2RJ7 A;  3EE5 A;  1XZ6 A;  1H5R A;  1H7L A;  1H7T A;  3BRK X;  4LW3 A;  1H3M A;  2YQJ A;  4D0Z A;  1GWW A;  4KXO A;  3DK5 A;  2YQS A;  1FGG A;  1YRO B;  4EEO A;  2YC5 A;  4B4B A;  4FRD A;  4Y7F A;  2Y4L A;  3K8E A;  1V82 A;  1GX0 A;  1W57 A;  1ZI5 A;  2FYD B;  1V84 A;  3V8Y A;  1HM8 A;  1ZJP A;  3KIA A;  2O1H A;  1NF5 B;  2JCJ A;  4AYL A;  2VS4 A;  4CJ8 A;  5IDS A;  2Y4K A;  1G1L A;  1H7Q A;  3ZGG A;  1VPA A;  1H5S D;  1S4P A;  3OH4 A;  4Y6N A;  1FR9 A;  3DJ4 A;  2XWL A;  1R82 A;  1HM9 A;  2AES A;  3IOJ A;  1HJJ A;  5C4B A;  1TW1 A;  1QWJ A;  3CKO A;  1FRW A;  4FRM A;  3F1Y A;  3U2X A;  5C48 A;  2V0I A;  1YP4 A;  1H4C A;  1TW5 A;  4G3Q A;  1WSZ A;  3E26 A;  3CKV A;  3CGX A;  1R7V A;  1WT2 A;  3OAM A;  2WGZ A;  1OQM B;  3V0N A;  1JV1 A;  4EE3 A;  2BO6 A;  1O7O A;  4FRH A;  2VD4 A;  2RJ4 A;  1HJL A;  3QVB A;  4M4K A;  4Y6U A;  4Y7V A;  5BXC A;  4P02 A;  3OKR A;  3RMV A;  4B3U A;  3PNN A;  1VGW A;  1GWV A;  1W77 A;  1GA8 A;  2VSI A;  4KC1 A;  4FRL A;  4Y7T A;  2RJ8 A;  3CU0 A;  2RJ5 A;  1Z90 A;  3CKJ A;  4ZDQ A; 
#chains in the Genus database with same CATH topology
 1ZI4 A;  3SPT A;  1PZY B;  3I0L A;  4JD0 A;  1QGQ A;  1TZF A;  4ASY A;  2BO7 A;  2VXL A;  1O0R A;  3GUE A;  2FYB A;  1R80 A;  1ZI1 A;  1R7U A;  5HS2 A;  2VSH A;  3DUV A;  4HO3 A;  3R2W A;  4IRQ A;  2AM5 A;  5C4F A;  1IIN A;  2XWM A;  1FZW A;  1LZJ A;  3SXG A;  4MIX A;  4KNR A;  1VZT A;  2YC3 A;  4B4G A;  4NAL A;  4B2W A;  1G2V A;  4B4M A;  4CJC A;  1QG8 A;  2Y6P A;  2E3D A;  1GQ9 A;  2W0V A;  2MZB A;  5CQM X;  5C8R A;  1R81 A;  3V8Z A;  4DEC A;  1FWY A;  4P00 A;  5CQO A;  3SX7 A;  4D11 A;  1R7T A;  4E1K A;  2Q4J A;  4GBP A;  4B5B A;  4IRP A;  2OI6 A;  2DPW A;  1LVW A;  2ZU9 A;  4FCU A;  3ZF8 A;  2Y7A A;  4EEA A;  5L6V A;  2FFV A;  4NAI A;  2YQH A;  4ARW A;  2OEG A;  1ZJ1 A;  5C3A A;  3POL A;  4FRP A;  3USR A;  2RJ0 A;  1LL0 A;  2BO8 A;  1JVD A;  1ZI3 A;  1MP4 A;  2AGD A;  1ZCT A;  1YP2 A;  5CQN X;  3I0G A;  5C1H A;  1WVC A;  2AEC A;  4KNX A;  3I0K A;  2I5K A;  2YES A;  1H7H A;  3CKN A;  4Y62 A;  3T7O A;  1G9R A;  4EEG A;  5C49 A;  1LZI A;  3HL3 A;  4AAW A;  3Q80 A;  1JVG A;  2WAW A;  2WVL A;  4M2A A;  5CQP A;  3FOQ A;  2Y4M A;  3JUJ A;  4DDZ A;  5C38 A;  2RJ1 A;  2XME A;  5FYE A;  4O6M A;  3PKQ A;  2Z87 A;  5FTV A;  3D98 A;  3OGZ A;  2A8W A;  1H7E A;  4KRV A;  2YQC A;  5AJN A;  3NGW A;  3OH1 A;  4Y63 A;  4AC3 A;  4CVH A;  1O7Q A;  4FIY A;  4YS8 A;  2XMH A;  1EZI A;  5CMG X;  3U0Y A;  1H5S B;  3K8D A;  4D0T A;  1FXO A;  3I0I X;  3JUK A;  4HO8 A;  1FO9 A;  2E8B A;  3I0J A;  3JTJ A;  1VM8 A;  2BO4 A;  3SXC A;  2FFU A;  1H5S A;  3OC9 A;  1H7G A;  1HM0 A;  1NQI B;  1R7Y A;  2OI5 A;  1H7F A;  1S4O A;  5C4C A;  3PKP A;  1VH3 A;  3F1C A;  5FV9 A;  1ZDF A;  4KC2 A;  1LL3 A;  4EVW A;  4R7P A;  1GQC A;  4KPZ A;  1G95 A;  2FYA A;  4Y7U A;  5C3B A;  2RIZ A;  2ZU8 A;  3T7M A;  1NKH B;  1GX4 A;  5C1L A;  2WEE A;  1E5K A;  4J18 A;  3N9W A;  5FUH A;  4HO0 A;  2ZU7 A;  4MYB A;  1OMX A;  2X5Z A;  1MP3 A;  1VGT A;  1ZCY A;  2P6W A;  1FOA A;  1OMZ A;  2YCM A;  3U0X A;  5C47 A;  2PX7 A;  2JCK A;  2AM4 A;  1HV9 A;  2XWN A;  3SXB A;  4G3S A;  4FRO A;  3SXD A;  1ZJ3 A;  2RIX A;  4M2B A;  1IIM A;  2A8U A;  1I52 A;  1R7X A;  4HG6 A;  1FGX A;  2PGV A;  3U2V A;  5EJZ A;  3R3I A;  3V0Q A;  2GGO A;  4FRA A;  1ZIZ A;  1H4E A;  3I0F A;  4Y64 A;  4FCE A;  2O1G A;  3I0C A;  2RJ9 A;  1TVY A;  1INJ A;  1G97 A;  5C4E A;  4FRQ A;  2UX8 A;  2X60 A;  1H5T B;  3ZLL A;  3I0E A;  1LZ0 A;  1PZT A;  3LW6 A;  5C3D A;  2JCL A;  4LW6 A;  3SX8 A;  1ZJ0 A;  1WT0 A;  3O3P A;  4DE7 A;  2ICY A;  4Y7G A;  1H5T A;  3BCV A;  2CU2 A;  4KQL A;  3T7N A;  1FO8 A;  2QH5 A;  4HO4 A;  4BQH A;  1ZCU A;  1KWS A;  3V91 A;  1W55 A;  5DDV A;  5I1F A;  2D0J A;  5FU0 A;  2J0A A;  4AYJ A;  2WVK A;  4C2S A;  2PGY A;  1JYL A;  1G93 A;  5JQQ A;  3D8V A;  1ON8 A;  3SXA A;  1WT1 A;  2D7R A;  2RIT A;  4HO2 A;  2VXM A;  4D11 C;  2I7B A;  2V0L A;  4Q7C A;  2VK9 A;  4EE5 A;  3V0P A;  1S4N A;  4M28 A;  1VZU A;  5IDT A;  4B42 A;  1MC3 A;  4CJB A;  1ZHJ A;  5C4D A;  4JIS A;  2QGI A;  1VGU A;  5CMH A;  2O1F A;  2RIY A;  5IFY A;  4HO6 A;  1ON6 A;  2VS5 A;  2D7I A;  5C1G A;  4BMA A;  5D92 A;  1FXJ A;  1FR8 A;  2VFZ A;  2X65 A;  4MND A;  3V0O A;  4ASJ A;  1XHB A;  2QKX A;  2Y4J A;  1V83 A;  3OH2 A;  1YP3 A;  1G3L A;  4XWI A;  4UEG A;  3V0M A;  3ZLK A;  3CKQ A;  2P73 A;  3ZGF A;  3IOI A;  5EJ1 A;  2WE9 A;  1QGS A;  3SXE A;  4Y9X A;  4NAK A;  1NWG B;  5FTS A;  1G0R A;  4EEM A;  5DDT A;  3SX3 A;  1VH1 A;  1O23 B;  1VZX A;  2OEF A;  4HCQ A;  4G3P A;  3TZT A;  1ZJO A;  1NHE B;  2NXV A;  2JCO A;  5C36 A;  4O6N A;  4KT7 A;  1WT3 A;  3SX5 A;  2V0J A;  1ZDG A;  4KC4 A;  1MP5 A;  2ICX A;  4HOC A;  5FU8 A;  4L41 C;  2AE7 A;  1NMM B;  2FY7 A;  3TQD A;  2GGQ A;  1H5S C;  1FG5 N;  3FWW A;  2OI7 A;  2X5S A;  4FQW A;  1G8O A;  2AM3 A;  2V0K A;  2FYC B;  3Q7U A;  4FRE A;  3USQ A;  2PA4 A;  5J49 A;  5CQL X;  3U2U A;  1JV3 A;  5D91 A;  5EIY A;  1K4V A;  3U2T A;  4FRB A;  3OH0 A;  4HO5 A;  2Z86 A;  4D48 A;  4G87 A;  3D5N A;  1VGZ A;  5L6S A;  2RJ6 A;  3IOH A;  3Q4S A;  3RSB A;  1VIC A;  1JYK A;  2VS3 A;  3ST8 A;  4HO9 A;  1G23 A;  3V0L A;  4NAN A;  3RMW A;  1SS9 A;  2P72 A;  5CMJ A;  4ECM A;  2APC A;  3E25 A;  1INI A;  1ZCV A;  1LZ7 A;  4K6R A;  1ZJ2 A;  2WVM A;  5AJP A;  3I0H A;  2W0W A;  4B2X A;  3OH3 A;  3V90 A;  5CMI A;  1H5R B;  2I5E A;  3U2W A;  1LL2 A;  2C0N A;  5AJO A;  5CMF X;  4KPX A;  3I0D A;  4EE4 A;  1H4D A;  1EYR A;  2V0H A;  2AH9 A;  2RJ7 A;  3EE5 A;  1XZ6 A;  1H5R A;  1H7L A;  1H7T A;  3BRK X;  4LW3 A;  1H3M A;  2YQJ A;  4D0Z A;  1GWW A;  4KXO A;  3DK5 A;  2YQS A;  1FGG A;  1YRO B;  4EEO A;  2YC5 A;  4B4B A;  4FRD A;  4Y7F A;  2Y4L A;  3K8E A;  1V82 A;  1GX0 A;  1W57 A;  1ZI5 A;  2FYD B;  1V84 A;  3V8Y A;  1HM8 A;  1ZJP A;  3KIA A;  2O1H A;  1NF5 B;  2JCJ A;  4AYL A;  2VS4 A;  4CJ8 A;  5IDS A;  2Y4K A;  1G1L A;  1H7Q A;  3ZGG A;  1VPA A;  1H5S D;  1S4P A;  3OH4 A;  4Y6N A;  1FR9 A;  3DJ4 A;  2XWL A;  2J0B A;  1R82 A;  1HM9 A;  2AES A;  3IOJ A;  1HJJ A;  5C4B A;  1TW1 A;  1QWJ A;  3CKO A;  1FRW A;  4FRM A;  3F1Y A;  3U2X A;  5C48 A;  2V0I A;  1YP4 A;  1H4C A;  1TW5 A;  4G3Q A;  1WSZ A;  3E26 A;  3CKV A;  3CGX A;  1R7V A;  1WT2 A;  3OAM A;  2WGZ A;  1OQM B;  3V0N A;  1JV1 A;  4EE3 A;  2BO6 A;  1O7O A;  4FRH A;  2VD4 A;  2RJ4 A;  1HJL A;  3QVB A;  4M4K A;  4Y6U A;  4Y7V A;  5BXC A;  4FIX A;  4P02 A;  3OKR A;  3RMV A;  4B3U A;  3PNN A;  1VGW A;  1GWV A;  1W77 A;  1GA8 A;  2VSI A;  4KC1 A;  4FRL A;  4Y7T A;  2RJ8 A;  3CU0 A;  2RJ5 A;  1Z90 A;  3CKJ A;  4ZDQ A; 
#chains in the Genus database with same CATH homology
 1ZI4 A;  3SPT A;  1PZY B;  3I0L A;  4JD0 A;  1QGQ A;  1TZF A;  4ASY A;  2BO7 A;  2VXL A;  1O0R A;  3GUE A;  2FYB A;  1R80 A;  1ZI1 A;  1R7U A;  5HS2 A;  2VSH A;  3DUV A;  4HO3 A;  3R2W A;  4IRQ A;  2AM5 A;  5C4F A;  1IIN A;  2XWM A;  1FZW A;  1LZJ A;  3SXG A;  4MIX A;  4KNR A;  1VZT A;  2YC3 A;  4B4G A;  4NAL A;  4B2W A;  1G2V A;  4B4M A;  4CJC A;  1QG8 A;  2Y6P A;  2E3D A;  1GQ9 A;  2W0V A;  2MZB A;  5CQM X;  5C8R A;  1R81 A;  3V8Z A;  4DEC A;  1FWY A;  4P00 A;  5CQO A;  3SX7 A;  4D11 A;  1R7T A;  4E1K A;  2Q4J A;  4GBP A;  4B5B A;  4IRP A;  2OI6 A;  2DPW A;  1LVW A;  2ZU9 A;  4FCU A;  3ZF8 A;  2Y7A A;  4EEA A;  5L6V A;  2FFV A;  4NAI A;  2YQH A;  4ARW A;  2OEG A;  1ZJ1 A;  5C3A A;  3POL A;  4FRP A;  3USR A;  2RJ0 A;  1LL0 A;  2BO8 A;  1JVD A;  1ZI3 A;  1MP4 A;  2AGD A;  1ZCT A;  1YP2 A;  5CQN X;  3I0G A;  5C1H A;  1WVC A;  2AEC A;  4KNX A;  3I0K A;  2I5K A;  2YES A;  1H7H A;  3CKN A;  4Y62 A;  3T7O A;  1G9R A;  4EEG A;  5C49 A;  1LZI A;  3HL3 A;  4AAW A;  3Q80 A;  1JVG A;  2WAW A;  2WVL A;  4M2A A;  5CQP A;  3FOQ A;  2Y4M A;  3JUJ A;  4DDZ A;  5C38 A;  2RJ1 A;  2XME A;  5FYE A;  4O6M A;  3PKQ A;  2Z87 A;  5FTV A;  3D98 A;  3OGZ A;  2A8W A;  1H7E A;  4KRV A;  2YQC A;  5AJN A;  3NGW A;  3OH1 A;  4Y63 A;  4AC3 A;  4CVH A;  1O7Q A;  4FIY A;  4YS8 A;  2XMH A;  1EZI A;  5CMG X;  3U0Y A;  1H5S B;  3K8D A;  4D0T A;  1FXO A;  3I0I X;  3JUK A;  4HO8 A;  1FO9 A;  2E8B A;  3I0J A;  3JTJ A;  1VM8 A;  2BO4 A;  3SXC A;  2FFU A;  1H5S A;  3OC9 A;  1H7G A;  1HM0 A;  1NQI B;  1R7Y A;  2OI5 A;  1H7F A;  1S4O A;  5C4C A;  3PKP A;  1VH3 A;  3F1C A;  5FV9 A;  1ZDF A;  4KC2 A;  1LL3 A;  4EVW A;  4R7P A;  1GQC A;  4KPZ A;  1G95 A;  2FYA A;  4Y7U A;  5C3B A;  2RIZ A;  2ZU8 A;  3T7M A;  1NKH B;  1GX4 A;  5C1L A;  2WEE A;  1E5K A;  4J18 A;  3N9W A;  5FUH A;  4HO0 A;  2ZU7 A;  4MYB A;  1OMX A;  2X5Z A;  1MP3 A;  1VGT A;  1ZCY A;  2P6W A;  1FOA A;  1OMZ A;  2YCM A;  3U0X A;  5C47 A;  2PX7 A;  2JCK A;  2AM4 A;  1HV9 A;  2XWN A;  3SXB A;  4G3S A;  4FRO A;  3SXD A;  1ZJ3 A;  2RIX A;  4M2B A;  1IIM A;  2A8U A;  1I52 A;  1R7X A;  4HG6 A;  1FGX A;  2PGV A;  3U2V A;  5EJZ A;  3R3I A;  3V0Q A;  2GGO A;  4FRA A;  1ZIZ A;  1H4E A;  3I0F A;  4Y64 A;  4FCE A;  2O1G A;  3I0C A;  2RJ9 A;  1TVY A;  1INJ A;  1G97 A;  5C4E A;  4FRQ A;  2UX8 A;  2X60 A;  1H5T B;  3ZLL A;  3I0E A;  1LZ0 A;  1PZT A;  3LW6 A;  5C3D A;  2JCL A;  4LW6 A;  3SX8 A;  1ZJ0 A;  1WT0 A;  3O3P A;  4DE7 A;  2ICY A;  4Y7G A;  1H5T A;  3BCV A;  2CU2 A;  4KQL A;  3T7N A;  1FO8 A;  2QH5 A;  4HO4 A;  4BQH A;  1ZCU A;  1KWS A;  3V91 A;  1W55 A;  5DDV A;  5I1F A;  2D0J A;  5FU0 A;  2J0A A;  4AYJ A;  2WVK A;  4C2S A;  2PGY A;  1JYL A;  1G93 A;  5JQQ A;  3D8V A;  1ON8 A;  3SXA A;  1WT1 A;  2D7R A;  2RIT A;  4HO2 A;  2VXM A;  4D11 C;  2I7B A;  2V0L A;  4Q7C A;  2VK9 A;  4EE5 A;  3V0P A;  1S4N A;  4M28 A;  1VZU A;  5IDT A;  4B42 A;  1MC3 A;  4CJB A;  1ZHJ A;  5C4D A;  4JIS A;  2QGI A;  1VGU A;  5CMH A;  2O1F A;  2RIY A;  5IFY A;  4HO6 A;  1ON6 A;  2VS5 A;  2D7I A;  5C1G A;  4BMA A;  5D92 A;  1FXJ A;  1FR8 A;  2VFZ A;  2X65 A;  4MND A;  3V0O A;  4ASJ A;  1XHB A;  2QKX A;  2Y4J A;  1V83 A;  3OH2 A;  1YP3 A;  1G3L A;  4XWI A;  4UEG A;  3V0M A;  3ZLK A;  3CKQ A;  2P73 A;  3ZGF A;  3IOI A;  5EJ1 A;  2WE9 A;  1QGS A;  3SXE A;  4Y9X A;  4NAK A;  1NWG B;  5FTS A;  1G0R A;  4EEM A;  5DDT A;  3SX3 A;  1VH1 A;  1O23 B;  1VZX A;  2OEF A;  4HCQ A;  4G3P A;  3TZT A;  1ZJO A;  1NHE B;  2NXV A;  2JCO A;  5C36 A;  4O6N A;  4KT7 A;  1WT3 A;  3SX5 A;  2V0J A;  1ZDG A;  4KC4 A;  1MP5 A;  2ICX A;  4HOC A;  5FU8 A;  4L41 C;  2AE7 A;  1NMM B;  2FY7 A;  3TQD A;  2GGQ A;  1H5S C;  1FG5 N;  3FWW A;  2OI7 A;  2X5S A;  4FQW A;  1G8O A;  2AM3 A;  2V0K A;  2FYC B;  3Q7U A;  4FRE A;  3USQ A;  2PA4 A;  5J49 A;  5CQL X;  3U2U A;  1JV3 A;  5D91 A;  5EIY A;  1K4V A;  3U2T A;  4FRB A;  3OH0 A;  4HO5 A;  2Z86 A;  4D48 A;  4G87 A;  3D5N A;  1VGZ A;  5L6S A;  2RJ6 A;  3IOH A;  3Q4S A;  3RSB A;  1VIC A;  1JYK A;  2VS3 A;  3ST8 A;  4HO9 A;  1G23 A;  3V0L A;  4NAN A;  3RMW A;  1SS9 A;  2P72 A;  5CMJ A;  4ECM A;  2APC A;  3E25 A;  1INI A;  1ZCV A;  1LZ7 A;  4K6R A;  1ZJ2 A;  2WVM A;  5AJP A;  3I0H A;  2W0W A;  4B2X A;  3OH3 A;  3V90 A;  5CMI A;  1H5R B;  2I5E A;  3U2W A;  1LL2 A;  2C0N A;  5AJO A;  5CMF X;  4KPX A;  3I0D A;  4EE4 A;  1H4D A;  1EYR A;  2V0H A;  2AH9 A;  2RJ7 A;  3EE5 A;  1XZ6 A;  1H5R A;  1H7L A;  1H7T A;  3BRK X;  4LW3 A;  1H3M A;  2YQJ A;  4D0Z A;  1GWW A;  4KXO A;  3DK5 A;  2YQS A;  1FGG A;  1YRO B;  4EEO A;  2YC5 A;  4B4B A;  4FRD A;  4Y7F A;  2Y4L A;  3K8E A;  1V82 A;  1GX0 A;  1W57 A;  1ZI5 A;  2FYD B;  1V84 A;  3V8Y A;  1HM8 A;  1ZJP A;  3KIA A;  2O1H A;  1NF5 B;  2JCJ A;  4AYL A;  2VS4 A;  4CJ8 A;  5IDS A;  2Y4K A;  1G1L A;  1H7Q A;  3ZGG A;  1VPA A;  1H5S D;  1S4P A;  3OH4 A;  4Y6N A;  1FR9 A;  3DJ4 A;  2XWL A;  2J0B A;  1R82 A;  1HM9 A;  2AES A;  3IOJ A;  1HJJ A;  5C4B A;  1TW1 A;  1QWJ A;  3CKO A;  1FRW A;  4FRM A;  3F1Y A;  3U2X A;  5C48 A;  2V0I A;  1YP4 A;  1H4C A;  1TW5 A;  4G3Q A;  1WSZ A;  3E26 A;  3CKV A;  3CGX A;  1R7V A;  1WT2 A;  3OAM A;  2WGZ A;  1OQM B;  3V0N A;  1JV1 A;  4EE3 A;  2BO6 A;  1O7O A;  4FRH A;  2VD4 A;  2RJ4 A;  1HJL A;  3QVB A;  4M4K A;  4Y6U A;  4Y7V A;  5BXC A;  4FIX A;  4P02 A;  3OKR A;  3RMV A;  4B3U A;  3PNN A;  1VGW A;  1GWV A;  1W77 A;  1GA8 A;  2VSI A;  4KC1 A;  4FRL A;  4Y7T A;  2RJ8 A;  3CU0 A;  2RJ5 A;  1Z90 A;  3CKJ A;  4ZDQ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...