1ZCYA

Apo form of a mutant of glycogenin in which asp159 is replaced by ser
Total Genus 81
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
81
sequence length
266
structure length
257
Chain Sequence
MTDQAFVTLTTNDAYAKGALVLGSSLKQHRTSRRLAVLTTPQVSDTMRKALEIVFDEVITVDILDSGDSAHLTLMKRPELGVTLTKLHCWSLTQYSKCVFMDADTLVLANIDDLFEREELSAAPDPGWPDCFNSGVFVYQPSVETYNQLLHVASEQGSFSGGDQGLLNTFFNSWATTDIRKHLPFIYNLSSISIYSYLPAFKAFGANAKVVHFLGQTKPWNYTYDTKTKSVRSPQFLNVWWDIFTTSVVPLLQQFGL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Glycogenin-1
publication title Requirements for catalysis in mammalian glycogenin.
pubmed doi rcsb
source organism Oryctolagus cuniculus
molecule tags Transferase
total genus 81
structure length 257
sequence length 266
ec nomenclature ec 2.4.1.186: Glycogenin glucosyltransferase.
pdb deposition date 2005-04-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01501 Glyco_transf_8 Glycosyl transferase family 8
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.550.10 Alpha Beta Alpha-Beta Complex Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A 1zcyA00
1NF5B 4P00A 2Y4MA 3SX8A 1JVGA 3DJ4A 3K8DA 1ZIZA 5C47A 3IOJA 3OH4A 1V84A 1INJA 2FYBA 4E1KA 4EE4A 1R7TA 1G2VA 1FO8A 3I0KA 3SPTA 1H5SC 1ZJOA 1R81A 5DDTA 2RJ8A 2X5SA 1OQMB 1W55A 2AM3A 1FRWA 3I0GA 3RSBA 3ZGGA 4HCQA 1MP3A 2X5ZA 1MP4A 1O7QA 1QWJA 2RJ6A 1ZCYA 4HO5A 4MYBA 2PGVA 3ST8A 1VZXA 3I0DA 2RJ0A 1V83A 2YCMA 5C4BA 4JISA 2D7RA 1GQCA 3SXAA 3N9WA 3U0YA 1QG8A 4EE3A 5CQMX 3KIAA 3U2TA 1TVYA 4FQWA 1H7LA 1I52A 2P72A 1H4EA 2BO4A 3FOQA 3V0LA 1ZJ1A 3JTJA 4D0TA 1VGZA 2OI5A 4KC1A 4FCUA 2A8WA 3U2UA 2V0JA 1ZHJA 2AGDA 3SX5A 3LW6A 4KRVA 3T7OA 3USQA 1PZTA 1QGSA 4EEAA 1SS9A 1G97A 1WT3A 1LZJA 4HO3A 1ON6A 4J18A 2O1HA 1VH3A 2O1GA 2I5KA 2V0KA 4K6RA 5C1GA 3V0PA 1JV3A 3OH0A 2BO6A 1G3LA 1MC3A 2QH5A 1H4DA 3U2WA 2RJ1A 3SXDA 3E25A 4D48A 3OH2A 5EJZA 1H5TB 1R7VA 2BO7A 3SX3A 1H7QA 1WSZA 1FXOA 1LVWA 4B42A 2Y7AA 5C38A 3RMWA 1LZIA 2AESA 3USRA 2OI7A 4BMAA 1HM9A 2GGQA 2FYDB 5C49A 1WT0A 5C48A 1XZ6A 3SXBA 2AH9A 2YC5A 4FRBA 2DPWA 1EZIA 4B4BA 2NXVA 2O1FA 2Z87A 1H5SB 3Q4SA 3ZLKA 1NWGB 1V82A 1R82A 1S4PA 2ICYA 2YQHA 5C36A 2Q4JA 4B5BA 1E5KA 1GQ9A 2PA4A 2RJ9A 4G3SA 3I0HA 1H7TA 4KQLA 4B4GA 1S4NA 2Y4JA 1GX4A 2VS5A 1G95A 5J49A 5JQQA 4D11C 2RJ5A 4CJCA 2D7IA 2ZU7A 1JYKA 2VXMA 2WVLA 3IOHA 1FR9A 2RJ4A 2WVKA 1VZUA 1YP2A 2RIYA 2VSIA 3I0LA 3QVBA 1XHBA 4Y7UA 4G87A 4Y7VA 3JUJA 1WVCA 2VS4A 4XWIA 3ZGFA 1VICA 2ICXA 1LL0A 5C4DA 1VGWA 4KPXA 4LW6A 4ASYA 3T7MA 3K8EA 1G93A 2FFVA 2D0JA 3OC9A 3PKQA 2MZBA 5EJ1A 3CKJA 1MP5A 4FROA 3PKPA 1NKHB 3E26A 4KPZA 2BO8A 4EVWA 4FRDA 2FFUA 1H4CA 1WT1A 2FYAA 5CMFX 4CJ8A 2GGOA 5DDVA 5FU8A 4LW3A 2A8UA 4AYLA 1GWVA 5CQPA 4FRMA 1NHEB 3GUEA 1FG5N 3I0FA 2X65A 1G8OA 4Y9XA 4EE5A 4Y6UA 1TW5A 1W57A 3SXGA 1R7YA 4KT7A 4ZDQA 1NMMB 4KC2A 4CJBA 2AE7A 1EYRA 1OMZA 1W77A 1ZCTA 5I1FA 2V0HA 3ZF8A 3CKQA 1KWSA 4EEMA 5L6SA 3CKVA 1TW1A 3F1YA 1ZDGA 1H5RB 2WAWA 2Y4KA 4AAWA 1FR8A 4MNDA 4Y7GA 1YP4A 1FO9A 1O0RA 3V0OA 4M2AA 1FXJA 2WGZA 5CMJA 4HO6A 3V0MA 1H7FA 4HO0A 2YQSA 1FOAA 3OAMA 3CGXA 3U2VA 3I0CA 2OEFA 1ZCVA 1JVDA 2E8BA 5CMGX 3R3IA 4KC4A 3I0JA 2W0VA 2RITA 1GX0A 2E3DA 5C4FA 4HOCA 4NANA 1LZ0A 2XMEA 2YQCA 3BRKX 5IDSA 1R80A 5FYEA 5FV9A 2V0LA 4Y7TA 3D5NA 5FTVA 4EEOA 3T7NA 2I5EA 2CU2A 4BQHA 2FY7A 2I7BA 1GA8A 1VZTA 3D98A 4HO2A 2VXLA 4KNRA 3NGWA 2VD4A 2VFZA 4ASJA 2QKXA 4JD0A 1HJJA 4Y63A 1VH1A 1FGGA 4KXOA 4D0ZA 1FZWA 2PGYA 2Y4LA 5CMIA 3U0XA 1H5TA 4YS8A 4Y7FA 1ZI1A 4FRPA 4ECMA 3CU0A 5L6VA 1ON8A 5AJOA 1HV9A 2P6WA 1FGXA 5FU0A 3POLA 1ZDFA 2XWNA 4DECA 4GBPA 2RIXA 5IDTA 3EE5A 5HS2A 2YQJA 4G3PA 4M28A 2ZU9A 1YP3A 3V0NA 3I0EA 4HO8A 1G1LA 3CKNA 3V8ZA 4EEGA 1OMXA 1H5SA 5AJNA 2APCA 1VGTA 1YROB 4B4MA 2JCOA 4HG6A 4CVHA 2YESA 1HM8A 1R7XA 2V0IA 3OKRA 4M4KA 5C3BA 4IRQA 4ARWA 5C3DA 2VSHA 1Z90A 1H7GA 3IOIA 2JCLA 1H3MA 2OI6A 3R2WA 3PNNA 2XWLA 2XMHA 4FRLA 1H5SD 5C3AA 5C8RA 1IINA 4FCEA 1HM0A 5C1LA 1HJLA 3OGZA 2ZU8A 3CKOA 1LL2A 2W0WA 1ZJ2A 3O3PA 4Y62A 4C2SA 3RMVA 5CQOA 2P73A 2XWMA 5AJPA 1QGQA 1ZCUA 3Q7UA 3JUKA 5CMHA 4DDZA 2FYCB 1IIMA 4HO4A 2WVMA 1WT2A 1H7HA 2VS3A 5BXCA 3V90A 3V91A 3DK5A 4NAKA 4FREA 3BCVA 3OH3A 4AYJA 3OH1A 1O23B 1PZYB 1K4VA 4FRAA 4HO9A 1LL3A 3V0QA 4Y6NA 1ZJ0A 1JV1A 4Y64A 4B2WA 1ZJPA 4KNXA 4UEGA 2RJ7A 1G0RA 1G9RA 1VPAA 5FUHA 2WEEA 1R7UA 3V8YA 3Q80A 4B2XA 2PX7A 2X60A 4NALA 3F1CA 4P02A 1S4OA 1H5RA 4FRQA 3I0IX 2UX8A 1O7OA 2QGIA 5EIYA 3TQDA 1ZI4A 3FWWA 1G23A 4G3QA 1ZI3A 4NAIA 5C4EA 1FWYA 4L41C 2JCKA 1TZFA 5CQLX 4B3UA 2AECA 4FRHA 1INIA 3SXCA 2Y6PA 1VM8A 3DUVA 2WE9A 5CQNX 3D8VA 4D11A 3HL3A 3SXEA 5C4CA 1LZ7A 4R7PA 3TZTA 1ZJ3A 1VGUA 2AM5A 3SX7A 2RIZA 1NQIB 3U2XA 4AC3A 2Z86A 1JYLA 1H7EA 2AM4A 2OEGA 4M2BA 4IRPA 5FTSA 5C1HA 5IFYA 1ZI5A 3ZLLA 2YC3A 1GWWA 4DE7A 2JCJA
chains in the Genus database with same CATH superfamily
1NF5B 4P00A 2Y4MA 3SX8A 1JVGA 3DJ4A 3K8DA 1ZIZA 5C47A 3IOJA 3OH4A 1V84A 1INJA 2FYBA 4E1KA 4EE4A 1R7TA 1G2VA 1FO8A 3I0KA 3SPTA 1H5SC 1ZJOA 1R81A 5DDTA 2RJ8A 2X5SA 1OQMB 1W55A 2AM3A 1FRWA 3I0GA 3RSBA 3ZGGA 4HCQA 1MP3A 2X5ZA 1MP4A 1O7QA 1QWJA 2RJ6A 1ZCYA 4HO5A 4MYBA 2PGVA 3ST8A 1VZXA 3I0DA 2RJ0A 1V83A 2YCMA 5C4BA 4JISA 2D7RA 1GQCA 3SXAA 3N9WA 3U0YA 1QG8A 4EE3A 5CQMX 3KIAA 3U2TA 1TVYA 4FQWA 1H7LA 1I52A 2VK9A 2P72A 2C0NA 1H4EA 2BO4A 3FOQA 3V0LA 1ZJ1A 3JTJA 4O6MA 4D0TA 1VGZA 2OI5A 4KC1A 4Q7CA 4FCUA 2A8WA 3U2UA 2V0JA 1ZHJA 2AGDA 3SX5A 3LW6A 4KRVA 3T7OA 3USQA 1PZTA 1QGSA 4EEAA 1SS9A 1G97A 1WT3A 1LZJA 4HO3A 1ON6A 4J18A 2O1HA 2J0BA 1VH3A 2O1GA 2I5KA 2V0KA 4K6RA 5C1GA 3V0PA 1JV3A 3OH0A 2BO6A 1G3LA 1MC3A 2QH5A 1H4DA 3U2WA 2RJ1A 3SXDA 3E25A 4D48A 3OH2A 5EJZA 1H5TB 1R7VA 2BO7A 3SX3A 1H7QA 1WSZA 1FXOA 1LVWA 4B42A 2Y7AA 5C38A 3RMWA 1LZIA 2AESA 3USRA 2OI7A 4BMAA 1HM9A 2GGQA 2FYDB 5C49A 1WT0A 5C48A 1XZ6A 3SXBA 2AH9A 2YC5A 4FRBA 2DPWA 1EZIA 4FIXA 4B4BA 2NXVA 2O1FA 2Z87A 1H5SB 3Q4SA 3ZLKA 1NWGB 1V82A 1R82A 1S4PA 2ICYA 2YQHA 5C36A 2Q4JA 4B5BA 1E5KA 4FIYA 1GQ9A 2PA4A 2RJ9A 4G3SA 3I0HA 1H7TA 4KQLA 4B4GA 1S4NA 2Y4JA 1GX4A 2VS5A 1G95A 5J49A 5JQQA 4D11C 2RJ5A 4CJCA 2D7IA 2ZU7A 1JYKA 2VXMA 2WVLA 3IOHA 1FR9A 2RJ4A 2WVKA 1VZUA 1YP2A 2RIYA 2VSIA 3I0LA 3QVBA 1XHBA 4Y7UA 4G87A 4Y7VA 3JUJA 1WVCA 2VS4A 4XWIA 3ZGFA 1VICA 2ICXA 1LL0A 5C4DA 1VGWA 4KPXA 4LW6A 4ASYA 3T7MA 3K8EA 1G93A 2FFVA 2D0JA 3OC9A 3PKQA 2MZBA 5EJ1A 3CKJA 1MP5A 4FROA 3PKPA 1NKHB 3E26A 4KPZA 2BO8A 4EVWA 4FRDA 2FFUA 1H4CA 1WT1A 2FYAA 5CMFX 4CJ8A 2GGOA 5DDVA 5FU8A 4LW3A 2A8UA 4AYLA 1GWVA 5CQPA 4FRMA 1NHEB 3GUEA 1FG5N 3I0FA 2X65A 1G8OA 4Y9XA 4EE5A 4Y6UA 1TW5A 1W57A 3SXGA 1R7YA 4KT7A 4ZDQA 1NMMB 4KC2A 4CJBA 2AE7A 1EYRA 1OMZA 1W77A 1ZCTA 5I1FA 2V0HA 3ZF8A 3CKQA 1KWSA 4EEMA 5L6SA 3CKVA 1TW1A 3F1YA 1ZDGA 1H5RB 2WAWA 2Y4KA 4AAWA 1FR8A 4MNDA 4Y7GA 1YP4A 1FO9A 1O0RA 3V0OA 4M2AA 1FXJA 2WGZA 5CMJA 4HO6A 3V0MA 1H7FA 4HO0A 2YQSA 1FOAA 3OAMA 3CGXA 3U2VA 3I0CA 2OEFA 1ZCVA 1JVDA 2E8BA 5CMGX 3R3IA 4KC4A 3I0JA 2W0VA 2RITA 1GX0A 2E3DA 5C4FA 4HOCA 4NANA 1LZ0A 2XMEA 2YQCA 3BRKX 5IDSA 1R80A 5FYEA 5FV9A 2V0LA 4Y7TA 3D5NA 5FTVA 4EEOA 3T7NA 2I5EA 2CU2A 4BQHA 2FY7A 2I7BA 1GA8A 1VZTA 3D98A 4HO2A 2VXLA 4KNRA 3NGWA 2VD4A 2VFZA 4ASJA 2QKXA 4JD0A 1HJJA 4Y63A 1VH1A 1FGGA 4KXOA 4D0ZA 1FZWA 2PGYA 2Y4LA 5CMIA 3U0XA 1H5TA 4YS8A 4Y7FA 1ZI1A 4FRPA 4ECMA 3CU0A 5L6VA 1ON8A 5AJOA 1HV9A 2P6WA 1FGXA 5FU0A 3POLA 1ZDFA 2XWNA 4DECA 4GBPA 2RIXA 5IDTA 3EE5A 5HS2A 2YQJA 4G3PA 4M28A 2ZU9A 1YP3A 3V0NA 3I0EA 4HO8A 1G1LA 3CKNA 3V8ZA 4EEGA 1OMXA 1H5SA 5AJNA 4MIXA 2APCA 1VGTA 1YROB 4B4MA 2JCOA 4HG6A 4CVHA 2YESA 1HM8A 1R7XA 2V0IA 3OKRA 4M4KA 5C3BA 4IRQA 4ARWA 5C3DA 2VSHA 1Z90A 1H7GA 3IOIA 2JCLA 1H3MA 2OI6A 3R2WA 3PNNA 2XWLA 2XMHA 4FRLA 1H5SD 5C3AA 5C8RA 1IINA 4FCEA 1HM0A 5C1LA 1HJLA 3OGZA 2ZU8A 3CKOA 1LL2A 2W0WA 4O6NA 1ZJ2A 3O3PA 4Y62A 4C2SA 3RMVA 5CQOA 2P73A 2XWMA 5AJPA 1QGQA 1ZCUA 3Q7UA 3JUKA 5CMHA 4DDZA 2FYCB 1IIMA 4HO4A 2WVMA 1WT2A 1H7HA 2VS3A 5BXCA 3V90A 3V91A 3DK5A 4NAKA 4FREA 3BCVA 3OH3A 4AYJA 3OH1A 1O23B 1PZYB 1K4VA 4FRAA 4HO9A 1LL3A 3V0QA 4Y6NA 1ZJ0A 1JV1A 4Y64A 4B2WA 1ZJPA 4KNXA 4UEGA 2RJ7A 1G0RA 1G9RA 1VPAA 5FUHA 2WEEA 1R7UA 3V8YA 3Q80A 4B2XA 2PX7A 2X60A 5D92A 4NALA 3F1CA 4P02A 1S4OA 1H5RA 4FRQA 3I0IX 2UX8A 1O7OA 2QGIA 5EIYA 3TQDA 1ZI4A 3FWWA 1G23A 4G3QA 1ZI3A 4NAIA 5C4EA 1FWYA 4L41C 2JCKA 1TZFA 5CQLX 4B3UA 2AECA 4FRHA 1INIA 3SXCA 2Y6PA 1VM8A 3DUVA 2WE9A 5CQNX 3D8VA 4D11A 3HL3A 3SXEA 5C4CA 1LZ7A 4R7PA 3TZTA 1ZJ3A 1VGUA 5D91A 2AM5A 2J0AA 3SX7A 2RIZA 1NQIB 3U2XA 4AC3A 2Z86A 1JYLA 1H7EA 2AM4A 2OEGA 4M2BA 4IRPA 5FTSA 5C1HA 5IFYA 1ZI5A 3ZLLA 2YC3A 1GWWA 4DE7A 2JCJA
chains in the Genus database with same CATH topology
1NF5B 4P00A 2Y4MA 3SX8A 1JVGA 3DJ4A 3K8DA 1ZIZA 5C47A 3IOJA 3OH4A 1V84A 1INJA 2FYBA 4E1KA 4EE4A 1R7TA 1G2VA 1FO8A 3I0KA 3SPTA 1H5SC 1ZJOA 1R81A 5DDTA 2RJ8A 2X5SA 1OQMB 1W55A 2AM3A 1FRWA 3I0GA 3RSBA 3ZGGA 4HCQA 1MP3A 2X5ZA 1MP4A 1O7QA 1QWJA 2RJ6A 1ZCYA 4HO5A 4MYBA 2PGVA 3ST8A 1VZXA 3I0DA 2RJ0A 1V83A 2YCMA 5C4BA 4JISA 2D7RA 1GQCA 3SXAA 3N9WA 3U0YA 1QG8A 4EE3A 5CQMX 3KIAA 3U2TA 1TVYA 4FQWA 1H7LA 1I52A 2VK9A 2P72A 2C0NA 1H4EA 2BO4A 3FOQA 3V0LA 1ZJ1A 3JTJA 4O6MA 4D0TA 1VGZA 2OI5A 4KC1A 4Q7CA 4FCUA 2A8WA 3U2UA 2V0JA 1ZHJA 2AGDA 3SX5A 3LW6A 4KRVA 3T7OA 3USQA 1PZTA 1QGSA 4EEAA 1SS9A 1G97A 1WT3A 1LZJA 4HO3A 1ON6A 4J18A 2O1HA 2J0BA 1VH3A 2O1GA 2I5KA 2V0KA 4K6RA 5C1GA 3V0PA 1JV3A 3OH0A 2BO6A 1G3LA 1MC3A 2QH5A 1H4DA 3U2WA 2RJ1A 3SXDA 3E25A 4D48A 3OH2A 5EJZA 1H5TB 1R7VA 2BO7A 3SX3A 1H7QA 1WSZA 1FXOA 1LVWA 4B42A 2Y7AA 5C38A 3RMWA 1LZIA 2AESA 3USRA 2OI7A 4BMAA 1HM9A 2GGQA 2FYDB 5C49A 1WT0A 5C48A 1XZ6A 3SXBA 2AH9A 2YC5A 4FRBA 2DPWA 1EZIA 4FIXA 4B4BA 2NXVA 2O1FA 2Z87A 1H5SB 3Q4SA 3ZLKA 1NWGB 1V82A 1R82A 1S4PA 2ICYA 2YQHA 5C36A 2Q4JA 4B5BA 1E5KA 4FIYA 1GQ9A 2PA4A 2RJ9A 4G3SA 3I0HA 1H7TA 4KQLA 4B4GA 1S4NA 2Y4JA 1GX4A 2VS5A 1G95A 5J49A 5JQQA 4D11C 2RJ5A 4CJCA 2D7IA 2ZU7A 1JYKA 2VXMA 2WVLA 3IOHA 1FR9A 2RJ4A 2WVKA 1VZUA 1YP2A 2RIYA 2VSIA 3I0LA 3QVBA 1XHBA 4Y7UA 4G87A 4Y7VA 3JUJA 1WVCA 2VS4A 4XWIA 3ZGFA 1VICA 2ICXA 1LL0A 5C4DA 1VGWA 4KPXA 4LW6A 4ASYA 3T7MA 3K8EA 1G93A 2FFVA 2D0JA 3OC9A 3PKQA 2MZBA 5EJ1A 3CKJA 1MP5A 4FROA 3PKPA 1NKHB 3E26A 4KPZA 2BO8A 4EVWA 4FRDA 2FFUA 1H4CA 1WT1A 2FYAA 5CMFX 4CJ8A 2GGOA 5DDVA 5FU8A 4LW3A 2A8UA 4AYLA 1GWVA 5CQPA 4FRMA 1NHEB 3GUEA 1FG5N 3I0FA 2X65A 1G8OA 4Y9XA 4EE5A 4Y6UA 1TW5A 1W57A 3SXGA 1R7YA 4KT7A 4ZDQA 1NMMB 4KC2A 4CJBA 2AE7A 1EYRA 1OMZA 1W77A 1ZCTA 5I1FA 2V0HA 3ZF8A 3CKQA 1KWSA 4EEMA 5L6SA 3CKVA 1TW1A 3F1YA 1ZDGA 1H5RB 2WAWA 2Y4KA 4AAWA 1FR8A 4MNDA 4Y7GA 1YP4A 1FO9A 1O0RA 3V0OA 4M2AA 1FXJA 2WGZA 5CMJA 4HO6A 3V0MA 1H7FA 4HO0A 2YQSA 1FOAA 3OAMA 3CGXA 3U2VA 3I0CA 2OEFA 1ZCVA 1JVDA 2E8BA 5CMGX 3R3IA 4KC4A 3I0JA 2W0VA 2RITA 1GX0A 2E3DA 5C4FA 4HOCA 4NANA 1LZ0A 2XMEA 2YQCA 3BRKX 5IDSA 1R80A 5FYEA 5FV9A 2V0LA 4Y7TA 3D5NA 5FTVA 4EEOA 3T7NA 2I5EA 2CU2A 4BQHA 2FY7A 2I7BA 1GA8A 1VZTA 3D98A 4HO2A 2VXLA 4KNRA 3NGWA 2VD4A 2VFZA 4ASJA 2QKXA 4JD0A 1HJJA 4Y63A 1VH1A 1FGGA 4KXOA 4D0ZA 1FZWA 2PGYA 2Y4LA 5CMIA 3U0XA 1H5TA 4YS8A 4Y7FA 1ZI1A 4FRPA 4ECMA 3CU0A 5L6VA 1ON8A 5AJOA 1HV9A 2P6WA 1FGXA 5FU0A 3POLA 1ZDFA 2XWNA 4DECA 4GBPA 2RIXA 5IDTA 3EE5A 5HS2A 2YQJA 4G3PA 4M28A 2ZU9A 1YP3A 3V0NA 3I0EA 4HO8A 1G1LA 3CKNA 3V8ZA 4EEGA 1OMXA 1H5SA 5AJNA 4MIXA 2APCA 1VGTA 1YROB 4B4MA 2JCOA 4HG6A 4CVHA 2YESA 1HM8A 1R7XA 2V0IA 3OKRA 4M4KA 5C3BA 4IRQA 4ARWA 5C3DA 2VSHA 1Z90A 1H7GA 3IOIA 2JCLA 1H3MA 2OI6A 3R2WA 3PNNA 2XWLA 2XMHA 4FRLA 1H5SD 5C3AA 5C8RA 1IINA 4FCEA 1HM0A 5C1LA 1HJLA 3OGZA 2ZU8A 3CKOA 1LL2A 2W0WA 4O6NA 1ZJ2A 3O3PA 4Y62A 4C2SA 3RMVA 5CQOA 2P73A 2XWMA 5AJPA 1QGQA 1ZCUA 3Q7UA 3JUKA 5CMHA 4DDZA 2FYCB 1IIMA 4HO4A 2WVMA 1WT2A 1H7HA 2VS3A 5BXCA 3V90A 3V91A 3DK5A 4NAKA 4FREA 3BCVA 3OH3A 4AYJA 3OH1A 1O23B 1PZYB 1K4VA 4FRAA 4HO9A 1LL3A 3V0QA 4Y6NA 1ZJ0A 1JV1A 4Y64A 4B2WA 1ZJPA 4KNXA 4UEGA 2RJ7A 1G0RA 1G9RA 1VPAA 5FUHA 2WEEA 1R7UA 3V8YA 3Q80A 4B2XA 2PX7A 2X60A 5D92A 4NALA 3F1CA 4P02A 1S4OA 1H5RA 4FRQA 3I0IX 2UX8A 1O7OA 2QGIA 5EIYA 3TQDA 1ZI4A 3FWWA 1G23A 4G3QA 1ZI3A 4NAIA 5C4EA 1FWYA 4L41C 2JCKA 1TZFA 5CQLX 4B3UA 2AECA 4FRHA 1INIA 3SXCA 2Y6PA 1VM8A 3DUVA 2WE9A 5CQNX 3D8VA 4D11A 3HL3A 3SXEA 5C4CA 1LZ7A 4R7PA 3TZTA 1ZJ3A 1VGUA 5D91A 2AM5A 2J0AA 3SX7A 2RIZA 1NQIB 3U2XA 4AC3A 2Z86A 1JYLA 1H7EA 2AM4A 2OEGA 4M2BA 4IRPA 5FTSA 5C1HA 5IFYA 1ZI5A 3ZLLA 2YC3A 1GWWA 4DE7A 2JCJA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1NF5 B;  4P00 A;  2Y4M A;  3SX8 A;  1JVG A;  3DJ4 A;  3K8D A;  1ZIZ A;  5C47 A;  3IOJ A;  3OH4 A;  1V84 A;  1INJ A;  2FYB A;  4E1K A;  4EE4 A;  1R7T A;  1G2V A;  1FO8 A;  3I0K A;  3SPT A;  1H5S C;  1ZJO A;  1R81 A;  5DDT A;  2RJ8 A;  2X5S A;  1OQM B;  1W55 A;  2AM3 A;  1FRW A;  3I0G A;  3RSB A;  3ZGG A;  4HCQ A;  1MP3 A;  2X5Z A;  1MP4 A;  1O7Q A;  1QWJ A;  2RJ6 A;  1ZCY A;  4HO5 A;  4MYB A;  2PGV A;  3ST8 A;  1VZX A;  3I0D A;  2RJ0 A;  1V83 A;  2YCM A;  5C4B A;  4JIS A;  2D7R A;  1GQC A;  3SXA A;  3N9W A;  3U0Y A;  1QG8 A;  4EE3 A;  5CQM X;  3KIA A;  3U2T A;  1TVY A;  4FQW A;  1H7L A;  1I52 A;  2P72 A;  1H4E A;  2BO4 A;  3FOQ A;  3V0L A;  1ZJ1 A;  3JTJ A;  4D0T A;  1VGZ A;  2OI5 A;  4KC1 A;  4FCU A;  2A8W A;  3U2U A;  2V0J A;  1ZHJ A;  2AGD A;  3SX5 A;  3LW6 A;  4KRV A;  3T7O A;  3USQ A;  1PZT A;  1QGS A;  4EEA A;  1SS9 A;  1G97 A;  1WT3 A;  1LZJ A;  4HO3 A;  1ON6 A;  4J18 A;  2O1H A;  1VH3 A;  2O1G A;  2I5K A;  2V0K A;  4K6R A;  5C1G A;  3V0P A;  1JV3 A;  3OH0 A;  2BO6 A;  1G3L A;  1MC3 A;  2QH5 A;  1H4D A;  3U2W A;  2RJ1 A;  3SXD A;  3E25 A;  4D48 A;  3OH2 A;  5EJZ A;  1H5T B;  1R7V A;  2BO7 A;  3SX3 A;  1H7Q A;  1WSZ A;  1FXO A;  1LVW A;  4B42 A;  2Y7A A;  5C38 A;  3RMW A;  1LZI A;  2AES A;  3USR A;  2OI7 A;  4BMA A;  1HM9 A;  2GGQ A;  2FYD B;  5C49 A;  1WT0 A;  5C48 A;  1XZ6 A;  3SXB A;  2AH9 A;  2YC5 A;  4FRB A;  2DPW A;  1EZI A;  4B4B A;  2NXV A;  2O1F A;  2Z87 A;  1H5S B;  3Q4S A;  3ZLK A;  1NWG B;  1V82 A;  1R82 A;  1S4P A;  2ICY A;  2YQH A;  5C36 A;  2Q4J A;  4B5B A;  1E5K A;  1GQ9 A;  2PA4 A;  2RJ9 A;  4G3S A;  3I0H A;  1H7T A;  4KQL A;  4B4G A;  1S4N A;  2Y4J A;  1GX4 A;  2VS5 A;  1G95 A;  5J49 A;  5JQQ A;  4D11 C;  2RJ5 A;  4CJC A;  2D7I A;  2ZU7 A;  1JYK A;  2VXM A;  2WVL A;  3IOH A;  1FR9 A;  2RJ4 A;  2WVK A;  1VZU A;  1YP2 A;  2RIY A;  2VSI A;  3I0L A;  3QVB A;  1XHB A;  4Y7U A;  4G87 A;  4Y7V A;  3JUJ A;  1WVC A;  2VS4 A;  4XWI A;  3ZGF A;  1VIC A;  2ICX A;  1LL0 A;  5C4D A;  1VGW A;  4KPX A;  4LW6 A;  4ASY A;  3T7M A;  3K8E A;  1G93 A;  2FFV A;  2D0J A;  3OC9 A;  3PKQ A;  2MZB A;  5EJ1 A;  3CKJ A;  1MP5 A;  4FRO A;  3PKP A;  1NKH B;  3E26 A;  4KPZ A;  2BO8 A;  4EVW A;  4FRD A;  2FFU A;  1H4C A;  1WT1 A;  2FYA A;  5CMF X;  4CJ8 A;  2GGO A;  5DDV A;  5FU8 A;  4LW3 A;  2A8U A;  4AYL A;  1GWV A;  5CQP A;  4FRM A;  1NHE B;  3GUE A;  1FG5 N;  3I0F A;  2X65 A;  1G8O A;  4Y9X A;  4EE5 A;  4Y6U A;  1TW5 A;  1W57 A;  3SXG A;  1R7Y A;  4KT7 A;  4ZDQ A;  1NMM B;  4KC2 A;  4CJB A;  2AE7 A;  1EYR A;  1OMZ A;  1W77 A;  1ZCT A;  5I1F A;  2V0H A;  3ZF8 A;  3CKQ A;  1KWS A;  4EEM A;  5L6S A;  3CKV A;  1TW1 A;  3F1Y A;  1ZDG A;  1H5R B;  2WAW A;  2Y4K A;  4AAW A;  1FR8 A;  4MND A;  4Y7G A;  1YP4 A;  1FO9 A;  1O0R A;  3V0O A;  4M2A A;  1FXJ A;  2WGZ A;  5CMJ A;  4HO6 A;  3V0M A;  1H7F A;  4HO0 A;  2YQS A;  1FOA A;  3OAM A;  3CGX A;  3U2V A;  3I0C A;  2OEF A;  1ZCV A;  1JVD A;  2E8B A;  5CMG X;  3R3I A;  4KC4 A;  3I0J A;  2W0V A;  2RIT A;  1GX0 A;  2E3D A;  5C4F A;  4HOC A;  4NAN A;  1LZ0 A;  2XME A;  2YQC A;  3BRK X;  5IDS A;  1R80 A;  5FYE A;  5FV9 A;  2V0L A;  4Y7T A;  3D5N A;  5FTV A;  4EEO A;  3T7N A;  2I5E A;  2CU2 A;  4BQH A;  2FY7 A;  2I7B A;  1GA8 A;  1VZT A;  3D98 A;  4HO2 A;  2VXL A;  4KNR A;  3NGW A;  2VD4 A;  2VFZ A;  4ASJ A;  2QKX A;  4JD0 A;  1HJJ A;  4Y63 A;  1VH1 A;  1FGG A;  4KXO A;  4D0Z A;  1FZW A;  2PGY A;  2Y4L A;  5CMI A;  3U0X A;  1H5T A;  4YS8 A;  4Y7F A;  1ZI1 A;  4FRP A;  4ECM A;  3CU0 A;  5L6V A;  1ON8 A;  5AJO A;  1HV9 A;  2P6W A;  1FGX A;  5FU0 A;  3POL A;  1ZDF A;  2XWN A;  4DEC A;  4GBP A;  2RIX A;  5IDT A;  3EE5 A;  5HS2 A;  2YQJ A;  4G3P A;  4M28 A;  2ZU9 A;  1YP3 A;  3V0N A;  3I0E A;  4HO8 A;  1G1L A;  3CKN A;  3V8Z A;  4EEG A;  1OMX A;  1H5S A;  5AJN A;  2APC A;  1VGT A;  1YRO B;  4B4M A;  2JCO A;  4HG6 A;  4CVH A;  2YES A;  1HM8 A;  1R7X A;  2V0I A;  3OKR A;  4M4K A;  5C3B A;  4IRQ A;  4ARW A;  5C3D A;  2VSH A;  1Z90 A;  1H7G A;  3IOI A;  2JCL A;  1H3M A;  2OI6 A;  3R2W A;  3PNN A;  2XWL A;  2XMH A;  4FRL A;  1H5S D;  5C3A A;  5C8R A;  1IIN A;  4FCE A;  1HM0 A;  5C1L A;  1HJL A;  3OGZ A;  2ZU8 A;  3CKO A;  1LL2 A;  2W0W A;  1ZJ2 A;  3O3P A;  4Y62 A;  4C2S A;  3RMV A;  5CQO A;  2P73 A;  2XWM A;  5AJP A;  1QGQ A;  1ZCU A;  3Q7U A;  3JUK A;  5CMH A;  4DDZ A;  2FYC B;  1IIM A;  4HO4 A;  2WVM A;  1WT2 A;  1H7H A;  2VS3 A;  5BXC A;  3V90 A;  3V91 A;  3DK5 A;  4NAK A;  4FRE A;  3BCV A;  3OH3 A;  4AYJ A;  3OH1 A;  1O23 B;  1PZY B;  1K4V A;  4FRA A;  4HO9 A;  1LL3 A;  3V0Q A;  4Y6N A;  1ZJ0 A;  1JV1 A;  4Y64 A;  4B2W A;  1ZJP A;  4KNX A;  4UEG A;  2RJ7 A;  1G0R A;  1G9R A;  1VPA A;  5FUH A;  2WEE A;  1R7U A;  3V8Y A;  3Q80 A;  4B2X A;  2PX7 A;  2X60 A;  4NAL A;  3F1C A;  4P02 A;  1S4O A;  1H5R A;  4FRQ A;  3I0I X;  2UX8 A;  1O7O A;  2QGI A;  5EIY A;  3TQD A;  1ZI4 A;  3FWW A;  1G23 A;  4G3Q A;  1ZI3 A;  4NAI A;  5C4E A;  1FWY A;  4L41 C;  2JCK A;  1TZF A;  5CQL X;  4B3U A;  2AEC A;  4FRH A;  1INI A;  3SXC A;  2Y6P A;  1VM8 A;  3DUV A;  2WE9 A;  5CQN X;  3D8V A;  4D11 A;  3HL3 A;  3SXE A;  5C4C A;  1LZ7 A;  4R7P A;  3TZT A;  1ZJ3 A;  1VGU A;  2AM5 A;  3SX7 A;  2RIZ A;  1NQI B;  3U2X A;  4AC3 A;  2Z86 A;  1JYL A;  1H7E A;  2AM4 A;  2OEG A;  4M2B A;  4IRP A;  5FTS A;  5C1H A;  5IFY A;  1ZI5 A;  3ZLL A;  2YC3 A;  1GWW A;  4DE7 A;  2JCJ A; 
#chains in the Genus database with same CATH topology
 1NF5 B;  4P00 A;  2Y4M A;  3SX8 A;  1JVG A;  3DJ4 A;  3K8D A;  1ZIZ A;  5C47 A;  3IOJ A;  3OH4 A;  1V84 A;  1INJ A;  2FYB A;  4E1K A;  4EE4 A;  1R7T A;  1G2V A;  1FO8 A;  3I0K A;  3SPT A;  1H5S C;  1ZJO A;  1R81 A;  5DDT A;  2RJ8 A;  2X5S A;  1OQM B;  1W55 A;  2AM3 A;  1FRW A;  3I0G A;  3RSB A;  3ZGG A;  4HCQ A;  1MP3 A;  2X5Z A;  1MP4 A;  1O7Q A;  1QWJ A;  2RJ6 A;  1ZCY A;  4HO5 A;  4MYB A;  2PGV A;  3ST8 A;  1VZX A;  3I0D A;  2RJ0 A;  1V83 A;  2YCM A;  5C4B A;  4JIS A;  2D7R A;  1GQC A;  3SXA A;  3N9W A;  3U0Y A;  1QG8 A;  4EE3 A;  5CQM X;  3KIA A;  3U2T A;  1TVY A;  4FQW A;  1H7L A;  1I52 A;  2VK9 A;  2P72 A;  2C0N A;  1H4E A;  2BO4 A;  3FOQ A;  3V0L A;  1ZJ1 A;  3JTJ A;  4O6M A;  4D0T A;  1VGZ A;  2OI5 A;  4KC1 A;  4Q7C A;  4FCU A;  2A8W A;  3U2U A;  2V0J A;  1ZHJ A;  2AGD A;  3SX5 A;  3LW6 A;  4KRV A;  3T7O A;  3USQ A;  1PZT A;  1QGS A;  4EEA A;  1SS9 A;  1G97 A;  1WT3 A;  1LZJ A;  4HO3 A;  1ON6 A;  4J18 A;  2O1H A;  2J0B A;  1VH3 A;  2O1G A;  2I5K A;  2V0K A;  4K6R A;  5C1G A;  3V0P A;  1JV3 A;  3OH0 A;  2BO6 A;  1G3L A;  1MC3 A;  2QH5 A;  1H4D A;  3U2W A;  2RJ1 A;  3SXD A;  3E25 A;  4D48 A;  3OH2 A;  5EJZ A;  1H5T B;  1R7V A;  2BO7 A;  3SX3 A;  1H7Q A;  1WSZ A;  1FXO A;  1LVW A;  4B42 A;  2Y7A A;  5C38 A;  3RMW A;  1LZI A;  2AES A;  3USR A;  2OI7 A;  4BMA A;  1HM9 A;  2GGQ A;  2FYD B;  5C49 A;  1WT0 A;  5C48 A;  1XZ6 A;  3SXB A;  2AH9 A;  2YC5 A;  4FRB A;  2DPW A;  1EZI A;  4FIX A;  4B4B A;  2NXV A;  2O1F A;  2Z87 A;  1H5S B;  3Q4S A;  3ZLK A;  1NWG B;  1V82 A;  1R82 A;  1S4P A;  2ICY A;  2YQH A;  5C36 A;  2Q4J A;  4B5B A;  1E5K A;  4FIY A;  1GQ9 A;  2PA4 A;  2RJ9 A;  4G3S A;  3I0H A;  1H7T A;  4KQL A;  4B4G A;  1S4N A;  2Y4J A;  1GX4 A;  2VS5 A;  1G95 A;  5J49 A;  5JQQ A;  4D11 C;  2RJ5 A;  4CJC A;  2D7I A;  2ZU7 A;  1JYK A;  2VXM A;  2WVL A;  3IOH A;  1FR9 A;  2RJ4 A;  2WVK A;  1VZU A;  1YP2 A;  2RIY A;  2VSI A;  3I0L A;  3QVB A;  1XHB A;  4Y7U A;  4G87 A;  4Y7V A;  3JUJ A;  1WVC A;  2VS4 A;  4XWI A;  3ZGF A;  1VIC A;  2ICX A;  1LL0 A;  5C4D A;  1VGW A;  4KPX A;  4LW6 A;  4ASY A;  3T7M A;  3K8E A;  1G93 A;  2FFV A;  2D0J A;  3OC9 A;  3PKQ A;  2MZB A;  5EJ1 A;  3CKJ A;  1MP5 A;  4FRO A;  3PKP A;  1NKH B;  3E26 A;  4KPZ A;  2BO8 A;  4EVW A;  4FRD A;  2FFU A;  1H4C A;  1WT1 A;  2FYA A;  5CMF X;  4CJ8 A;  2GGO A;  5DDV A;  5FU8 A;  4LW3 A;  2A8U A;  4AYL A;  1GWV A;  5CQP A;  4FRM A;  1NHE B;  3GUE A;  1FG5 N;  3I0F A;  2X65 A;  1G8O A;  4Y9X A;  4EE5 A;  4Y6U A;  1TW5 A;  1W57 A;  3SXG A;  1R7Y A;  4KT7 A;  4ZDQ A;  1NMM B;  4KC2 A;  4CJB A;  2AE7 A;  1EYR A;  1OMZ A;  1W77 A;  1ZCT A;  5I1F A;  2V0H A;  3ZF8 A;  3CKQ A;  1KWS A;  4EEM A;  5L6S A;  3CKV A;  1TW1 A;  3F1Y A;  1ZDG A;  1H5R B;  2WAW A;  2Y4K A;  4AAW A;  1FR8 A;  4MND A;  4Y7G A;  1YP4 A;  1FO9 A;  1O0R A;  3V0O A;  4M2A A;  1FXJ A;  2WGZ A;  5CMJ A;  4HO6 A;  3V0M A;  1H7F A;  4HO0 A;  2YQS A;  1FOA A;  3OAM A;  3CGX A;  3U2V A;  3I0C A;  2OEF A;  1ZCV A;  1JVD A;  2E8B A;  5CMG X;  3R3I A;  4KC4 A;  3I0J A;  2W0V A;  2RIT A;  1GX0 A;  2E3D A;  5C4F A;  4HOC A;  4NAN A;  1LZ0 A;  2XME A;  2YQC A;  3BRK X;  5IDS A;  1R80 A;  5FYE A;  5FV9 A;  2V0L A;  4Y7T A;  3D5N A;  5FTV A;  4EEO A;  3T7N A;  2I5E A;  2CU2 A;  4BQH A;  2FY7 A;  2I7B A;  1GA8 A;  1VZT A;  3D98 A;  4HO2 A;  2VXL A;  4KNR A;  3NGW A;  2VD4 A;  2VFZ A;  4ASJ A;  2QKX A;  4JD0 A;  1HJJ A;  4Y63 A;  1VH1 A;  1FGG A;  4KXO A;  4D0Z A;  1FZW A;  2PGY A;  2Y4L A;  5CMI A;  3U0X A;  1H5T A;  4YS8 A;  4Y7F A;  1ZI1 A;  4FRP A;  4ECM A;  3CU0 A;  5L6V A;  1ON8 A;  5AJO A;  1HV9 A;  2P6W A;  1FGX A;  5FU0 A;  3POL A;  1ZDF A;  2XWN A;  4DEC A;  4GBP A;  2RIX A;  5IDT A;  3EE5 A;  5HS2 A;  2YQJ A;  4G3P A;  4M28 A;  2ZU9 A;  1YP3 A;  3V0N A;  3I0E A;  4HO8 A;  1G1L A;  3CKN A;  3V8Z A;  4EEG A;  1OMX A;  1H5S A;  5AJN A;  4MIX A;  2APC A;  1VGT A;  1YRO B;  4B4M A;  2JCO A;  4HG6 A;  4CVH A;  2YES A;  1HM8 A;  1R7X A;  2V0I A;  3OKR A;  4M4K A;  5C3B A;  4IRQ A;  4ARW A;  5C3D A;  2VSH A;  1Z90 A;  1H7G A;  3IOI A;  2JCL A;  1H3M A;  2OI6 A;  3R2W A;  3PNN A;  2XWL A;  2XMH A;  4FRL A;  1H5S D;  5C3A A;  5C8R A;  1IIN A;  4FCE A;  1HM0 A;  5C1L A;  1HJL A;  3OGZ A;  2ZU8 A;  3CKO A;  1LL2 A;  2W0W A;  4O6N A;  1ZJ2 A;  3O3P A;  4Y62 A;  4C2S A;  3RMV A;  5CQO A;  2P73 A;  2XWM A;  5AJP A;  1QGQ A;  1ZCU A;  3Q7U A;  3JUK A;  5CMH A;  4DDZ A;  2FYC B;  1IIM A;  4HO4 A;  2WVM A;  1WT2 A;  1H7H A;  2VS3 A;  5BXC A;  3V90 A;  3V91 A;  3DK5 A;  4NAK A;  4FRE A;  3BCV A;  3OH3 A;  4AYJ A;  3OH1 A;  1O23 B;  1PZY B;  1K4V A;  4FRA A;  4HO9 A;  1LL3 A;  3V0Q A;  4Y6N A;  1ZJ0 A;  1JV1 A;  4Y64 A;  4B2W A;  1ZJP A;  4KNX A;  4UEG A;  2RJ7 A;  1G0R A;  1G9R A;  1VPA A;  5FUH A;  2WEE A;  1R7U A;  3V8Y A;  3Q80 A;  4B2X A;  2PX7 A;  2X60 A;  5D92 A;  4NAL A;  3F1C A;  4P02 A;  1S4O A;  1H5R A;  4FRQ A;  3I0I X;  2UX8 A;  1O7O A;  2QGI A;  5EIY A;  3TQD A;  1ZI4 A;  3FWW A;  1G23 A;  4G3Q A;  1ZI3 A;  4NAI A;  5C4E A;  1FWY A;  4L41 C;  2JCK A;  1TZF A;  5CQL X;  4B3U A;  2AEC A;  4FRH A;  1INI A;  3SXC A;  2Y6P A;  1VM8 A;  3DUV A;  2WE9 A;  5CQN X;  3D8V A;  4D11 A;  3HL3 A;  3SXE A;  5C4C A;  1LZ7 A;  4R7P A;  3TZT A;  1ZJ3 A;  1VGU A;  5D91 A;  2AM5 A;  2J0A A;  3SX7 A;  2RIZ A;  1NQI B;  3U2X A;  4AC3 A;  2Z86 A;  1JYL A;  1H7E A;  2AM4 A;  2OEG A;  4M2B A;  4IRP A;  5FTS A;  5C1H A;  5IFY A;  1ZI5 A;  3ZLL A;  2YC3 A;  1GWW A;  4DE7 A;  2JCJ A; 
#chains in the Genus database with same CATH homology
 1NF5 B;  4P00 A;  2Y4M A;  3SX8 A;  1JVG A;  3DJ4 A;  3K8D A;  1ZIZ A;  5C47 A;  3IOJ A;  3OH4 A;  1V84 A;  1INJ A;  2FYB A;  4E1K A;  4EE4 A;  1R7T A;  1G2V A;  1FO8 A;  3I0K A;  3SPT A;  1H5S C;  1ZJO A;  1R81 A;  5DDT A;  2RJ8 A;  2X5S A;  1OQM B;  1W55 A;  2AM3 A;  1FRW A;  3I0G A;  3RSB A;  3ZGG A;  4HCQ A;  1MP3 A;  2X5Z A;  1MP4 A;  1O7Q A;  1QWJ A;  2RJ6 A;  1ZCY A;  4HO5 A;  4MYB A;  2PGV A;  3ST8 A;  1VZX A;  3I0D A;  2RJ0 A;  1V83 A;  2YCM A;  5C4B A;  4JIS A;  2D7R A;  1GQC A;  3SXA A;  3N9W A;  3U0Y A;  1QG8 A;  4EE3 A;  5CQM X;  3KIA A;  3U2T A;  1TVY A;  4FQW A;  1H7L A;  1I52 A;  2VK9 A;  2P72 A;  2C0N A;  1H4E A;  2BO4 A;  3FOQ A;  3V0L A;  1ZJ1 A;  3JTJ A;  4O6M A;  4D0T A;  1VGZ A;  2OI5 A;  4KC1 A;  4Q7C A;  4FCU A;  2A8W A;  3U2U A;  2V0J A;  1ZHJ A;  2AGD A;  3SX5 A;  3LW6 A;  4KRV A;  3T7O A;  3USQ A;  1PZT A;  1QGS A;  4EEA A;  1SS9 A;  1G97 A;  1WT3 A;  1LZJ A;  4HO3 A;  1ON6 A;  4J18 A;  2O1H A;  2J0B A;  1VH3 A;  2O1G A;  2I5K A;  2V0K A;  4K6R A;  5C1G A;  3V0P A;  1JV3 A;  3OH0 A;  2BO6 A;  1G3L A;  1MC3 A;  2QH5 A;  1H4D A;  3U2W A;  2RJ1 A;  3SXD A;  3E25 A;  4D48 A;  3OH2 A;  5EJZ A;  1H5T B;  1R7V A;  2BO7 A;  3SX3 A;  1H7Q A;  1WSZ A;  1FXO A;  1LVW A;  4B42 A;  2Y7A A;  5C38 A;  3RMW A;  1LZI A;  2AES A;  3USR A;  2OI7 A;  4BMA A;  1HM9 A;  2GGQ A;  2FYD B;  5C49 A;  1WT0 A;  5C48 A;  1XZ6 A;  3SXB A;  2AH9 A;  2YC5 A;  4FRB A;  2DPW A;  1EZI A;  4FIX A;  4B4B A;  2NXV A;  2O1F A;  2Z87 A;  1H5S B;  3Q4S A;  3ZLK A;  1NWG B;  1V82 A;  1R82 A;  1S4P A;  2ICY A;  2YQH A;  5C36 A;  2Q4J A;  4B5B A;  1E5K A;  4FIY A;  1GQ9 A;  2PA4 A;  2RJ9 A;  4G3S A;  3I0H A;  1H7T A;  4KQL A;  4B4G A;  1S4N A;  2Y4J A;  1GX4 A;  2VS5 A;  1G95 A;  5J49 A;  5JQQ A;  4D11 C;  2RJ5 A;  4CJC A;  2D7I A;  2ZU7 A;  1JYK A;  2VXM A;  2WVL A;  3IOH A;  1FR9 A;  2RJ4 A;  2WVK A;  1VZU A;  1YP2 A;  2RIY A;  2VSI A;  3I0L A;  3QVB A;  1XHB A;  4Y7U A;  4G87 A;  4Y7V A;  3JUJ A;  1WVC A;  2VS4 A;  4XWI A;  3ZGF A;  1VIC A;  2ICX A;  1LL0 A;  5C4D A;  1VGW A;  4KPX A;  4LW6 A;  4ASY A;  3T7M A;  3K8E A;  1G93 A;  2FFV A;  2D0J A;  3OC9 A;  3PKQ A;  2MZB A;  5EJ1 A;  3CKJ A;  1MP5 A;  4FRO A;  3PKP A;  1NKH B;  3E26 A;  4KPZ A;  2BO8 A;  4EVW A;  4FRD A;  2FFU A;  1H4C A;  1WT1 A;  2FYA A;  5CMF X;  4CJ8 A;  2GGO A;  5DDV A;  5FU8 A;  4LW3 A;  2A8U A;  4AYL A;  1GWV A;  5CQP A;  4FRM A;  1NHE B;  3GUE A;  1FG5 N;  3I0F A;  2X65 A;  1G8O A;  4Y9X A;  4EE5 A;  4Y6U A;  1TW5 A;  1W57 A;  3SXG A;  1R7Y A;  4KT7 A;  4ZDQ A;  1NMM B;  4KC2 A;  4CJB A;  2AE7 A;  1EYR A;  1OMZ A;  1W77 A;  1ZCT A;  5I1F A;  2V0H A;  3ZF8 A;  3CKQ A;  1KWS A;  4EEM A;  5L6S A;  3CKV A;  1TW1 A;  3F1Y A;  1ZDG A;  1H5R B;  2WAW A;  2Y4K A;  4AAW A;  1FR8 A;  4MND A;  4Y7G A;  1YP4 A;  1FO9 A;  1O0R A;  3V0O A;  4M2A A;  1FXJ A;  2WGZ A;  5CMJ A;  4HO6 A;  3V0M A;  1H7F A;  4HO0 A;  2YQS A;  1FOA A;  3OAM A;  3CGX A;  3U2V A;  3I0C A;  2OEF A;  1ZCV A;  1JVD A;  2E8B A;  5CMG X;  3R3I A;  4KC4 A;  3I0J A;  2W0V A;  2RIT A;  1GX0 A;  2E3D A;  5C4F A;  4HOC A;  4NAN A;  1LZ0 A;  2XME A;  2YQC A;  3BRK X;  5IDS A;  1R80 A;  5FYE A;  5FV9 A;  2V0L A;  4Y7T A;  3D5N A;  5FTV A;  4EEO A;  3T7N A;  2I5E A;  2CU2 A;  4BQH A;  2FY7 A;  2I7B A;  1GA8 A;  1VZT A;  3D98 A;  4HO2 A;  2VXL A;  4KNR A;  3NGW A;  2VD4 A;  2VFZ A;  4ASJ A;  2QKX A;  4JD0 A;  1HJJ A;  4Y63 A;  1VH1 A;  1FGG A;  4KXO A;  4D0Z A;  1FZW A;  2PGY A;  2Y4L A;  5CMI A;  3U0X A;  1H5T A;  4YS8 A;  4Y7F A;  1ZI1 A;  4FRP A;  4ECM A;  3CU0 A;  5L6V A;  1ON8 A;  5AJO A;  1HV9 A;  2P6W A;  1FGX A;  5FU0 A;  3POL A;  1ZDF A;  2XWN A;  4DEC A;  4GBP A;  2RIX A;  5IDT A;  3EE5 A;  5HS2 A;  2YQJ A;  4G3P A;  4M28 A;  2ZU9 A;  1YP3 A;  3V0N A;  3I0E A;  4HO8 A;  1G1L A;  3CKN A;  3V8Z A;  4EEG A;  1OMX A;  1H5S A;  5AJN A;  4MIX A;  2APC A;  1VGT A;  1YRO B;  4B4M A;  2JCO A;  4HG6 A;  4CVH A;  2YES A;  1HM8 A;  1R7X A;  2V0I A;  3OKR A;  4M4K A;  5C3B A;  4IRQ A;  4ARW A;  5C3D A;  2VSH A;  1Z90 A;  1H7G A;  3IOI A;  2JCL A;  1H3M A;  2OI6 A;  3R2W A;  3PNN A;  2XWL A;  2XMH A;  4FRL A;  1H5S D;  5C3A A;  5C8R A;  1IIN A;  4FCE A;  1HM0 A;  5C1L A;  1HJL A;  3OGZ A;  2ZU8 A;  3CKO A;  1LL2 A;  2W0W A;  4O6N A;  1ZJ2 A;  3O3P A;  4Y62 A;  4C2S A;  3RMV A;  5CQO A;  2P73 A;  2XWM A;  5AJP A;  1QGQ A;  1ZCU A;  3Q7U A;  3JUK A;  5CMH A;  4DDZ A;  2FYC B;  1IIM A;  4HO4 A;  2WVM A;  1WT2 A;  1H7H A;  2VS3 A;  5BXC A;  3V90 A;  3V91 A;  3DK5 A;  4NAK A;  4FRE A;  3BCV A;  3OH3 A;  4AYJ A;  3OH1 A;  1O23 B;  1PZY B;  1K4V A;  4FRA A;  4HO9 A;  1LL3 A;  3V0Q A;  4Y6N A;  1ZJ0 A;  1JV1 A;  4Y64 A;  4B2W A;  1ZJP A;  4KNX A;  4UEG A;  2RJ7 A;  1G0R A;  1G9R A;  1VPA A;  5FUH A;  2WEE A;  1R7U A;  3V8Y A;  3Q80 A;  4B2X A;  2PX7 A;  2X60 A;  5D92 A;  4NAL A;  3F1C A;  4P02 A;  1S4O A;  1H5R A;  4FRQ A;  3I0I X;  2UX8 A;  1O7O A;  2QGI A;  5EIY A;  3TQD A;  1ZI4 A;  3FWW A;  1G23 A;  4G3Q A;  1ZI3 A;  4NAI A;  5C4E A;  1FWY A;  4L41 C;  2JCK A;  1TZF A;  5CQL X;  4B3U A;  2AEC A;  4FRH A;  1INI A;  3SXC A;  2Y6P A;  1VM8 A;  3DUV A;  2WE9 A;  5CQN X;  3D8V A;  4D11 A;  3HL3 A;  3SXE A;  5C4C A;  1LZ7 A;  4R7P A;  3TZT A;  1ZJ3 A;  1VGU A;  5D91 A;  2AM5 A;  2J0A A;  3SX7 A;  2RIZ A;  1NQI B;  3U2X A;  4AC3 A;  2Z86 A;  1JYL A;  1H7E A;  2AM4 A;  2OEG A;  4M2B A;  4IRP A;  5FTS A;  5C1H A;  5IFY A;  1ZI5 A;  3ZLL A;  2YC3 A;  1GWW A;  4DE7 A;  2JCJ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...