1ZCYA

Apo form of a mutant of glycogenin in which asp159 is replaced by ser
Total Genus 81
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
81
sequence length
266
structure length
257
Chain Sequence
MTDQAFVTLTTNDAYAKGALVLGSSLKQHRTSRRLAVLTTPQVSDTMRKALEIVFDEVITVDILDSGDSAHLTLMKRPELGVTLTKLHCWSLTQYSKCVFMDADTLVLANIDDLFEREELSAAPDPGWPDCFNSGVFVYQPSVETYNQLLHVASEQGSFSGGDQGLLNTFFNSWATTDIRKHLPFIYNLSSISIYSYLPAFKAFGANAKVVHFLGQTKPWNYTYDTKTKSVRSPQFLNVWWDIFTTSVVPLLQQFGL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords Glycogenin-1
publication title Requirements for catalysis in mammalian glycogenin.
pubmed doi rcsb
source organism Oryctolagus cuniculus
total genus 81
structure length 257
sequence length 266
ec nomenclature ec 2.4.1.186: Glycogenin glucosyltransferase.
pdb deposition date 2005-04-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01501 Glyco_transf_8 Glycosyl transferase family 8
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.550.10 Alpha Beta Alpha-Beta Complex Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A 1zcyA00
1JV3A 3U2VA 5CQMX 5FU0A 5C8RA 1H5RB 1ZI3A 2V0JA 3CKVA 3OH3A 1FXOA 1INJA 1FR8A 4J18A 1S4NA 4FRMA 4D48A 3N9WA 4EEAA 4G87A 3V8ZA 1H4CA 2BO8A 2BO7A 5CQOA 1H5RA 5FU8A 2WVKA 4KQLA 4HO6A 5IDTA 4NAIA 1IIMA 4Y62A 2JCJA 5EJ1A 4Y6NA 4FRPA 5C3BA 2RJ9A 5FYEA 2VSHA 1O23B 5C4BA 3K8EA 2W0VA 1HJJA 5EJZA 2D7RA 2FYAA 5L6VA 1S4OA 1H5TB 5C4DA 1LL3A 2VS4A 3CKNA 4E1KA 1ZI5A 3EE5A 4ZDQA 5IFYA 3NGWA 4B2XA 1VM8A 5DDVA 1H7TA 1H5TA 1LL0A 2UX8A 5FV9A 4K6RA 2RJ6A 4M2AA 4DE7A 1G95A 4HCQA 2QH5A 5BXCA 1R80A 2O1FA 4P00A 5CQNX 2O1GA 2AECA 2RJ7A 1G93A 1R7UA 3SXEA 4FCEA 2GGQA 2YQHA 2ICXA 1WVCA 1PZTA 1H7EA 2WVMA 1FZWA 3I0FA 4DDZA 2ZU7A 1H7GA 4CJ8A 3SXAA 4ARWA 2VXLA 2Y7AA 4JISA 1R7TA 3T7MA 2D7IA 5C1GA 3U2TA 1H7FA 3F1CA 3K8DA 2XWMA 2RIZA 4JD0A 2AH9A 5C1LA 3LW6A 3ZGFA 2I7BA 1H7LA 1GQCA 3Q4SA 3D98A 1G3LA 5AJNA 2BO4A 2YQCA 1HM9A 4G3SA 5C38A 5FTSA 1GA8A 3V0PA 1VPAA 1G23A 1EZIA 4FRBA 1H4EA 1ZCTA 3V0NA 2AM4A 5CMFX 1LZ0A 2I5KA 3PNNA 3V91A 4EE4A 3DJ4A 5C4EA 3I0IX 3Q7UA 1MC3A 3U0YA 1R81A 3CKQA 1MP5A 4B4MA 5JQQA 1MP4A 2MZBA 5C1HA 4D0ZA 3E25A 2XMHA 3I0DA 4HO3A 1FRWA 1W57A 1HV9A 1NWGB 2ICYA 5DDTA 4KPXA 1H5SB 1TW1A 1GX4A 4R7PA 1VGZA 1Z90A 2VS5A 4Y7FA 1HJLA 4LW3A 4D11A 4KNRA 1H7HA 4Y7GA 2RJ0A 3OAMA 1H5SA 1G0RA 1NHEB 4KC2A 1YP4A 3SXCA 2ZU8A 3USQA 1OMXA 2Z86A 4HO2A 3T7OA 4FROA 1ZJOA 3V8YA 1TW5A 2RJ4A 1VH3A 2E3DA 1FOAA 1V84A 4GBPA 1YP3A 2E8BA 3U2WA 3SX3A 2Z87A 5CMGX 1WT2A 3RMVA 5AJOA 2Y4JA 1G97A 1OMZA 2I5EA 2VSIA 2JCLA 1ZCUA 2WE9A 3U2UA 1LZJA 1ZIZA 4B3UA 2W0WA 2XWLA 3F1YA 3TZTA 1XZ6A 3R2WA 2RIXA 4AC3A 4FQWA 1YP2A 5C3AA 1JYLA 5L6SA 2YC3A 3I0KA 1H4DA 1VGWA 4HO9A 3USRA 2XWNA 4HOCA 3V90A 2X65A 2Q4JA 3E26A 4D0TA 2RIYA 3ZLLA 2D0JA 2Y4MA 4KPZA 4KXOA 2FY7A 1W55A 3JTJA 1FWYA 4YS8A 4BQHA 2RITA 2AGDA 1ZI1A 2A8UA 3ZF8A 2O1HA 1GWVA 4B5BA 1VZXA 3DK5A 3FOQA 1YROB 2YESA 4FCUA 4G3QA 4KNXA 1TZFA 4HO0A 1VICA 1NKHB 5FUHA 3R3IA 1GX0A 3V0QA 2X5ZA 3O3PA 4EE3A 2QGIA 2RJ8A 1ZJ3A 2JCKA 1O7OA 5C48A 2AE7A 3CKJA 3OH1A 4Y7TA 3V0MA 3ZGGA 1VZTA 2ZU9A 5CMHA 1WT0A 2OI7A 1O7QA 2V0HA 4IRQA 1PZYB 4MYBA 3U2XA 1WT3A 3CU0A 4Y9XA 1LZIA 4P02A 4Y7VA 1KWSA 1ON8A 2FYCB 3ST8A 3IOHA 3PKQA 1IINA 3SXGA 2YC5A 3D8VA 4Y6UA 3TQDA 4B4GA 3SX8A 2PGYA 4CJBA 1LL2A 1ZCVA 3BRKX 3OH2A 3I0GA 1HM0A 3I0HA 4ASYA 3Q80A 2YCMA 1FGXA 1SS9A 4L41C 2FYDB 4Y64A 2AESA 1ZDFA 2AM3A 3HL3A 3QVBA 4M2BA 5AJPA 3SX5A 5C49A 2WAWA 4M28A 1H5SC 4ECMA 2YQJA 2VD4A 4EEOA 2P72A 5C36A 3U0XA 3OC9A 1G1LA 1LVWA 2NXVA 1LZ7A 3CKOA 4FRQA 4AAWA 1JYKA 3T7NA 2CU2A 1R7YA 4HO5A 1MP3A 1OQMB 4FRLA 2V0KA 4NAKA 3IOIA 1JVDA 4CVHA 4CJCA 2X5SA 5C4FA 1NQIB 1JVGA 1R82A 2DPWA 5IDSA 4B4BA 1FG5N 1I52A 2QKXA 3I0JA 1JV1A 2OI5A 3PKPA 1XHBA 1ZCYA 1WT1A 1ZDGA 3IOJA 1R7XA 3BCVA 1VGTA 2RJ1A 5HS2A 4M4KA 1ON6A 4ASJA 1H7QA 3GUEA 4AYLA 2FYBA 3CGXA 1ZI4A 1FR9A 2XMEA 1QGQA 1EYRA 3JUJA 3SXDA 5CMJA 1QWJA 1TVYA 2Y6PA 3V0LA 1ZJ1A 2RJ5A 4B42A 4B2WA 1K4VA 4Y7UA 2PGVA 4KT7A 2BO6A 1ZJ0A 1G8OA 4LW6A 4EE5A 2VFZA 3RSBA 3I0CA 4C2SA 3SX7A 2Y4KA 4HG6A 2WGZA 3OH4A 2YQSA 4Y63A 4XWIA 4AYJA 4DECA 4KC4A 2V0LA 1G9RA 3FWWA 3SXBA 4FRHA 2WEEA 1NF5B 5CMIA 1FO8A 2VS3A 4BMAA 1V82A 1VH1A 2OEGA 1S4PA 1H5SD 3JUKA 3OGZA 4EVWA 4EEMA 1E5KA 4NANA 4NALA 1W77A 4FRDA 3POLA 4KRVA 1INIA 2A8WA 2PX7A 3V0OA 2P6WA 4MNDA 3D5NA 5C47A 3RMWA 2JCOA 1H3MA 2X60A 4UEGA 3DUVA 4KC1A 2WVLA 3KIAA 1FO9A 4FRAA 5C4CA 5EIYA 1VZUA 2P73A 2V0IA 2APCA 5C3DA 4FREA 1ZJ2A 2FFVA 2Y4LA 3I0EA 5CQPA 1GWWA 2VXMA 1QG8A 1HM8A 4D11C 1G2VA 5I1FA 1ZJPA 2OEFA 5J49A 1GQ9A 1WSZA 2FFUA 4G3PA 1FXJA 1R7VA 2OI6A 3OH0A 5CQLX 1QGSA 2GGOA 1V83A 4HO8A 1NMMB 3OKRA 4IRPA 1ZHJA 2AM5A 3I0LA 3SPTA 1VGUA 4HO4A 5FTVA 3ZLKA 1O0RA 1FGGA 4EEGA 2PA4A
chains in the Genus database with same CATH superfamily
1JV3A 3U2VA 5CQMX 5FU0A 5C8RA 1H5RB 1ZI3A 2V0JA 3CKVA 3OH3A 1FXOA 1INJA 1FR8A 4J18A 1S4NA 4FRMA 4D48A 3N9WA 4EEAA 4G87A 3V8ZA 1H4CA 2BO8A 2BO7A 4O6NA 5CQOA 1H5RA 5FU8A 2WVKA 4KQLA 4HO6A 5IDTA 4NAIA 1IIMA 4Y62A 2JCJA 5EJ1A 4Y6NA 4FRPA 5C3BA 2RJ9A 5FYEA 2VSHA 1O23B 5C4BA 3K8EA 2W0VA 1HJJA 5EJZA 4FIXA 2D7RA 2FYAA 5L6VA 1S4OA 1H5TB 5C4DA 1LL3A 2VS4A 4MIXA 3CKNA 4E1KA 1ZI5A 3EE5A 4ZDQA 5IFYA 3NGWA 4B2XA 1VM8A 5DDVA 1H7TA 1H5TA 1LL0A 2UX8A 5FV9A 4K6RA 2RJ6A 4M2AA 4DE7A 1G95A 4HCQA 2QH5A 5BXCA 1R80A 2O1FA 4P00A 5CQNX 2O1GA 2AECA 2RJ7A 1G93A 1R7UA 3SXEA 4FCEA 2GGQA 2YQHA 2ICXA 1WVCA 1PZTA 1H7EA 2WVMA 1FZWA 3I0FA 4DDZA 2ZU7A 1H7GA 4CJ8A 3SXAA 4ARWA 2VXLA 2Y7AA 4JISA 1R7TA 3T7MA 2D7IA 5C1GA 3U2TA 1H7FA 3F1CA 3K8DA 2XWMA 2RIZA 4JD0A 2AH9A 5C1LA 3LW6A 3ZGFA 2I7BA 1H7LA 1GQCA 3Q4SA 3D98A 1G3LA 5AJNA 2BO4A 2YQCA 1HM9A 4G3SA 5C38A 5FTSA 1GA8A 3V0PA 1VPAA 1G23A 1EZIA 4FRBA 1H4EA 1ZCTA 3V0NA 2AM4A 5CMFX 1LZ0A 2I5KA 3PNNA 3V91A 4EE4A 3DJ4A 5C4EA 3I0IX 3Q7UA 1MC3A 3U0YA 1R81A 3CKQA 1MP5A 4B4MA 5JQQA 1MP4A 2MZBA 5C1HA 4D0ZA 3E25A 2XMHA 3I0DA 4HO3A 1FRWA 1W57A 5D92A 1HV9A 1NWGB 2ICYA 5DDTA 4KPXA 1H5SB 1TW1A 1GX4A 4R7PA 1VGZA 1Z90A 2VS5A 4Y7FA 1HJLA 4LW3A 4D11A 4KNRA 1H7HA 4Y7GA 4O6MA 2RJ0A 2VK9A 3OAMA 1H5SA 1G0RA 1NHEB 4KC2A 1YP4A 3SXCA 2ZU8A 3USQA 1OMXA 2Z86A 4HO2A 3T7OA 4FROA 1ZJOA 3V8YA 1TW5A 2RJ4A 1VH3A 2E3DA 1FOAA 1V84A 4GBPA 1YP3A 2E8BA 3U2WA 3SX3A 2Z87A 5CMGX 1WT2A 3RMVA 5AJOA 2Y4JA 1G97A 1OMZA 2I5EA 2VSIA 2JCLA 1ZCUA 2WE9A 3U2UA 1LZJA 1ZIZA 4B3UA 2W0WA 2XWLA 3F1YA 3TZTA 1XZ6A 3R2WA 2J0BA 2RIXA 4AC3A 4FIYA 4FQWA 1YP2A 5C3AA 1JYLA 5L6SA 2YC3A 3I0KA 1H4DA 1VGWA 4HO9A 3USRA 2XWNA 4HOCA 3V90A 2X65A 2Q4JA 3E26A 4D0TA 2RIYA 3ZLLA 2D0JA 2Y4MA 4KPZA 4KXOA 2FY7A 1W55A 3JTJA 1FWYA 4YS8A 4BQHA 2RITA 2AGDA 1ZI1A 2A8UA 3ZF8A 2O1HA 1GWVA 4B5BA 1VZXA 3DK5A 3FOQA 1YROB 2YESA 4FCUA 4G3QA 4KNXA 1TZFA 4HO0A 1VICA 1NKHB 5FUHA 3R3IA 1GX0A 3V0QA 2X5ZA 3O3PA 4EE3A 2QGIA 2RJ8A 1ZJ3A 2JCKA 1O7OA 5C48A 2AE7A 3CKJA 3OH1A 4Y7TA 3V0MA 3ZGGA 1VZTA 2ZU9A 5CMHA 1WT0A 2OI7A 1O7QA 2V0HA 4IRQA 1PZYB 4MYBA 3U2XA 1WT3A 3CU0A 4Y9XA 1LZIA 4P02A 4Y7VA 1KWSA 1ON8A 2FYCB 3ST8A 3IOHA 3PKQA 1IINA 3SXGA 2YC5A 3D8VA 4Y6UA 3TQDA 4B4GA 3SX8A 2PGYA 4CJBA 1LL2A 1ZCVA 3BRKX 3OH2A 3I0GA 1HM0A 3I0HA 4ASYA 3Q80A 2YCMA 1FGXA 1SS9A 4L41C 2FYDB 4Y64A 2AESA 1ZDFA 2AM3A 3HL3A 3QVBA 4M2BA 5AJPA 3SX5A 5C49A 2WAWA 4M28A 1H5SC 4ECMA 2YQJA 2VD4A 4EEOA 2P72A 5C36A 3U0XA 3OC9A 1G1LA 1LVWA 2NXVA 1LZ7A 3CKOA 4FRQA 4AAWA 1JYKA 3T7NA 2CU2A 1R7YA 4HO5A 1MP3A 1OQMB 4FRLA 2V0KA 4NAKA 3IOIA 1JVDA 4CVHA 4CJCA 2X5SA 5C4FA 1NQIB 1JVGA 1R82A 2DPWA 5IDSA 4B4BA 1FG5N 1I52A 2QKXA 3I0JA 1JV1A 2OI5A 3PKPA 1XHBA 1ZCYA 1WT1A 1ZDGA 3IOJA 1R7XA 3BCVA 1VGTA 2RJ1A 5HS2A 4M4KA 1ON6A 4ASJA 1H7QA 3GUEA 4AYLA 2FYBA 3CGXA 1ZI4A 1FR9A 2XMEA 1QGQA 1EYRA 3JUJA 3SXDA 5CMJA 1QWJA 1TVYA 2Y6PA 3V0LA 1ZJ1A 2RJ5A 4B42A 4B2WA 1K4VA 4Y7UA 2PGVA 4KT7A 2BO6A 1ZJ0A 1G8OA 4LW6A 4EE5A 2VFZA 3RSBA 3I0CA 4Q7CA 4C2SA 3SX7A 2Y4KA 4HG6A 2WGZA 3OH4A 2YQSA 4Y63A 4XWIA 4AYJA 4DECA 4KC4A 2V0LA 1G9RA 3FWWA 3SXBA 4FRHA 2WEEA 1NF5B 5CMIA 1FO8A 2VS3A 4BMAA 1V82A 1VH1A 2OEGA 1S4PA 1H5SD 3JUKA 3OGZA 4EVWA 4EEMA 1E5KA 4NANA 4NALA 1W77A 4FRDA 3POLA 4KRVA 1INIA 2A8WA 2PX7A 3V0OA 2P6WA 4MNDA 3D5NA 5C47A 3RMWA 2JCOA 1H3MA 2X60A 4UEGA 3DUVA 4KC1A 2WVLA 3KIAA 5D91A 1FO9A 4FRAA 5C4CA 5EIYA 1VZUA 2P73A 2V0IA 2APCA 5C3DA 4FREA 1ZJ2A 2FFVA 2Y4LA 2C0NA 3I0EA 5CQPA 1GWWA 2VXMA 1QG8A 1HM8A 4D11C 1G2VA 5I1FA 1ZJPA 2OEFA 5J49A 1GQ9A 1WSZA 2FFUA 4G3PA 1FXJA 1R7VA 2OI6A 3OH0A 5CQLX 1QGSA 2GGOA 1V83A 4HO8A 1NMMB 3OKRA 2J0AA 4IRPA 1ZHJA 2AM5A 3I0LA 3SPTA 1VGUA 4HO4A 5FTVA 3ZLKA 1O0RA 1FGGA 4EEGA 2PA4A
chains in the Genus database with same CATH topology
1JV3A 3U2VA 5CQMX 5FU0A 5C8RA 1H5RB 1ZI3A 2V0JA 3CKVA 3OH3A 1FXOA 1INJA 1FR8A 4J18A 1S4NA 4FRMA 4D48A 3N9WA 4EEAA 4G87A 3V8ZA 1H4CA 2BO8A 2BO7A 4O6NA 5CQOA 1H5RA 5FU8A 2WVKA 4KQLA 4HO6A 5IDTA 4NAIA 1IIMA 4Y62A 2JCJA 5EJ1A 4Y6NA 4FRPA 5C3BA 2RJ9A 5FYEA 2VSHA 1O23B 5C4BA 3K8EA 2W0VA 1HJJA 5EJZA 4FIXA 2D7RA 2FYAA 5L6VA 1S4OA 1H5TB 5C4DA 1LL3A 2VS4A 4MIXA 3CKNA 4E1KA 1ZI5A 3EE5A 4ZDQA 5IFYA 3NGWA 4B2XA 1VM8A 5DDVA 1H7TA 1H5TA 1LL0A 2UX8A 5FV9A 4K6RA 2RJ6A 4M2AA 4DE7A 1G95A 4HCQA 2QH5A 5BXCA 1R80A 2O1FA 4P00A 5CQNX 2O1GA 2AECA 2RJ7A 1G93A 1R7UA 3SXEA 4FCEA 2GGQA 2YQHA 2ICXA 1WVCA 1PZTA 1H7EA 2WVMA 1FZWA 3I0FA 4DDZA 2ZU7A 1H7GA 4CJ8A 3SXAA 4ARWA 2VXLA 2Y7AA 4JISA 1R7TA 3T7MA 2D7IA 5C1GA 3U2TA 1H7FA 3F1CA 3K8DA 2XWMA 2RIZA 4JD0A 2AH9A 5C1LA 3LW6A 3ZGFA 2I7BA 1H7LA 1GQCA 3Q4SA 3D98A 1G3LA 5AJNA 2BO4A 2YQCA 1HM9A 4G3SA 5C38A 5FTSA 1GA8A 3V0PA 1VPAA 1G23A 1EZIA 4FRBA 1H4EA 1ZCTA 3V0NA 2AM4A 5CMFX 1LZ0A 2I5KA 3PNNA 3V91A 4EE4A 3DJ4A 5C4EA 3I0IX 3Q7UA 1MC3A 3U0YA 1R81A 3CKQA 1MP5A 4B4MA 5JQQA 1MP4A 2MZBA 5C1HA 4D0ZA 3E25A 2XMHA 3I0DA 4HO3A 1FRWA 1W57A 5D92A 1HV9A 1NWGB 2ICYA 5DDTA 4KPXA 1H5SB 1TW1A 1GX4A 4R7PA 1VGZA 1Z90A 2VS5A 4Y7FA 1HJLA 4LW3A 4D11A 4KNRA 1H7HA 4Y7GA 4O6MA 2RJ0A 2VK9A 3OAMA 1H5SA 1G0RA 1NHEB 4KC2A 1YP4A 3SXCA 2ZU8A 3USQA 1OMXA 2Z86A 4HO2A 3T7OA 4FROA 1ZJOA 3V8YA 1TW5A 2RJ4A 1VH3A 2E3DA 1FOAA 1V84A 4GBPA 1YP3A 2E8BA 3U2WA 3SX3A 2Z87A 5CMGX 1WT2A 3RMVA 5AJOA 2Y4JA 1G97A 1OMZA 2I5EA 2VSIA 2JCLA 1ZCUA 2WE9A 3U2UA 1LZJA 1ZIZA 4B3UA 2W0WA 2XWLA 3F1YA 3TZTA 1XZ6A 3R2WA 2J0BA 2RIXA 4AC3A 4FIYA 4FQWA 1YP2A 5C3AA 1JYLA 5L6SA 2YC3A 3I0KA 1H4DA 1VGWA 4HO9A 3USRA 2XWNA 4HOCA 3V90A 2X65A 2Q4JA 3E26A 4D0TA 2RIYA 3ZLLA 2D0JA 2Y4MA 4KPZA 4KXOA 2FY7A 1W55A 3JTJA 1FWYA 4YS8A 4BQHA 2RITA 2AGDA 1ZI1A 2A8UA 3ZF8A 2O1HA 1GWVA 4B5BA 1VZXA 3DK5A 3FOQA 1YROB 2YESA 4FCUA 4G3QA 4KNXA 1TZFA 4HO0A 1VICA 1NKHB 5FUHA 3R3IA 1GX0A 3V0QA 2X5ZA 3O3PA 4EE3A 2QGIA 2RJ8A 1ZJ3A 2JCKA 1O7OA 5C48A 2AE7A 3CKJA 3OH1A 4Y7TA 3V0MA 3ZGGA 1VZTA 2ZU9A 5CMHA 1WT0A 2OI7A 1O7QA 2V0HA 4IRQA 1PZYB 4MYBA 3U2XA 1WT3A 3CU0A 4Y9XA 1LZIA 4P02A 4Y7VA 1KWSA 1ON8A 2FYCB 3ST8A 3IOHA 3PKQA 1IINA 3SXGA 2YC5A 3D8VA 4Y6UA 3TQDA 4B4GA 3SX8A 2PGYA 4CJBA 1LL2A 1ZCVA 3BRKX 3OH2A 3I0GA 1HM0A 3I0HA 4ASYA 3Q80A 2YCMA 1FGXA 1SS9A 4L41C 2FYDB 4Y64A 2AESA 1ZDFA 2AM3A 3HL3A 3QVBA 4M2BA 5AJPA 3SX5A 5C49A 2WAWA 4M28A 1H5SC 4ECMA 2YQJA 2VD4A 4EEOA 2P72A 5C36A 3U0XA 3OC9A 1G1LA 1LVWA 2NXVA 1LZ7A 3CKOA 4FRQA 4AAWA 1JYKA 3T7NA 2CU2A 1R7YA 4HO5A 1MP3A 1OQMB 4FRLA 2V0KA 4NAKA 3IOIA 1JVDA 4CVHA 4CJCA 2X5SA 5C4FA 1NQIB 1JVGA 1R82A 2DPWA 5IDSA 4B4BA 1FG5N 1I52A 2QKXA 3I0JA 1JV1A 2OI5A 3PKPA 1XHBA 1ZCYA 1WT1A 1ZDGA 3IOJA 1R7XA 3BCVA 1VGTA 2RJ1A 5HS2A 4M4KA 1ON6A 4ASJA 1H7QA 3GUEA 4AYLA 2FYBA 3CGXA 1ZI4A 1FR9A 2XMEA 1QGQA 1EYRA 3JUJA 3SXDA 5CMJA 1QWJA 1TVYA 2Y6PA 3V0LA 1ZJ1A 2RJ5A 4B42A 4B2WA 1K4VA 4Y7UA 2PGVA 4KT7A 2BO6A 1ZJ0A 1G8OA 4LW6A 4EE5A 2VFZA 3RSBA 3I0CA 4Q7CA 4C2SA 3SX7A 2Y4KA 4HG6A 2WGZA 3OH4A 2YQSA 4Y63A 4XWIA 4AYJA 4DECA 4KC4A 2V0LA 1G9RA 3FWWA 3SXBA 4FRHA 2WEEA 1NF5B 5CMIA 1FO8A 2VS3A 4BMAA 1V82A 1VH1A 2OEGA 1S4PA 1H5SD 3JUKA 3OGZA 4EVWA 4EEMA 1E5KA 4NANA 4NALA 1W77A 4FRDA 3POLA 4KRVA 1INIA 2A8WA 2PX7A 3V0OA 2P6WA 4MNDA 3D5NA 5C47A 3RMWA 2JCOA 1H3MA 2X60A 4UEGA 3DUVA 4KC1A 2WVLA 3KIAA 5D91A 1FO9A 4FRAA 5C4CA 5EIYA 1VZUA 2P73A 2V0IA 2APCA 5C3DA 4FREA 1ZJ2A 2FFVA 2Y4LA 2C0NA 3I0EA 5CQPA 1GWWA 2VXMA 1QG8A 1HM8A 4D11C 1G2VA 5I1FA 1ZJPA 2OEFA 5J49A 1GQ9A 1WSZA 2FFUA 4G3PA 1FXJA 1R7VA 2OI6A 3OH0A 5CQLX 1QGSA 2GGOA 1V83A 4HO8A 1NMMB 3OKRA 2J0AA 4IRPA 1ZHJA 2AM5A 3I0LA 3SPTA 1VGUA 4HO4A 5FTVA 3ZLKA 1O0RA 1FGGA 4EEGA 2PA4A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1JV3 A;  3U2V A;  5CQM X;  5FU0 A;  5C8R A;  1H5R B;  1ZI3 A;  2V0J A;  3CKV A;  3OH3 A;  1FXO A;  1INJ A;  1FR8 A;  4J18 A;  1S4N A;  4FRM A;  4D48 A;  3N9W A;  4EEA A;  4G87 A;  3V8Z A;  1H4C A;  2BO8 A;  2BO7 A;  5CQO A;  1H5R A;  5FU8 A;  2WVK A;  4KQL A;  4HO6 A;  5IDT A;  4NAI A;  1IIM A;  4Y62 A;  2JCJ A;  5EJ1 A;  4Y6N A;  4FRP A;  5C3B A;  2RJ9 A;  5FYE A;  2VSH A;  1O23 B;  5C4B A;  3K8E A;  2W0V A;  1HJJ A;  5EJZ A;  2D7R A;  2FYA A;  5L6V A;  1S4O A;  1H5T B;  5C4D A;  1LL3 A;  2VS4 A;  3CKN A;  4E1K A;  1ZI5 A;  3EE5 A;  4ZDQ A;  5IFY A;  3NGW A;  4B2X A;  1VM8 A;  5DDV A;  1H7T A;  1H5T A;  1LL0 A;  2UX8 A;  5FV9 A;  4K6R A;  2RJ6 A;  4M2A A;  4DE7 A;  1G95 A;  4HCQ A;  2QH5 A;  5BXC A;  1R80 A;  2O1F A;  4P00 A;  5CQN X;  2O1G A;  2AEC A;  2RJ7 A;  1G93 A;  1R7U A;  3SXE A;  4FCE A;  2GGQ A;  2YQH A;  2ICX A;  1WVC A;  1PZT A;  1H7E A;  2WVM A;  1FZW A;  3I0F A;  4DDZ A;  2ZU7 A;  1H7G A;  4CJ8 A;  3SXA A;  4ARW A;  2VXL A;  2Y7A A;  4JIS A;  1R7T A;  3T7M A;  2D7I A;  5C1G A;  3U2T A;  1H7F A;  3F1C A;  3K8D A;  2XWM A;  2RIZ A;  4JD0 A;  2AH9 A;  5C1L A;  3LW6 A;  3ZGF A;  2I7B A;  1H7L A;  1GQC A;  3Q4S A;  3D98 A;  1G3L A;  5AJN A;  2BO4 A;  2YQC A;  1HM9 A;  4G3S A;  5C38 A;  5FTS A;  1GA8 A;  3V0P A;  1VPA A;  1G23 A;  1EZI A;  4FRB A;  1H4E A;  1ZCT A;  3V0N A;  2AM4 A;  5CMF X;  1LZ0 A;  2I5K A;  3PNN A;  3V91 A;  4EE4 A;  3DJ4 A;  5C4E A;  3I0I X;  3Q7U A;  1MC3 A;  3U0Y A;  1R81 A;  3CKQ A;  1MP5 A;  4B4M A;  5JQQ A;  1MP4 A;  2MZB A;  5C1H A;  4D0Z A;  3E25 A;  2XMH A;  3I0D A;  4HO3 A;  1FRW A;  1W57 A;  1HV9 A;  1NWG B;  2ICY A;  5DDT A;  4KPX A;  1H5S B;  1TW1 A;  1GX4 A;  4R7P A;  1VGZ A;  1Z90 A;  2VS5 A;  4Y7F A;  1HJL A;  4LW3 A;  4D11 A;  4KNR A;  1H7H A;  4Y7G A;  2RJ0 A;  3OAM A;  1H5S A;  1G0R A;  1NHE B;  4KC2 A;  1YP4 A;  3SXC A;  2ZU8 A;  3USQ A;  1OMX A;  2Z86 A;  4HO2 A;  3T7O A;  4FRO A;  1ZJO A;  3V8Y A;  1TW5 A;  2RJ4 A;  1VH3 A;  2E3D A;  1FOA A;  1V84 A;  4GBP A;  1YP3 A;  2E8B A;  3U2W A;  3SX3 A;  2Z87 A;  5CMG X;  1WT2 A;  3RMV A;  5AJO A;  2Y4J A;  1G97 A;  1OMZ A;  2I5E A;  2VSI A;  2JCL A;  1ZCU A;  2WE9 A;  3U2U A;  1LZJ A;  1ZIZ A;  4B3U A;  2W0W A;  2XWL A;  3F1Y A;  3TZT A;  1XZ6 A;  3R2W A;  2RIX A;  4AC3 A;  4FQW A;  1YP2 A;  5C3A A;  1JYL A;  5L6S A;  2YC3 A;  3I0K A;  1H4D A;  1VGW A;  4HO9 A;  3USR A;  2XWN A;  4HOC A;  3V90 A;  2X65 A;  2Q4J A;  3E26 A;  4D0T A;  2RIY A;  3ZLL A;  2D0J A;  2Y4M A;  4KPZ A;  4KXO A;  2FY7 A;  1W55 A;  3JTJ A;  1FWY A;  4YS8 A;  4BQH A;  2RIT A;  2AGD A;  1ZI1 A;  2A8U A;  3ZF8 A;  2O1H A;  1GWV A;  4B5B A;  1VZX A;  3DK5 A;  3FOQ A;  1YRO B;  2YES A;  4FCU A;  4G3Q A;  4KNX A;  1TZF A;  4HO0 A;  1VIC A;  1NKH B;  5FUH A;  3R3I A;  1GX0 A;  3V0Q A;  2X5Z A;  3O3P A;  4EE3 A;  2QGI A;  2RJ8 A;  1ZJ3 A;  2JCK A;  1O7O A;  5C48 A;  2AE7 A;  3CKJ A;  3OH1 A;  4Y7T A;  3V0M A;  3ZGG A;  1VZT A;  2ZU9 A;  5CMH A;  1WT0 A;  2OI7 A;  1O7Q A;  2V0H A;  4IRQ A;  1PZY B;  4MYB A;  3U2X A;  1WT3 A;  3CU0 A;  4Y9X A;  1LZI A;  4P02 A;  4Y7V A;  1KWS A;  1ON8 A;  2FYC B;  3ST8 A;  3IOH A;  3PKQ A;  1IIN A;  3SXG A;  2YC5 A;  3D8V A;  4Y6U A;  3TQD A;  4B4G A;  3SX8 A;  2PGY A;  4CJB A;  1LL2 A;  1ZCV A;  3BRK X;  3OH2 A;  3I0G A;  1HM0 A;  3I0H A;  4ASY A;  3Q80 A;  2YCM A;  1FGX A;  1SS9 A;  4L41 C;  2FYD B;  4Y64 A;  2AES A;  1ZDF A;  2AM3 A;  3HL3 A;  3QVB A;  4M2B A;  5AJP A;  3SX5 A;  5C49 A;  2WAW A;  4M28 A;  1H5S C;  4ECM A;  2YQJ A;  2VD4 A;  4EEO A;  2P72 A;  5C36 A;  3U0X A;  3OC9 A;  1G1L A;  1LVW A;  2NXV A;  1LZ7 A;  3CKO A;  4FRQ A;  4AAW A;  1JYK A;  3T7N A;  2CU2 A;  1R7Y A;  4HO5 A;  1MP3 A;  1OQM B;  4FRL A;  2V0K A;  4NAK A;  3IOI A;  1JVD A;  4CVH A;  4CJC A;  2X5S A;  5C4F A;  1NQI B;  1JVG A;  1R82 A;  2DPW A;  5IDS A;  4B4B A;  1FG5 N;  1I52 A;  2QKX A;  3I0J A;  1JV1 A;  2OI5 A;  3PKP A;  1XHB A;  1ZCY A;  1WT1 A;  1ZDG A;  3IOJ A;  1R7X A;  3BCV A;  1VGT A;  2RJ1 A;  5HS2 A;  4M4K A;  1ON6 A;  4ASJ A;  1H7Q A;  3GUE A;  4AYL A;  2FYB A;  3CGX A;  1ZI4 A;  1FR9 A;  2XME A;  1QGQ A;  1EYR A;  3JUJ A;  3SXD A;  5CMJ A;  1QWJ A;  1TVY A;  2Y6P A;  3V0L A;  1ZJ1 A;  2RJ5 A;  4B42 A;  4B2W A;  1K4V A;  4Y7U A;  2PGV A;  4KT7 A;  2BO6 A;  1ZJ0 A;  1G8O A;  4LW6 A;  4EE5 A;  2VFZ A;  3RSB A;  3I0C A;  4C2S A;  3SX7 A;  2Y4K A;  4HG6 A;  2WGZ A;  3OH4 A;  2YQS A;  4Y63 A;  4XWI A;  4AYJ A;  4DEC A;  4KC4 A;  2V0L A;  1G9R A;  3FWW A;  3SXB A;  4FRH A;  2WEE A;  1NF5 B;  5CMI A;  1FO8 A;  2VS3 A;  4BMA A;  1V82 A;  1VH1 A;  2OEG A;  1S4P A;  1H5S D;  3JUK A;  3OGZ A;  4EVW A;  4EEM A;  1E5K A;  4NAN A;  4NAL A;  1W77 A;  4FRD A;  3POL A;  4KRV A;  1INI A;  2A8W A;  2PX7 A;  3V0O A;  2P6W A;  4MND A;  3D5N A;  5C47 A;  3RMW A;  2JCO A;  1H3M A;  2X60 A;  4UEG A;  3DUV A;  4KC1 A;  2WVL A;  3KIA A;  1FO9 A;  4FRA A;  5C4C A;  5EIY A;  1VZU A;  2P73 A;  2V0I A;  2APC A;  5C3D A;  4FRE A;  1ZJ2 A;  2FFV A;  2Y4L A;  3I0E A;  5CQP A;  1GWW A;  2VXM A;  1QG8 A;  1HM8 A;  4D11 C;  1G2V A;  5I1F A;  1ZJP A;  2OEF A;  5J49 A;  1GQ9 A;  1WSZ A;  2FFU A;  4G3P A;  1FXJ A;  1R7V A;  2OI6 A;  3OH0 A;  5CQL X;  1QGS A;  2GGO A;  1V83 A;  4HO8 A;  1NMM B;  3OKR A;  4IRP A;  1ZHJ A;  2AM5 A;  3I0L A;  3SPT A;  1VGU A;  4HO4 A;  5FTV A;  3ZLK A;  1O0R A;  1FGG A;  4EEG A;  2PA4 A; 
#chains in the Genus database with same CATH topology
 1JV3 A;  3U2V A;  5CQM X;  5FU0 A;  5C8R A;  1H5R B;  1ZI3 A;  2V0J A;  3CKV A;  3OH3 A;  1FXO A;  1INJ A;  1FR8 A;  4J18 A;  1S4N A;  4FRM A;  4D48 A;  3N9W A;  4EEA A;  4G87 A;  3V8Z A;  1H4C A;  2BO8 A;  2BO7 A;  4O6N A;  5CQO A;  1H5R A;  5FU8 A;  2WVK A;  4KQL A;  4HO6 A;  5IDT A;  4NAI A;  1IIM A;  4Y62 A;  2JCJ A;  5EJ1 A;  4Y6N A;  4FRP A;  5C3B A;  2RJ9 A;  5FYE A;  2VSH A;  1O23 B;  5C4B A;  3K8E A;  2W0V A;  1HJJ A;  5EJZ A;  4FIX A;  2D7R A;  2FYA A;  5L6V A;  1S4O A;  1H5T B;  5C4D A;  1LL3 A;  2VS4 A;  4MIX A;  3CKN A;  4E1K A;  1ZI5 A;  3EE5 A;  4ZDQ A;  5IFY A;  3NGW A;  4B2X A;  1VM8 A;  5DDV A;  1H7T A;  1H5T A;  1LL0 A;  2UX8 A;  5FV9 A;  4K6R A;  2RJ6 A;  4M2A A;  4DE7 A;  1G95 A;  4HCQ A;  2QH5 A;  5BXC A;  1R80 A;  2O1F A;  4P00 A;  5CQN X;  2O1G A;  2AEC A;  2RJ7 A;  1G93 A;  1R7U A;  3SXE A;  4FCE A;  2GGQ A;  2YQH A;  2ICX A;  1WVC A;  1PZT A;  1H7E A;  2WVM A;  1FZW A;  3I0F A;  4DDZ A;  2ZU7 A;  1H7G A;  4CJ8 A;  3SXA A;  4ARW A;  2VXL A;  2Y7A A;  4JIS A;  1R7T A;  3T7M A;  2D7I A;  5C1G A;  3U2T A;  1H7F A;  3F1C A;  3K8D A;  2XWM A;  2RIZ A;  4JD0 A;  2AH9 A;  5C1L A;  3LW6 A;  3ZGF A;  2I7B A;  1H7L A;  1GQC A;  3Q4S A;  3D98 A;  1G3L A;  5AJN A;  2BO4 A;  2YQC A;  1HM9 A;  4G3S A;  5C38 A;  5FTS A;  1GA8 A;  3V0P A;  1VPA A;  1G23 A;  1EZI A;  4FRB A;  1H4E A;  1ZCT A;  3V0N A;  2AM4 A;  5CMF X;  1LZ0 A;  2I5K A;  3PNN A;  3V91 A;  4EE4 A;  3DJ4 A;  5C4E A;  3I0I X;  3Q7U A;  1MC3 A;  3U0Y A;  1R81 A;  3CKQ A;  1MP5 A;  4B4M A;  5JQQ A;  1MP4 A;  2MZB A;  5C1H A;  4D0Z A;  3E25 A;  2XMH A;  3I0D A;  4HO3 A;  1FRW A;  1W57 A;  5D92 A;  1HV9 A;  1NWG B;  2ICY A;  5DDT A;  4KPX A;  1H5S B;  1TW1 A;  1GX4 A;  4R7P A;  1VGZ A;  1Z90 A;  2VS5 A;  4Y7F A;  1HJL A;  4LW3 A;  4D11 A;  4KNR A;  1H7H A;  4Y7G A;  4O6M A;  2RJ0 A;  2VK9 A;  3OAM A;  1H5S A;  1G0R A;  1NHE B;  4KC2 A;  1YP4 A;  3SXC A;  2ZU8 A;  3USQ A;  1OMX A;  2Z86 A;  4HO2 A;  3T7O A;  4FRO A;  1ZJO A;  3V8Y A;  1TW5 A;  2RJ4 A;  1VH3 A;  2E3D A;  1FOA A;  1V84 A;  4GBP A;  1YP3 A;  2E8B A;  3U2W A;  3SX3 A;  2Z87 A;  5CMG X;  1WT2 A;  3RMV A;  5AJO A;  2Y4J A;  1G97 A;  1OMZ A;  2I5E A;  2VSI A;  2JCL A;  1ZCU A;  2WE9 A;  3U2U A;  1LZJ A;  1ZIZ A;  4B3U A;  2W0W A;  2XWL A;  3F1Y A;  3TZT A;  1XZ6 A;  3R2W A;  2J0B A;  2RIX A;  4AC3 A;  4FIY A;  4FQW A;  1YP2 A;  5C3A A;  1JYL A;  5L6S A;  2YC3 A;  3I0K A;  1H4D A;  1VGW A;  4HO9 A;  3USR A;  2XWN A;  4HOC A;  3V90 A;  2X65 A;  2Q4J A;  3E26 A;  4D0T A;  2RIY A;  3ZLL A;  2D0J A;  2Y4M A;  4KPZ A;  4KXO A;  2FY7 A;  1W55 A;  3JTJ A;  1FWY A;  4YS8 A;  4BQH A;  2RIT A;  2AGD A;  1ZI1 A;  2A8U A;  3ZF8 A;  2O1H A;  1GWV A;  4B5B A;  1VZX A;  3DK5 A;  3FOQ A;  1YRO B;  2YES A;  4FCU A;  4G3Q A;  4KNX A;  1TZF A;  4HO0 A;  1VIC A;  1NKH B;  5FUH A;  3R3I A;  1GX0 A;  3V0Q A;  2X5Z A;  3O3P A;  4EE3 A;  2QGI A;  2RJ8 A;  1ZJ3 A;  2JCK A;  1O7O A;  5C48 A;  2AE7 A;  3CKJ A;  3OH1 A;  4Y7T A;  3V0M A;  3ZGG A;  1VZT A;  2ZU9 A;  5CMH A;  1WT0 A;  2OI7 A;  1O7Q A;  2V0H A;  4IRQ A;  1PZY B;  4MYB A;  3U2X A;  1WT3 A;  3CU0 A;  4Y9X A;  1LZI A;  4P02 A;  4Y7V A;  1KWS A;  1ON8 A;  2FYC B;  3ST8 A;  3IOH A;  3PKQ A;  1IIN A;  3SXG A;  2YC5 A;  3D8V A;  4Y6U A;  3TQD A;  4B4G A;  3SX8 A;  2PGY A;  4CJB A;  1LL2 A;  1ZCV A;  3BRK X;  3OH2 A;  3I0G A;  1HM0 A;  3I0H A;  4ASY A;  3Q80 A;  2YCM A;  1FGX A;  1SS9 A;  4L41 C;  2FYD B;  4Y64 A;  2AES A;  1ZDF A;  2AM3 A;  3HL3 A;  3QVB A;  4M2B A;  5AJP A;  3SX5 A;  5C49 A;  2WAW A;  4M28 A;  1H5S C;  4ECM A;  2YQJ A;  2VD4 A;  4EEO A;  2P72 A;  5C36 A;  3U0X A;  3OC9 A;  1G1L A;  1LVW A;  2NXV A;  1LZ7 A;  3CKO A;  4FRQ A;  4AAW A;  1JYK A;  3T7N A;  2CU2 A;  1R7Y A;  4HO5 A;  1MP3 A;  1OQM B;  4FRL A;  2V0K A;  4NAK A;  3IOI A;  1JVD A;  4CVH A;  4CJC A;  2X5S A;  5C4F A;  1NQI B;  1JVG A;  1R82 A;  2DPW A;  5IDS A;  4B4B A;  1FG5 N;  1I52 A;  2QKX A;  3I0J A;  1JV1 A;  2OI5 A;  3PKP A;  1XHB A;  1ZCY A;  1WT1 A;  1ZDG A;  3IOJ A;  1R7X A;  3BCV A;  1VGT A;  2RJ1 A;  5HS2 A;  4M4K A;  1ON6 A;  4ASJ A;  1H7Q A;  3GUE A;  4AYL A;  2FYB A;  3CGX A;  1ZI4 A;  1FR9 A;  2XME A;  1QGQ A;  1EYR A;  3JUJ A;  3SXD A;  5CMJ A;  1QWJ A;  1TVY A;  2Y6P A;  3V0L A;  1ZJ1 A;  2RJ5 A;  4B42 A;  4B2W A;  1K4V A;  4Y7U A;  2PGV A;  4KT7 A;  2BO6 A;  1ZJ0 A;  1G8O A;  4LW6 A;  4EE5 A;  2VFZ A;  3RSB A;  3I0C A;  4Q7C A;  4C2S A;  3SX7 A;  2Y4K A;  4HG6 A;  2WGZ A;  3OH4 A;  2YQS A;  4Y63 A;  4XWI A;  4AYJ A;  4DEC A;  4KC4 A;  2V0L A;  1G9R A;  3FWW A;  3SXB A;  4FRH A;  2WEE A;  1NF5 B;  5CMI A;  1FO8 A;  2VS3 A;  4BMA A;  1V82 A;  1VH1 A;  2OEG A;  1S4P A;  1H5S D;  3JUK A;  3OGZ A;  4EVW A;  4EEM A;  1E5K A;  4NAN A;  4NAL A;  1W77 A;  4FRD A;  3POL A;  4KRV A;  1INI A;  2A8W A;  2PX7 A;  3V0O A;  2P6W A;  4MND A;  3D5N A;  5C47 A;  3RMW A;  2JCO A;  1H3M A;  2X60 A;  4UEG A;  3DUV A;  4KC1 A;  2WVL A;  3KIA A;  5D91 A;  1FO9 A;  4FRA A;  5C4C A;  5EIY A;  1VZU A;  2P73 A;  2V0I A;  2APC A;  5C3D A;  4FRE A;  1ZJ2 A;  2FFV A;  2Y4L A;  2C0N A;  3I0E A;  5CQP A;  1GWW A;  2VXM A;  1QG8 A;  1HM8 A;  4D11 C;  1G2V A;  5I1F A;  1ZJP A;  2OEF A;  5J49 A;  1GQ9 A;  1WSZ A;  2FFU A;  4G3P A;  1FXJ A;  1R7V A;  2OI6 A;  3OH0 A;  5CQL X;  1QGS A;  2GGO A;  1V83 A;  4HO8 A;  1NMM B;  3OKR A;  2J0A A;  4IRP A;  1ZHJ A;  2AM5 A;  3I0L A;  3SPT A;  1VGU A;  4HO4 A;  5FTV A;  3ZLK A;  1O0R A;  1FGG A;  4EEG A;  2PA4 A; 
#chains in the Genus database with same CATH homology
 1JV3 A;  3U2V A;  5CQM X;  5FU0 A;  5C8R A;  1H5R B;  1ZI3 A;  2V0J A;  3CKV A;  3OH3 A;  1FXO A;  1INJ A;  1FR8 A;  4J18 A;  1S4N A;  4FRM A;  4D48 A;  3N9W A;  4EEA A;  4G87 A;  3V8Z A;  1H4C A;  2BO8 A;  2BO7 A;  4O6N A;  5CQO A;  1H5R A;  5FU8 A;  2WVK A;  4KQL A;  4HO6 A;  5IDT A;  4NAI A;  1IIM A;  4Y62 A;  2JCJ A;  5EJ1 A;  4Y6N A;  4FRP A;  5C3B A;  2RJ9 A;  5FYE A;  2VSH A;  1O23 B;  5C4B A;  3K8E A;  2W0V A;  1HJJ A;  5EJZ A;  4FIX A;  2D7R A;  2FYA A;  5L6V A;  1S4O A;  1H5T B;  5C4D A;  1LL3 A;  2VS4 A;  4MIX A;  3CKN A;  4E1K A;  1ZI5 A;  3EE5 A;  4ZDQ A;  5IFY A;  3NGW A;  4B2X A;  1VM8 A;  5DDV A;  1H7T A;  1H5T A;  1LL0 A;  2UX8 A;  5FV9 A;  4K6R A;  2RJ6 A;  4M2A A;  4DE7 A;  1G95 A;  4HCQ A;  2QH5 A;  5BXC A;  1R80 A;  2O1F A;  4P00 A;  5CQN X;  2O1G A;  2AEC A;  2RJ7 A;  1G93 A;  1R7U A;  3SXE A;  4FCE A;  2GGQ A;  2YQH A;  2ICX A;  1WVC A;  1PZT A;  1H7E A;  2WVM A;  1FZW A;  3I0F A;  4DDZ A;  2ZU7 A;  1H7G A;  4CJ8 A;  3SXA A;  4ARW A;  2VXL A;  2Y7A A;  4JIS A;  1R7T A;  3T7M A;  2D7I A;  5C1G A;  3U2T A;  1H7F A;  3F1C A;  3K8D A;  2XWM A;  2RIZ A;  4JD0 A;  2AH9 A;  5C1L A;  3LW6 A;  3ZGF A;  2I7B A;  1H7L A;  1GQC A;  3Q4S A;  3D98 A;  1G3L A;  5AJN A;  2BO4 A;  2YQC A;  1HM9 A;  4G3S A;  5C38 A;  5FTS A;  1GA8 A;  3V0P A;  1VPA A;  1G23 A;  1EZI A;  4FRB A;  1H4E A;  1ZCT A;  3V0N A;  2AM4 A;  5CMF X;  1LZ0 A;  2I5K A;  3PNN A;  3V91 A;  4EE4 A;  3DJ4 A;  5C4E A;  3I0I X;  3Q7U A;  1MC3 A;  3U0Y A;  1R81 A;  3CKQ A;  1MP5 A;  4B4M A;  5JQQ A;  1MP4 A;  2MZB A;  5C1H A;  4D0Z A;  3E25 A;  2XMH A;  3I0D A;  4HO3 A;  1FRW A;  1W57 A;  5D92 A;  1HV9 A;  1NWG B;  2ICY A;  5DDT A;  4KPX A;  1H5S B;  1TW1 A;  1GX4 A;  4R7P A;  1VGZ A;  1Z90 A;  2VS5 A;  4Y7F A;  1HJL A;  4LW3 A;  4D11 A;  4KNR A;  1H7H A;  4Y7G A;  4O6M A;  2RJ0 A;  2VK9 A;  3OAM A;  1H5S A;  1G0R A;  1NHE B;  4KC2 A;  1YP4 A;  3SXC A;  2ZU8 A;  3USQ A;  1OMX A;  2Z86 A;  4HO2 A;  3T7O A;  4FRO A;  1ZJO A;  3V8Y A;  1TW5 A;  2RJ4 A;  1VH3 A;  2E3D A;  1FOA A;  1V84 A;  4GBP A;  1YP3 A;  2E8B A;  3U2W A;  3SX3 A;  2Z87 A;  5CMG X;  1WT2 A;  3RMV A;  5AJO A;  2Y4J A;  1G97 A;  1OMZ A;  2I5E A;  2VSI A;  2JCL A;  1ZCU A;  2WE9 A;  3U2U A;  1LZJ A;  1ZIZ A;  4B3U A;  2W0W A;  2XWL A;  3F1Y A;  3TZT A;  1XZ6 A;  3R2W A;  2J0B A;  2RIX A;  4AC3 A;  4FIY A;  4FQW A;  1YP2 A;  5C3A A;  1JYL A;  5L6S A;  2YC3 A;  3I0K A;  1H4D A;  1VGW A;  4HO9 A;  3USR A;  2XWN A;  4HOC A;  3V90 A;  2X65 A;  2Q4J A;  3E26 A;  4D0T A;  2RIY A;  3ZLL A;  2D0J A;  2Y4M A;  4KPZ A;  4KXO A;  2FY7 A;  1W55 A;  3JTJ A;  1FWY A;  4YS8 A;  4BQH A;  2RIT A;  2AGD A;  1ZI1 A;  2A8U A;  3ZF8 A;  2O1H A;  1GWV A;  4B5B A;  1VZX A;  3DK5 A;  3FOQ A;  1YRO B;  2YES A;  4FCU A;  4G3Q A;  4KNX A;  1TZF A;  4HO0 A;  1VIC A;  1NKH B;  5FUH A;  3R3I A;  1GX0 A;  3V0Q A;  2X5Z A;  3O3P A;  4EE3 A;  2QGI A;  2RJ8 A;  1ZJ3 A;  2JCK A;  1O7O A;  5C48 A;  2AE7 A;  3CKJ A;  3OH1 A;  4Y7T A;  3V0M A;  3ZGG A;  1VZT A;  2ZU9 A;  5CMH A;  1WT0 A;  2OI7 A;  1O7Q A;  2V0H A;  4IRQ A;  1PZY B;  4MYB A;  3U2X A;  1WT3 A;  3CU0 A;  4Y9X A;  1LZI A;  4P02 A;  4Y7V A;  1KWS A;  1ON8 A;  2FYC B;  3ST8 A;  3IOH A;  3PKQ A;  1IIN A;  3SXG A;  2YC5 A;  3D8V A;  4Y6U A;  3TQD A;  4B4G A;  3SX8 A;  2PGY A;  4CJB A;  1LL2 A;  1ZCV A;  3BRK X;  3OH2 A;  3I0G A;  1HM0 A;  3I0H A;  4ASY A;  3Q80 A;  2YCM A;  1FGX A;  1SS9 A;  4L41 C;  2FYD B;  4Y64 A;  2AES A;  1ZDF A;  2AM3 A;  3HL3 A;  3QVB A;  4M2B A;  5AJP A;  3SX5 A;  5C49 A;  2WAW A;  4M28 A;  1H5S C;  4ECM A;  2YQJ A;  2VD4 A;  4EEO A;  2P72 A;  5C36 A;  3U0X A;  3OC9 A;  1G1L A;  1LVW A;  2NXV A;  1LZ7 A;  3CKO A;  4FRQ A;  4AAW A;  1JYK A;  3T7N A;  2CU2 A;  1R7Y A;  4HO5 A;  1MP3 A;  1OQM B;  4FRL A;  2V0K A;  4NAK A;  3IOI A;  1JVD A;  4CVH A;  4CJC A;  2X5S A;  5C4F A;  1NQI B;  1JVG A;  1R82 A;  2DPW A;  5IDS A;  4B4B A;  1FG5 N;  1I52 A;  2QKX A;  3I0J A;  1JV1 A;  2OI5 A;  3PKP A;  1XHB A;  1ZCY A;  1WT1 A;  1ZDG A;  3IOJ A;  1R7X A;  3BCV A;  1VGT A;  2RJ1 A;  5HS2 A;  4M4K A;  1ON6 A;  4ASJ A;  1H7Q A;  3GUE A;  4AYL A;  2FYB A;  3CGX A;  1ZI4 A;  1FR9 A;  2XME A;  1QGQ A;  1EYR A;  3JUJ A;  3SXD A;  5CMJ A;  1QWJ A;  1TVY A;  2Y6P A;  3V0L A;  1ZJ1 A;  2RJ5 A;  4B42 A;  4B2W A;  1K4V A;  4Y7U A;  2PGV A;  4KT7 A;  2BO6 A;  1ZJ0 A;  1G8O A;  4LW6 A;  4EE5 A;  2VFZ A;  3RSB A;  3I0C A;  4Q7C A;  4C2S A;  3SX7 A;  2Y4K A;  4HG6 A;  2WGZ A;  3OH4 A;  2YQS A;  4Y63 A;  4XWI A;  4AYJ A;  4DEC A;  4KC4 A;  2V0L A;  1G9R A;  3FWW A;  3SXB A;  4FRH A;  2WEE A;  1NF5 B;  5CMI A;  1FO8 A;  2VS3 A;  4BMA A;  1V82 A;  1VH1 A;  2OEG A;  1S4P A;  1H5S D;  3JUK A;  3OGZ A;  4EVW A;  4EEM A;  1E5K A;  4NAN A;  4NAL A;  1W77 A;  4FRD A;  3POL A;  4KRV A;  1INI A;  2A8W A;  2PX7 A;  3V0O A;  2P6W A;  4MND A;  3D5N A;  5C47 A;  3RMW A;  2JCO A;  1H3M A;  2X60 A;  4UEG A;  3DUV A;  4KC1 A;  2WVL A;  3KIA A;  5D91 A;  1FO9 A;  4FRA A;  5C4C A;  5EIY A;  1VZU A;  2P73 A;  2V0I A;  2APC A;  5C3D A;  4FRE A;  1ZJ2 A;  2FFV A;  2Y4L A;  2C0N A;  3I0E A;  5CQP A;  1GWW A;  2VXM A;  1QG8 A;  1HM8 A;  4D11 C;  1G2V A;  5I1F A;  1ZJP A;  2OEF A;  5J49 A;  1GQ9 A;  1WSZ A;  2FFU A;  4G3P A;  1FXJ A;  1R7V A;  2OI6 A;  3OH0 A;  5CQL X;  1QGS A;  2GGO A;  1V83 A;  4HO8 A;  1NMM B;  3OKR A;  2J0A A;  4IRP A;  1ZHJ A;  2AM5 A;  3I0L A;  3SPT A;  1VGU A;  4HO4 A;  5FTV A;  3ZLK A;  1O0R A;  1FGG A;  4EEG A;  2PA4 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...