1ZDFA

Ser162 mutant of glycogenin complexed with udp-glucose and manganese
Total Genus 83
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
83
sequence length
264
structure length
258
Chain Sequence
MTDQAFVTLTTNDAYAKGALVLGSSLKQHRTSRRLAVLTTPQVSDTMRKALEIVFDEVITVDILDSGDSAHLTLMKRPELGVTLTKLHCWSLTQYSKCVFMDADTLVLANIDDLFEREELSAAPDPGWPDCFNSGVFVYQPSVETYNQLLHVASEQGSFDGGSQGLLNTFFNSWATTDIRKHLPFIYNLSSISIYSYLPAFKAFGANAKVVHFLGQTKPWNYTYDTKTKSVRSMTHPQFLNVWWDIFTTSVVPLLQQF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords Glycogenin-1
publication title Requirements for catalysis in mammalian glycogenin.
pubmed doi rcsb
source organism Oryctolagus cuniculus
total genus 83
structure length 258
sequence length 264
ec nomenclature ec 2.4.1.186: Glycogenin glucosyltransferase.
pdb deposition date 2005-04-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01501 Glyco_transf_8 Glycosyl transferase family 8
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.550.10 Alpha Beta Alpha-Beta Complex Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A 1zdfA00
2YQJA 3U0XA 4B2WA 3NGWA 1O0RA 3V91A 4HO6A 4FRDA 4KNXA 1H7LA 1MP3A 1QGQA 5C1GA 1H5SB 1INIA 1TZFA 4HO9A 3I0LA 2VS4A 4Y6NA 1H5SA 1H7EA 1G23A 1GWWA 1LZ0A 1R7TA 4KQLA 4AC3A 2V0HA 3SXEA 4XWIA 1R7VA 4NAIA 3CGXA 1H4CA 5I1FA 2X60A 4KNRA 1WSZA 1ZIZA 3O3PA 3V0OA 1OMXA 2ZU9A 3EE5A 2Q4JA 4L41C 5FV9A 1HM8A 3OKRA 4B5BA 3PNNA 1O23B 3T7NA 5DDTA 4HO3A 1GQ9A 1G2VA 1FOAA 1V82A 5BXCA 1R7UA 1R7XA 3I0FA 1R82A 3V8ZA 3D98A 4MYBA 4G87A 2Y6PA 1H5SD 2A8UA 2VS3A 2PGYA 1VGUA 5FUHA 1S4OA 4ASJA 5L6SA 2I5KA 2BO7A 2X5SA 2FYDB 4B42A 1KWSA 3V0QA 2ZU8A 5C8RA 1HM0A 2CU2A 3D5NA 5C3AA 4FRMA 1HJLA 4B2XA 5HS2A 2W0WA 4Y7VA 2Y4MA 4D11A 5C49A 1ON6A 2FFVA 5C1HA 5CQNX 5EIYA 2Z87A 2MZBA 2FYAA 4EEOA 1WT0A 1GX0A 3RSBA 4EEAA 4EE3A 5AJOA 4DDZA 1YROB 2VFZA 2O1HA 2BO8A 5CQPA 1GQCA 2ICYA 3RMWA 5J49A 5C48A 2FFUA 4IRQA 4Y7TA 3POLA 4Y62A 2AM5A 1VZXA 3U2XA 2AESA 2A8WA 5EJZA 1IIMA 4HG6A 3V90A 1H7QA 4EEGA 3DUVA 1VPAA 1FXJA 4HO0A 4BQHA 1H5TB 1FR8A 2WEEA 4HO5A 4FCEA 1H5TA 3N9WA 5CQMX 1ZI5A 1FWYA 1ZDFA 3IOJA 3PKPA 4FROA 3SPTA 2JCJA 2RJ1A 4NANA 3ZGFA 2P73A 2D0JA 5CMFX 3F1YA 1TW1A 2X5ZA 4AAWA 2PGVA 5C4DA 2VS5A 2ICXA 2VSHA 4G3QA 4M4KA 5DDVA 4FRPA 4FRLA 1WT3A 1OMZA 1FG5N 1ZCUA 3R3IA 5C1LA 1V83A 1H5SC 3GUEA 1FXOA 2QKXA 3ZF8A 4EEMA 3OC9A 1QG8A 3U2VA 1JV1A 1VZTA 4HO8A 3BCVA 3SXBA 3JUJA 1LL2A 1S4PA 1IINA 3CKNA 3SXAA 1ZJ0A 1VH1A 2AM3A 2RJ8A 4MNDA 5FTVA 3SX7A 2GGOA 3HL3A 4JD0A 2P6WA 4EE4A 5C4BA 4CJBA 5IFYA 1NMMB 4CJ8A 2V0JA 4HO2A 2QGIA 2E3DA 5C3DA 1H4EA 1R80A 1R7YA 1H7FA 1PZTA 3K8EA 4M2BA 5C47A 3U0YA 5C3BA 1VH3A 3SX3A 3V0PA 2XWLA 1SS9A 3T7OA 4B4BA 4ZDQA 2YQCA 2RJ0A 1VZUA 4DE7A 2P72A 4C2SA 3SX8A 1WT2A 4D48A 1FGGA 3JTJA 4AYLA 2AM4A 4Y7UA 5FU0A 4ARWA 5C4FA 2WAWA 3I0DA 4B3UA 1JVDA 3USQA 1R81A 1FR9A 1QWJA 3E25A 3I0JA 1G3LA 2RIZA 1ZI4A 3LW6A 2Z86A 2AE7A 4P02A 1V84A 1VICA 1MC3A 3OH0A 1GWVA 3Q7UA 2Y4LA 1G8OA 1G93A 1H7TA 4FRBA 4Y64A 4CJCA 3KIAA 1H3MA 1WT1A 3D8VA 2BO4A 1VGTA 5AJNA 1HV9A 1G1LA 4E1KA 1H7HA 2RJ7A 3F1CA 2DPWA 2V0IA 2JCOA 4HOCA 1MP5A 1H7GA 5IDSA 1LZJA 2Y4JA 1W77A 2E8BA 4LW6A 1TVYA 2YQSA 1QGSA 1GX4A 3JUKA 3Q4SA 4J18A 1ZJ1A 1FO9A 2NXVA 2V0LA 2I5EA 3V0NA 4GBPA 4UEGA 1JYLA 1YP3A 3OGZA 2OI7A 4FQWA 3TQDA 3Q80A 2OEGA 4R7PA 3V8YA 3SX5A 2ZU7A 3CKOA 2RIXA 4KC2A 4FCUA 2D7IA 3QVBA 4G3SA 3CU0A 4AYJA 2AGDA 4FRQA 2YESA 4Y6UA 1G0RA 1H4DA 4Y7FA 1W55A 1ZJ2A 3I0HA 3OH1A 3R2WA 1Z90A 3TZTA 3BRKX 2WE9A 5JQQA 1ON8A 4KC1A 3USRA 2OEFA 5C36A 2I7BA 3ST8A 2WVMA 4ECMA 1HJJA 2AECA 2RJ5A 2XMEA 3V0MA 4B4MA 5FYEA 2RITA 1G9RA 2YC5A 1NF5B 2VSIA 1I52A 2VXMA 2XWMA 4D0TA 4EVWA 3OH2A 2WGZA 5IDTA 5CQOA 3U2UA 4HCQA 1PZYB 2YQHA 2VD4A 2XMHA 4Y9XA 1XHBA 1INJA 4P00A 3I0EA 2UX8A 3CKVA 5FTSA 1JV3A 4Y7GA 3SXDA 5EJ1A 3SXCA 1ZI1A 4B4GA 3OAMA 1OQMB 2BO6A 1JVGA 1ZJ3A 3RMVA 3U2TA 4ASYA 5L6VA 1ZCTA 1W57A 5CMHA 1H5RB 2O1FA 3V0LA 1ZJOA 1H5RA 2FY7A 5FU8A 1LVWA 4KXOA 1LZIA 2XWNA 1WVCA 4KRVA 3U2WA 2WVKA 1NHEB 4KT7A 3PKQA 2QH5A 1NKHB 4IRPA 2RJ4A 4EE5A 1FO8A 1ZCVA 4YS8A 4Y63A 5CMIA 2RIYA 1EYRA 3I0IX 2Y7AA 2RJ6A 1VGZA 1LL0A 3DK5A 4LW3A 2V0KA 1YP4A 4D11C 4M28A 2GGQA 2FYBA 2APCA 4FRHA 2YCMA 1S4NA 4HO4A 1TW5A 3ZLKA 1K4VA 1G97A 2PA4A 3ZGGA 3I0GA 1O7OA 4KPZA 2OI5A 1GA8A 2AH9A 1VM8A 1MP4A 3SXGA 2OI6A 4G3PA 1VGWA 3I0KA 3DJ4A 5C4EA 4D0ZA 5AJPA 1FGXA 3IOHA 1ZDGA 1G95A 3CKJA 3CKQA 1NWGB 2VXLA 1ZCYA 2W0VA 3K8DA 2PX7A 4K6RA 4JISA 5CMJA 2Y4KA 5CQLX 3OH4A 2WVLA 4NAKA 4NALA 5C38A 2X65A 1JYKA 4KPXA 5CMGX 1ZJPA 2O1GA 4BMAA 3IOIA 3FWWA 3OH3A 1XZ6A 4FRAA 1E5KA 2FYCB 1ZI3A 2YC3A 1FZWA 2JCKA 1O7QA 4KC4A 3E26A 2JCLA 5C4CA 3ZLLA 4FREA 1FRWA 4DECA 3FOQA 1ZHJA 2D7RA 4CVHA 1YP2A 2RJ9A 4M2AA 1HM9A 3T7MA 1EZIA 1LL3A 3I0CA 1NQIB 1LZ7A
chains in the Genus database with same CATH superfamily
2YQJA 3U0XA 4B2WA 3NGWA 1O0RA 3V91A 4HO6A 4FRDA 4KNXA 1H7LA 1MP3A 1QGQA 5C1GA 1H5SB 1INIA 1TZFA 4HO9A 3I0LA 2VS4A 4Y6NA 1H5SA 1H7EA 1G23A 1GWWA 1LZ0A 1R7TA 4KQLA 4AC3A 2V0HA 3SXEA 4XWIA 1R7VA 4NAIA 3CGXA 2VK9A 1H4CA 5I1FA 2X60A 4KNRA 1WSZA 1ZIZA 3O3PA 3V0OA 1OMXA 2ZU9A 3EE5A 2Q4JA 4L41C 5FV9A 1HM8A 3OKRA 4B5BA 3PNNA 1O23B 3T7NA 5DDTA 4HO3A 1GQ9A 1G2VA 1FOAA 1V82A 5BXCA 1R7UA 1R7XA 3I0FA 1R82A 3V8ZA 3D98A 4MYBA 4G87A 2Y6PA 1H5SD 2A8UA 2VS3A 2PGYA 1VGUA 5FUHA 1S4OA 4ASJA 5L6SA 2I5KA 2BO7A 2X5SA 2FYDB 4B42A 1KWSA 3V0QA 2ZU8A 5C8RA 1HM0A 2CU2A 3D5NA 5C3AA 4FRMA 1HJLA 4FIXA 4B2XA 5HS2A 2W0WA 4Y7VA 2Y4MA 4D11A 5C49A 1ON6A 2FFVA 5C1HA 5CQNX 5EIYA 2Z87A 2MZBA 2FYAA 4EEOA 1WT0A 1GX0A 3RSBA 4EEAA 4EE3A 2C0NA 5AJOA 4DDZA 1YROB 2VFZA 2O1HA 2BO8A 5CQPA 4FIYA 1GQCA 2ICYA 3RMWA 5J49A 5C48A 2FFUA 2J0AA 4IRQA 4Y7TA 3POLA 4Y62A 2AM5A 1VZXA 3U2XA 2AESA 2A8WA 5EJZA 1IIMA 4HG6A 3V90A 1H7QA 4EEGA 3DUVA 1VPAA 1FXJA 4HO0A 4BQHA 1H5TB 1FR8A 2WEEA 4HO5A 4FCEA 4MIXA 1H5TA 3N9WA 5CQMX 1ZI5A 1FWYA 1ZDFA 3IOJA 3PKPA 4FROA 3SPTA 4O6NA 2JCJA 2RJ1A 4NANA 3ZGFA 2P73A 2D0JA 5CMFX 3F1YA 1TW1A 2X5ZA 4AAWA 2PGVA 5C4DA 2VS5A 2ICXA 2VSHA 4G3QA 4M4KA 5DDVA 4FRPA 4FRLA 1WT3A 1OMZA 1FG5N 1ZCUA 3R3IA 5C1LA 1V83A 1H5SC 3GUEA 1FXOA 2QKXA 3ZF8A 4EEMA 3OC9A 1QG8A 3U2VA 1JV1A 1VZTA 4HO8A 5D92A 3BCVA 3SXBA 3JUJA 1LL2A 1S4PA 1IINA 3CKNA 3SXAA 1ZJ0A 1VH1A 2AM3A 2RJ8A 4MNDA 5FTVA 3SX7A 2GGOA 3HL3A 4JD0A 2P6WA 4EE4A 5C4BA 4CJBA 5IFYA 2J0BA 1NMMB 4CJ8A 2V0JA 4HO2A 2QGIA 2E3DA 5C3DA 1H4EA 1R80A 1R7YA 1H7FA 1PZTA 3K8EA 4M2BA 5C47A 3U0YA 5C3BA 1VH3A 3SX3A 3V0PA 2XWLA 1SS9A 3T7OA 4B4BA 4ZDQA 2YQCA 2RJ0A 1VZUA 4DE7A 2P72A 4C2SA 3SX8A 1WT2A 4D48A 1FGGA 3JTJA 4AYLA 2AM4A 4Y7UA 5FU0A 4ARWA 5C4FA 2WAWA 3I0DA 4B3UA 1JVDA 3USQA 1R81A 1FR9A 1QWJA 3E25A 3I0JA 1G3LA 2RIZA 1ZI4A 3LW6A 2Z86A 2AE7A 4P02A 1V84A 1VICA 1MC3A 3OH0A 1GWVA 3Q7UA 2Y4LA 1G8OA 1G93A 1H7TA 4FRBA 4Y64A 4CJCA 3KIAA 1H3MA 1WT1A 3D8VA 2BO4A 1VGTA 5AJNA 1HV9A 1G1LA 4E1KA 1H7HA 2RJ7A 3F1CA 2DPWA 2V0IA 2JCOA 4HOCA 1MP5A 1H7GA 5IDSA 1LZJA 2Y4JA 1W77A 2E8BA 4LW6A 1TVYA 2YQSA 1QGSA 1GX4A 3JUKA 3Q4SA 4O6MA 4J18A 1ZJ1A 1FO9A 2NXVA 2V0LA 2I5EA 3V0NA 4GBPA 4UEGA 1JYLA 1YP3A 3OGZA 2OI7A 4FQWA 3TQDA 3Q80A 2OEGA 4R7PA 3V8YA 3SX5A 2ZU7A 3CKOA 2RIXA 4KC2A 4FCUA 2D7IA 3QVBA 4G3SA 3CU0A 4AYJA 2AGDA 4FRQA 2YESA 4Y6UA 1G0RA 1H4DA 4Y7FA 1W55A 1ZJ2A 3I0HA 3OH1A 3R2WA 1Z90A 3TZTA 3BRKX 2WE9A 5JQQA 1ON8A 4KC1A 3USRA 5D91A 2OEFA 5C36A 2I7BA 3ST8A 2WVMA 4ECMA 1HJJA 2AECA 2RJ5A 2XMEA 3V0MA 4B4MA 5FYEA 2RITA 1G9RA 2YC5A 1NF5B 2VSIA 1I52A 2VXMA 2XWMA 4D0TA 4EVWA 3OH2A 2WGZA 5IDTA 5CQOA 3U2UA 4HCQA 1PZYB 2YQHA 2VD4A 2XMHA 4Y9XA 1XHBA 1INJA 4P00A 3I0EA 2UX8A 3CKVA 5FTSA 1JV3A 4Y7GA 3SXDA 5EJ1A 3SXCA 1ZI1A 4B4GA 3OAMA 1OQMB 2BO6A 1JVGA 1ZJ3A 3RMVA 3U2TA 4ASYA 5L6VA 1ZCTA 1W57A 5CMHA 1H5RB 2O1FA 3V0LA 1ZJOA 1H5RA 4Q7CA 2FY7A 5FU8A 1LVWA 4KXOA 1LZIA 2XWNA 1WVCA 4KRVA 3U2WA 2WVKA 1NHEB 4KT7A 3PKQA 2QH5A 1NKHB 4IRPA 2RJ4A 4EE5A 1FO8A 1ZCVA 4YS8A 4Y63A 5CMIA 2RIYA 1EYRA 3I0IX 2Y7AA 2RJ6A 1VGZA 1LL0A 3DK5A 4LW3A 2V0KA 1YP4A 4D11C 4M28A 2GGQA 2FYBA 2APCA 4FRHA 2YCMA 1S4NA 4HO4A 1TW5A 3ZLKA 1K4VA 1G97A 2PA4A 3ZGGA 3I0GA 1O7OA 4KPZA 2OI5A 1GA8A 2AH9A 1VM8A 1MP4A 3SXGA 2OI6A 4G3PA 1VGWA 3I0KA 3DJ4A 5C4EA 4D0ZA 5AJPA 1FGXA 3IOHA 1ZDGA 1G95A 3CKJA 3CKQA 1NWGB 2VXLA 1ZCYA 2W0VA 3K8DA 2PX7A 4K6RA 4JISA 5CMJA 2Y4KA 5CQLX 3OH4A 2WVLA 4NAKA 4NALA 5C38A 2X65A 1JYKA 4KPXA 5CMGX 1ZJPA 2O1GA 4BMAA 3IOIA 3FWWA 3OH3A 1XZ6A 4FRAA 1E5KA 2FYCB 1ZI3A 2YC3A 1FZWA 2JCKA 1O7QA 4KC4A 3E26A 2JCLA 5C4CA 3ZLLA 4FREA 1FRWA 4DECA 3FOQA 1ZHJA 2D7RA 4CVHA 1YP2A 2RJ9A 4M2AA 1HM9A 3T7MA 1EZIA 1LL3A 3I0CA 1NQIB 1LZ7A
chains in the Genus database with same CATH topology
2YQJA 3U0XA 4B2WA 3NGWA 1O0RA 3V91A 4HO6A 4FRDA 4KNXA 1H7LA 1MP3A 1QGQA 5C1GA 1H5SB 1INIA 1TZFA 4HO9A 3I0LA 2VS4A 4Y6NA 1H5SA 1H7EA 1G23A 1GWWA 1LZ0A 1R7TA 4KQLA 4AC3A 2V0HA 3SXEA 4XWIA 1R7VA 4NAIA 3CGXA 2VK9A 1H4CA 5I1FA 2X60A 4KNRA 1WSZA 1ZIZA 3O3PA 3V0OA 1OMXA 2ZU9A 3EE5A 2Q4JA 4L41C 5FV9A 1HM8A 3OKRA 4B5BA 3PNNA 1O23B 3T7NA 5DDTA 4HO3A 1GQ9A 1G2VA 1FOAA 1V82A 5BXCA 1R7UA 1R7XA 3I0FA 1R82A 3V8ZA 3D98A 4MYBA 4G87A 2Y6PA 1H5SD 2A8UA 2VS3A 2PGYA 1VGUA 5FUHA 1S4OA 4ASJA 5L6SA 2I5KA 2BO7A 2X5SA 2FYDB 4B42A 1KWSA 3V0QA 2ZU8A 5C8RA 1HM0A 2CU2A 3D5NA 5C3AA 4FRMA 1HJLA 4FIXA 4B2XA 5HS2A 2W0WA 4Y7VA 2Y4MA 4D11A 5C49A 1ON6A 2FFVA 5C1HA 5CQNX 5EIYA 2Z87A 2MZBA 2FYAA 4EEOA 1WT0A 1GX0A 3RSBA 4EEAA 4EE3A 2C0NA 5AJOA 4DDZA 1YROB 2VFZA 2O1HA 2BO8A 5CQPA 4FIYA 1GQCA 2ICYA 3RMWA 5J49A 5C48A 2FFUA 2J0AA 4IRQA 4Y7TA 3POLA 4Y62A 2AM5A 1VZXA 3U2XA 2AESA 2A8WA 5EJZA 1IIMA 4HG6A 3V90A 1H7QA 4EEGA 3DUVA 1VPAA 1FXJA 4HO0A 4BQHA 1H5TB 1FR8A 2WEEA 4HO5A 4FCEA 4MIXA 1H5TA 3N9WA 5CQMX 1ZI5A 1FWYA 1ZDFA 3IOJA 3PKPA 4FROA 3SPTA 4O6NA 2JCJA 2RJ1A 4NANA 3ZGFA 2P73A 2D0JA 5CMFX 3F1YA 1TW1A 2X5ZA 4AAWA 2PGVA 5C4DA 2VS5A 2ICXA 2VSHA 4G3QA 4M4KA 5DDVA 4FRPA 4FRLA 1WT3A 1OMZA 1FG5N 1ZCUA 3R3IA 5C1LA 1V83A 1H5SC 3GUEA 1FXOA 2QKXA 3ZF8A 4EEMA 3OC9A 1QG8A 3U2VA 1JV1A 1VZTA 4HO8A 5D92A 3BCVA 3SXBA 3JUJA 1LL2A 1S4PA 1IINA 3CKNA 3SXAA 1ZJ0A 1VH1A 2AM3A 2RJ8A 4MNDA 5FTVA 3SX7A 2GGOA 3HL3A 4JD0A 2P6WA 4EE4A 5C4BA 4CJBA 5IFYA 2J0BA 1NMMB 4CJ8A 2V0JA 4HO2A 2QGIA 2E3DA 5C3DA 1H4EA 1R80A 1R7YA 1H7FA 1PZTA 3K8EA 4M2BA 5C47A 3U0YA 5C3BA 1VH3A 3SX3A 3V0PA 2XWLA 1SS9A 3T7OA 4B4BA 4ZDQA 2YQCA 2RJ0A 1VZUA 4DE7A 2P72A 4C2SA 3SX8A 1WT2A 4D48A 1FGGA 3JTJA 4AYLA 2AM4A 4Y7UA 5FU0A 4ARWA 5C4FA 2WAWA 3I0DA 4B3UA 1JVDA 3USQA 1R81A 1FR9A 1QWJA 3E25A 3I0JA 1G3LA 2RIZA 1ZI4A 3LW6A 2Z86A 2AE7A 4P02A 1V84A 1VICA 1MC3A 3OH0A 1GWVA 3Q7UA 2Y4LA 1G8OA 1G93A 1H7TA 4FRBA 4Y64A 4CJCA 3KIAA 1H3MA 1WT1A 3D8VA 2BO4A 1VGTA 5AJNA 1HV9A 1G1LA 4E1KA 1H7HA 2RJ7A 3F1CA 2DPWA 2V0IA 2JCOA 4HOCA 1MP5A 1H7GA 5IDSA 1LZJA 2Y4JA 1W77A 2E8BA 4LW6A 1TVYA 2YQSA 1QGSA 1GX4A 3JUKA 3Q4SA 4O6MA 4J18A 1ZJ1A 1FO9A 2NXVA 2V0LA 2I5EA 3V0NA 4GBPA 4UEGA 1JYLA 1YP3A 3OGZA 2OI7A 4FQWA 3TQDA 3Q80A 2OEGA 4R7PA 3V8YA 3SX5A 2ZU7A 3CKOA 2RIXA 4KC2A 4FCUA 2D7IA 3QVBA 4G3SA 3CU0A 4AYJA 2AGDA 4FRQA 2YESA 4Y6UA 1G0RA 1H4DA 4Y7FA 1W55A 1ZJ2A 3I0HA 3OH1A 3R2WA 1Z90A 3TZTA 3BRKX 2WE9A 5JQQA 1ON8A 4KC1A 3USRA 5D91A 2OEFA 5C36A 2I7BA 3ST8A 2WVMA 4ECMA 1HJJA 2AECA 2RJ5A 2XMEA 3V0MA 4B4MA 5FYEA 2RITA 1G9RA 2YC5A 1NF5B 2VSIA 1I52A 2VXMA 2XWMA 4D0TA 4EVWA 3OH2A 2WGZA 5IDTA 5CQOA 3U2UA 4HCQA 1PZYB 2YQHA 2VD4A 2XMHA 4Y9XA 1XHBA 1INJA 4P00A 3I0EA 2UX8A 3CKVA 5FTSA 1JV3A 4Y7GA 3SXDA 5EJ1A 3SXCA 1ZI1A 4B4GA 3OAMA 1OQMB 2BO6A 1JVGA 1ZJ3A 3RMVA 3U2TA 4ASYA 5L6VA 1ZCTA 1W57A 5CMHA 1H5RB 2O1FA 3V0LA 1ZJOA 1H5RA 4Q7CA 2FY7A 5FU8A 1LVWA 4KXOA 1LZIA 2XWNA 1WVCA 4KRVA 3U2WA 2WVKA 1NHEB 4KT7A 3PKQA 2QH5A 1NKHB 4IRPA 2RJ4A 4EE5A 1FO8A 1ZCVA 4YS8A 4Y63A 5CMIA 2RIYA 1EYRA 3I0IX 2Y7AA 2RJ6A 1VGZA 1LL0A 3DK5A 4LW3A 2V0KA 1YP4A 4D11C 4M28A 2GGQA 2FYBA 2APCA 4FRHA 2YCMA 1S4NA 4HO4A 1TW5A 3ZLKA 1K4VA 1G97A 2PA4A 3ZGGA 3I0GA 1O7OA 4KPZA 2OI5A 1GA8A 2AH9A 1VM8A 1MP4A 3SXGA 2OI6A 4G3PA 1VGWA 3I0KA 3DJ4A 5C4EA 4D0ZA 5AJPA 1FGXA 3IOHA 1ZDGA 1G95A 3CKJA 3CKQA 1NWGB 2VXLA 1ZCYA 2W0VA 3K8DA 2PX7A 4K6RA 4JISA 5CMJA 2Y4KA 5CQLX 3OH4A 2WVLA 4NAKA 4NALA 5C38A 2X65A 1JYKA 4KPXA 5CMGX 1ZJPA 2O1GA 4BMAA 3IOIA 3FWWA 3OH3A 1XZ6A 4FRAA 1E5KA 2FYCB 1ZI3A 2YC3A 1FZWA 2JCKA 1O7QA 4KC4A 3E26A 2JCLA 5C4CA 3ZLLA 4FREA 1FRWA 4DECA 3FOQA 1ZHJA 2D7RA 4CVHA 1YP2A 2RJ9A 4M2AA 1HM9A 3T7MA 1EZIA 1LL3A 3I0CA 1NQIB 1LZ7A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2YQJ A;  3U0X A;  4B2W A;  3NGW A;  1O0R A;  3V91 A;  4HO6 A;  4FRD A;  4KNX A;  1H7L A;  1MP3 A;  1QGQ A;  5C1G A;  1H5S B;  1INI A;  1TZF A;  4HO9 A;  3I0L A;  2VS4 A;  4Y6N A;  1H5S A;  1H7E A;  1G23 A;  1GWW A;  1LZ0 A;  1R7T A;  4KQL A;  4AC3 A;  2V0H A;  3SXE A;  4XWI A;  1R7V A;  4NAI A;  3CGX A;  1H4C A;  5I1F A;  2X60 A;  4KNR A;  1WSZ A;  1ZIZ A;  3O3P A;  3V0O A;  1OMX A;  2ZU9 A;  3EE5 A;  2Q4J A;  4L41 C;  5FV9 A;  1HM8 A;  3OKR A;  4B5B A;  3PNN A;  1O23 B;  3T7N A;  5DDT A;  4HO3 A;  1GQ9 A;  1G2V A;  1FOA A;  1V82 A;  5BXC A;  1R7U A;  1R7X A;  3I0F A;  1R82 A;  3V8Z A;  3D98 A;  4MYB A;  4G87 A;  2Y6P A;  1H5S D;  2A8U A;  2VS3 A;  2PGY A;  1VGU A;  5FUH A;  1S4O A;  4ASJ A;  5L6S A;  2I5K A;  2BO7 A;  2X5S A;  2FYD B;  4B42 A;  1KWS A;  3V0Q A;  2ZU8 A;  5C8R A;  1HM0 A;  2CU2 A;  3D5N A;  5C3A A;  4FRM A;  1HJL A;  4B2X A;  5HS2 A;  2W0W A;  4Y7V A;  2Y4M A;  4D11 A;  5C49 A;  1ON6 A;  2FFV A;  5C1H A;  5CQN X;  5EIY A;  2Z87 A;  2MZB A;  2FYA A;  4EEO A;  1WT0 A;  1GX0 A;  3RSB A;  4EEA A;  4EE3 A;  5AJO A;  4DDZ A;  1YRO B;  2VFZ A;  2O1H A;  2BO8 A;  5CQP A;  1GQC A;  2ICY A;  3RMW A;  5J49 A;  5C48 A;  2FFU A;  4IRQ A;  4Y7T A;  3POL A;  4Y62 A;  2AM5 A;  1VZX A;  3U2X A;  2AES A;  2A8W A;  5EJZ A;  1IIM A;  4HG6 A;  3V90 A;  1H7Q A;  4EEG A;  3DUV A;  1VPA A;  1FXJ A;  4HO0 A;  4BQH A;  1H5T B;  1FR8 A;  2WEE A;  4HO5 A;  4FCE A;  1H5T A;  3N9W A;  5CQM X;  1ZI5 A;  1FWY A;  1ZDF A;  3IOJ A;  3PKP A;  4FRO A;  3SPT A;  2JCJ A;  2RJ1 A;  4NAN A;  3ZGF A;  2P73 A;  2D0J A;  5CMF X;  3F1Y A;  1TW1 A;  2X5Z A;  4AAW A;  2PGV A;  5C4D A;  2VS5 A;  2ICX A;  2VSH A;  4G3Q A;  4M4K A;  5DDV A;  4FRP A;  4FRL A;  1WT3 A;  1OMZ A;  1FG5 N;  1ZCU A;  3R3I A;  5C1L A;  1V83 A;  1H5S C;  3GUE A;  1FXO A;  2QKX A;  3ZF8 A;  4EEM A;  3OC9 A;  1QG8 A;  3U2V A;  1JV1 A;  1VZT A;  4HO8 A;  3BCV A;  3SXB A;  3JUJ A;  1LL2 A;  1S4P A;  1IIN A;  3CKN A;  3SXA A;  1ZJ0 A;  1VH1 A;  2AM3 A;  2RJ8 A;  4MND A;  5FTV A;  3SX7 A;  2GGO A;  3HL3 A;  4JD0 A;  2P6W A;  4EE4 A;  5C4B A;  4CJB A;  5IFY A;  1NMM B;  4CJ8 A;  2V0J A;  4HO2 A;  2QGI A;  2E3D A;  5C3D A;  1H4E A;  1R80 A;  1R7Y A;  1H7F A;  1PZT A;  3K8E A;  4M2B A;  5C47 A;  3U0Y A;  5C3B A;  1VH3 A;  3SX3 A;  3V0P A;  2XWL A;  1SS9 A;  3T7O A;  4B4B A;  4ZDQ A;  2YQC A;  2RJ0 A;  1VZU A;  4DE7 A;  2P72 A;  4C2S A;  3SX8 A;  1WT2 A;  4D48 A;  1FGG A;  3JTJ A;  4AYL A;  2AM4 A;  4Y7U A;  5FU0 A;  4ARW A;  5C4F A;  2WAW A;  3I0D A;  4B3U A;  1JVD A;  3USQ A;  1R81 A;  1FR9 A;  1QWJ A;  3E25 A;  3I0J A;  1G3L A;  2RIZ A;  1ZI4 A;  3LW6 A;  2Z86 A;  2AE7 A;  4P02 A;  1V84 A;  1VIC A;  1MC3 A;  3OH0 A;  1GWV A;  3Q7U A;  2Y4L A;  1G8O A;  1G93 A;  1H7T A;  4FRB A;  4Y64 A;  4CJC A;  3KIA A;  1H3M A;  1WT1 A;  3D8V A;  2BO4 A;  1VGT A;  5AJN A;  1HV9 A;  1G1L A;  4E1K A;  1H7H A;  2RJ7 A;  3F1C A;  2DPW A;  2V0I A;  2JCO A;  4HOC A;  1MP5 A;  1H7G A;  5IDS A;  1LZJ A;  2Y4J A;  1W77 A;  2E8B A;  4LW6 A;  1TVY A;  2YQS A;  1QGS A;  1GX4 A;  3JUK A;  3Q4S A;  4J18 A;  1ZJ1 A;  1FO9 A;  2NXV A;  2V0L A;  2I5E A;  3V0N A;  4GBP A;  4UEG A;  1JYL A;  1YP3 A;  3OGZ A;  2OI7 A;  4FQW A;  3TQD A;  3Q80 A;  2OEG A;  4R7P A;  3V8Y A;  3SX5 A;  2ZU7 A;  3CKO A;  2RIX A;  4KC2 A;  4FCU A;  2D7I A;  3QVB A;  4G3S A;  3CU0 A;  4AYJ A;  2AGD A;  4FRQ A;  2YES A;  4Y6U A;  1G0R A;  1H4D A;  4Y7F A;  1W55 A;  1ZJ2 A;  3I0H A;  3OH1 A;  3R2W A;  1Z90 A;  3TZT A;  3BRK X;  2WE9 A;  5JQQ A;  1ON8 A;  4KC1 A;  3USR A;  2OEF A;  5C36 A;  2I7B A;  3ST8 A;  2WVM A;  4ECM A;  1HJJ A;  2AEC A;  2RJ5 A;  2XME A;  3V0M A;  4B4M A;  5FYE A;  2RIT A;  1G9R A;  2YC5 A;  1NF5 B;  2VSI A;  1I52 A;  2VXM A;  2XWM A;  4D0T A;  4EVW A;  3OH2 A;  2WGZ A;  5IDT A;  5CQO A;  3U2U A;  4HCQ A;  1PZY B;  2YQH A;  2VD4 A;  2XMH A;  4Y9X A;  1XHB A;  1INJ A;  4P00 A;  3I0E A;  2UX8 A;  3CKV A;  5FTS A;  1JV3 A;  4Y7G A;  3SXD A;  5EJ1 A;  3SXC A;  1ZI1 A;  4B4G A;  3OAM A;  1OQM B;  2BO6 A;  1JVG A;  1ZJ3 A;  3RMV A;  3U2T A;  4ASY A;  5L6V A;  1ZCT A;  1W57 A;  5CMH A;  1H5R B;  2O1F A;  3V0L A;  1ZJO A;  1H5R A;  2FY7 A;  5FU8 A;  1LVW A;  4KXO A;  1LZI A;  2XWN A;  1WVC A;  4KRV A;  3U2W A;  2WVK A;  1NHE B;  4KT7 A;  3PKQ A;  2QH5 A;  1NKH B;  4IRP A;  2RJ4 A;  4EE5 A;  1FO8 A;  1ZCV A;  4YS8 A;  4Y63 A;  5CMI A;  2RIY A;  1EYR A;  3I0I X;  2Y7A A;  2RJ6 A;  1VGZ A;  1LL0 A;  3DK5 A;  4LW3 A;  2V0K A;  1YP4 A;  4D11 C;  4M28 A;  2GGQ A;  2FYB A;  2APC A;  4FRH A;  2YCM A;  1S4N A;  4HO4 A;  1TW5 A;  3ZLK A;  1K4V A;  1G97 A;  2PA4 A;  3ZGG A;  3I0G A;  1O7O A;  4KPZ A;  2OI5 A;  1GA8 A;  2AH9 A;  1VM8 A;  1MP4 A;  3SXG A;  2OI6 A;  4G3P A;  1VGW A;  3I0K A;  3DJ4 A;  5C4E A;  4D0Z A;  5AJP A;  1FGX A;  3IOH A;  1ZDG A;  1G95 A;  3CKJ A;  3CKQ A;  1NWG B;  2VXL A;  1ZCY A;  2W0V A;  3K8D A;  2PX7 A;  4K6R A;  4JIS A;  5CMJ A;  2Y4K A;  5CQL X;  3OH4 A;  2WVL A;  4NAK A;  4NAL A;  5C38 A;  2X65 A;  1JYK A;  4KPX A;  5CMG X;  1ZJP A;  2O1G A;  4BMA A;  3IOI A;  3FWW A;  3OH3 A;  1XZ6 A;  4FRA A;  1E5K A;  2FYC B;  1ZI3 A;  2YC3 A;  1FZW A;  2JCK A;  1O7Q A;  4KC4 A;  3E26 A;  2JCL A;  5C4C A;  3ZLL A;  4FRE A;  1FRW A;  4DEC A;  3FOQ A;  1ZHJ A;  2D7R A;  4CVH A;  1YP2 A;  2RJ9 A;  4M2A A;  1HM9 A;  3T7M A;  1EZI A;  1LL3 A;  3I0C A;  1NQI B;  1LZ7 A; 
#chains in the Genus database with same CATH topology
 2YQJ A;  3U0X A;  4B2W A;  3NGW A;  1O0R A;  3V91 A;  4HO6 A;  4FRD A;  4KNX A;  1H7L A;  1MP3 A;  1QGQ A;  5C1G A;  1H5S B;  1INI A;  1TZF A;  4HO9 A;  3I0L A;  2VS4 A;  4Y6N A;  1H5S A;  1H7E A;  1G23 A;  1GWW A;  1LZ0 A;  1R7T A;  4KQL A;  4AC3 A;  2V0H A;  3SXE A;  4XWI A;  1R7V A;  4NAI A;  3CGX A;  2VK9 A;  1H4C A;  5I1F A;  2X60 A;  4KNR A;  1WSZ A;  1ZIZ A;  3O3P A;  3V0O A;  1OMX A;  2ZU9 A;  3EE5 A;  2Q4J A;  4L41 C;  5FV9 A;  1HM8 A;  3OKR A;  4B5B A;  3PNN A;  1O23 B;  3T7N A;  5DDT A;  4HO3 A;  1GQ9 A;  1G2V A;  1FOA A;  1V82 A;  5BXC A;  1R7U A;  1R7X A;  3I0F A;  1R82 A;  3V8Z A;  3D98 A;  4MYB A;  4G87 A;  2Y6P A;  1H5S D;  2A8U A;  2VS3 A;  2PGY A;  1VGU A;  5FUH A;  1S4O A;  4ASJ A;  5L6S A;  2I5K A;  2BO7 A;  2X5S A;  2FYD B;  4B42 A;  1KWS A;  3V0Q A;  2ZU8 A;  5C8R A;  1HM0 A;  2CU2 A;  3D5N A;  5C3A A;  4FRM A;  1HJL A;  4FIX A;  4B2X A;  5HS2 A;  2W0W A;  4Y7V A;  2Y4M A;  4D11 A;  5C49 A;  1ON6 A;  2FFV A;  5C1H A;  5CQN X;  5EIY A;  2Z87 A;  2MZB A;  2FYA A;  4EEO A;  1WT0 A;  1GX0 A;  3RSB A;  4EEA A;  4EE3 A;  2C0N A;  5AJO A;  4DDZ A;  1YRO B;  2VFZ A;  2O1H A;  2BO8 A;  5CQP A;  4FIY A;  1GQC A;  2ICY A;  3RMW A;  5J49 A;  5C48 A;  2FFU A;  2J0A A;  4IRQ A;  4Y7T A;  3POL A;  4Y62 A;  2AM5 A;  1VZX A;  3U2X A;  2AES A;  2A8W A;  5EJZ A;  1IIM A;  4HG6 A;  3V90 A;  1H7Q A;  4EEG A;  3DUV A;  1VPA A;  1FXJ A;  4HO0 A;  4BQH A;  1H5T B;  1FR8 A;  2WEE A;  4HO5 A;  4FCE A;  4MIX A;  1H5T A;  3N9W A;  5CQM X;  1ZI5 A;  1FWY A;  1ZDF A;  3IOJ A;  3PKP A;  4FRO A;  3SPT A;  4O6N A;  2JCJ A;  2RJ1 A;  4NAN A;  3ZGF A;  2P73 A;  2D0J A;  5CMF X;  3F1Y A;  1TW1 A;  2X5Z A;  4AAW A;  2PGV A;  5C4D A;  2VS5 A;  2ICX A;  2VSH A;  4G3Q A;  4M4K A;  5DDV A;  4FRP A;  4FRL A;  1WT3 A;  1OMZ A;  1FG5 N;  1ZCU A;  3R3I A;  5C1L A;  1V83 A;  1H5S C;  3GUE A;  1FXO A;  2QKX A;  3ZF8 A;  4EEM A;  3OC9 A;  1QG8 A;  3U2V A;  1JV1 A;  1VZT A;  4HO8 A;  5D92 A;  3BCV A;  3SXB A;  3JUJ A;  1LL2 A;  1S4P A;  1IIN A;  3CKN A;  3SXA A;  1ZJ0 A;  1VH1 A;  2AM3 A;  2RJ8 A;  4MND A;  5FTV A;  3SX7 A;  2GGO A;  3HL3 A;  4JD0 A;  2P6W A;  4EE4 A;  5C4B A;  4CJB A;  5IFY A;  2J0B A;  1NMM B;  4CJ8 A;  2V0J A;  4HO2 A;  2QGI A;  2E3D A;  5C3D A;  1H4E A;  1R80 A;  1R7Y A;  1H7F A;  1PZT A;  3K8E A;  4M2B A;  5C47 A;  3U0Y A;  5C3B A;  1VH3 A;  3SX3 A;  3V0P A;  2XWL A;  1SS9 A;  3T7O A;  4B4B A;  4ZDQ A;  2YQC A;  2RJ0 A;  1VZU A;  4DE7 A;  2P72 A;  4C2S A;  3SX8 A;  1WT2 A;  4D48 A;  1FGG A;  3JTJ A;  4AYL A;  2AM4 A;  4Y7U A;  5FU0 A;  4ARW A;  5C4F A;  2WAW A;  3I0D A;  4B3U A;  1JVD A;  3USQ A;  1R81 A;  1FR9 A;  1QWJ A;  3E25 A;  3I0J A;  1G3L A;  2RIZ A;  1ZI4 A;  3LW6 A;  2Z86 A;  2AE7 A;  4P02 A;  1V84 A;  1VIC A;  1MC3 A;  3OH0 A;  1GWV A;  3Q7U A;  2Y4L A;  1G8O A;  1G93 A;  1H7T A;  4FRB A;  4Y64 A;  4CJC A;  3KIA A;  1H3M A;  1WT1 A;  3D8V A;  2BO4 A;  1VGT A;  5AJN A;  1HV9 A;  1G1L A;  4E1K A;  1H7H A;  2RJ7 A;  3F1C A;  2DPW A;  2V0I A;  2JCO A;  4HOC A;  1MP5 A;  1H7G A;  5IDS A;  1LZJ A;  2Y4J A;  1W77 A;  2E8B A;  4LW6 A;  1TVY A;  2YQS A;  1QGS A;  1GX4 A;  3JUK A;  3Q4S A;  4O6M A;  4J18 A;  1ZJ1 A;  1FO9 A;  2NXV A;  2V0L A;  2I5E A;  3V0N A;  4GBP A;  4UEG A;  1JYL A;  1YP3 A;  3OGZ A;  2OI7 A;  4FQW A;  3TQD A;  3Q80 A;  2OEG A;  4R7P A;  3V8Y A;  3SX5 A;  2ZU7 A;  3CKO A;  2RIX A;  4KC2 A;  4FCU A;  2D7I A;  3QVB A;  4G3S A;  3CU0 A;  4AYJ A;  2AGD A;  4FRQ A;  2YES A;  4Y6U A;  1G0R A;  1H4D A;  4Y7F A;  1W55 A;  1ZJ2 A;  3I0H A;  3OH1 A;  3R2W A;  1Z90 A;  3TZT A;  3BRK X;  2WE9 A;  5JQQ A;  1ON8 A;  4KC1 A;  3USR A;  5D91 A;  2OEF A;  5C36 A;  2I7B A;  3ST8 A;  2WVM A;  4ECM A;  1HJJ A;  2AEC A;  2RJ5 A;  2XME A;  3V0M A;  4B4M A;  5FYE A;  2RIT A;  1G9R A;  2YC5 A;  1NF5 B;  2VSI A;  1I52 A;  2VXM A;  2XWM A;  4D0T A;  4EVW A;  3OH2 A;  2WGZ A;  5IDT A;  5CQO A;  3U2U A;  4HCQ A;  1PZY B;  2YQH A;  2VD4 A;  2XMH A;  4Y9X A;  1XHB A;  1INJ A;  4P00 A;  3I0E A;  2UX8 A;  3CKV A;  5FTS A;  1JV3 A;  4Y7G A;  3SXD A;  5EJ1 A;  3SXC A;  1ZI1 A;  4B4G A;  3OAM A;  1OQM B;  2BO6 A;  1JVG A;  1ZJ3 A;  3RMV A;  3U2T A;  4ASY A;  5L6V A;  1ZCT A;  1W57 A;  5CMH A;  1H5R B;  2O1F A;  3V0L A;  1ZJO A;  1H5R A;  4Q7C A;  2FY7 A;  5FU8 A;  1LVW A;  4KXO A;  1LZI A;  2XWN A;  1WVC A;  4KRV A;  3U2W A;  2WVK A;  1NHE B;  4KT7 A;  3PKQ A;  2QH5 A;  1NKH B;  4IRP A;  2RJ4 A;  4EE5 A;  1FO8 A;  1ZCV A;  4YS8 A;  4Y63 A;  5CMI A;  2RIY A;  1EYR A;  3I0I X;  2Y7A A;  2RJ6 A;  1VGZ A;  1LL0 A;  3DK5 A;  4LW3 A;  2V0K A;  1YP4 A;  4D11 C;  4M28 A;  2GGQ A;  2FYB A;  2APC A;  4FRH A;  2YCM A;  1S4N A;  4HO4 A;  1TW5 A;  3ZLK A;  1K4V A;  1G97 A;  2PA4 A;  3ZGG A;  3I0G A;  1O7O A;  4KPZ A;  2OI5 A;  1GA8 A;  2AH9 A;  1VM8 A;  1MP4 A;  3SXG A;  2OI6 A;  4G3P A;  1VGW A;  3I0K A;  3DJ4 A;  5C4E A;  4D0Z A;  5AJP A;  1FGX A;  3IOH A;  1ZDG A;  1G95 A;  3CKJ A;  3CKQ A;  1NWG B;  2VXL A;  1ZCY A;  2W0V A;  3K8D A;  2PX7 A;  4K6R A;  4JIS A;  5CMJ A;  2Y4K A;  5CQL X;  3OH4 A;  2WVL A;  4NAK A;  4NAL A;  5C38 A;  2X65 A;  1JYK A;  4KPX A;  5CMG X;  1ZJP A;  2O1G A;  4BMA A;  3IOI A;  3FWW A;  3OH3 A;  1XZ6 A;  4FRA A;  1E5K A;  2FYC B;  1ZI3 A;  2YC3 A;  1FZW A;  2JCK A;  1O7Q A;  4KC4 A;  3E26 A;  2JCL A;  5C4C A;  3ZLL A;  4FRE A;  1FRW A;  4DEC A;  3FOQ A;  1ZHJ A;  2D7R A;  4CVH A;  1YP2 A;  2RJ9 A;  4M2A A;  1HM9 A;  3T7M A;  1EZI A;  1LL3 A;  3I0C A;  1NQI B;  1LZ7 A; 
#chains in the Genus database with same CATH homology
 2YQJ A;  3U0X A;  4B2W A;  3NGW A;  1O0R A;  3V91 A;  4HO6 A;  4FRD A;  4KNX A;  1H7L A;  1MP3 A;  1QGQ A;  5C1G A;  1H5S B;  1INI A;  1TZF A;  4HO9 A;  3I0L A;  2VS4 A;  4Y6N A;  1H5S A;  1H7E A;  1G23 A;  1GWW A;  1LZ0 A;  1R7T A;  4KQL A;  4AC3 A;  2V0H A;  3SXE A;  4XWI A;  1R7V A;  4NAI A;  3CGX A;  2VK9 A;  1H4C A;  5I1F A;  2X60 A;  4KNR A;  1WSZ A;  1ZIZ A;  3O3P A;  3V0O A;  1OMX A;  2ZU9 A;  3EE5 A;  2Q4J A;  4L41 C;  5FV9 A;  1HM8 A;  3OKR A;  4B5B A;  3PNN A;  1O23 B;  3T7N A;  5DDT A;  4HO3 A;  1GQ9 A;  1G2V A;  1FOA A;  1V82 A;  5BXC A;  1R7U A;  1R7X A;  3I0F A;  1R82 A;  3V8Z A;  3D98 A;  4MYB A;  4G87 A;  2Y6P A;  1H5S D;  2A8U A;  2VS3 A;  2PGY A;  1VGU A;  5FUH A;  1S4O A;  4ASJ A;  5L6S A;  2I5K A;  2BO7 A;  2X5S A;  2FYD B;  4B42 A;  1KWS A;  3V0Q A;  2ZU8 A;  5C8R A;  1HM0 A;  2CU2 A;  3D5N A;  5C3A A;  4FRM A;  1HJL A;  4FIX A;  4B2X A;  5HS2 A;  2W0W A;  4Y7V A;  2Y4M A;  4D11 A;  5C49 A;  1ON6 A;  2FFV A;  5C1H A;  5CQN X;  5EIY A;  2Z87 A;  2MZB A;  2FYA A;  4EEO A;  1WT0 A;  1GX0 A;  3RSB A;  4EEA A;  4EE3 A;  2C0N A;  5AJO A;  4DDZ A;  1YRO B;  2VFZ A;  2O1H A;  2BO8 A;  5CQP A;  4FIY A;  1GQC A;  2ICY A;  3RMW A;  5J49 A;  5C48 A;  2FFU A;  2J0A A;  4IRQ A;  4Y7T A;  3POL A;  4Y62 A;  2AM5 A;  1VZX A;  3U2X A;  2AES A;  2A8W A;  5EJZ A;  1IIM A;  4HG6 A;  3V90 A;  1H7Q A;  4EEG A;  3DUV A;  1VPA A;  1FXJ A;  4HO0 A;  4BQH A;  1H5T B;  1FR8 A;  2WEE A;  4HO5 A;  4FCE A;  4MIX A;  1H5T A;  3N9W A;  5CQM X;  1ZI5 A;  1FWY A;  1ZDF A;  3IOJ A;  3PKP A;  4FRO A;  3SPT A;  4O6N A;  2JCJ A;  2RJ1 A;  4NAN A;  3ZGF A;  2P73 A;  2D0J A;  5CMF X;  3F1Y A;  1TW1 A;  2X5Z A;  4AAW A;  2PGV A;  5C4D A;  2VS5 A;  2ICX A;  2VSH A;  4G3Q A;  4M4K A;  5DDV A;  4FRP A;  4FRL A;  1WT3 A;  1OMZ A;  1FG5 N;  1ZCU A;  3R3I A;  5C1L A;  1V83 A;  1H5S C;  3GUE A;  1FXO A;  2QKX A;  3ZF8 A;  4EEM A;  3OC9 A;  1QG8 A;  3U2V A;  1JV1 A;  1VZT A;  4HO8 A;  5D92 A;  3BCV A;  3SXB A;  3JUJ A;  1LL2 A;  1S4P A;  1IIN A;  3CKN A;  3SXA A;  1ZJ0 A;  1VH1 A;  2AM3 A;  2RJ8 A;  4MND A;  5FTV A;  3SX7 A;  2GGO A;  3HL3 A;  4JD0 A;  2P6W A;  4EE4 A;  5C4B A;  4CJB A;  5IFY A;  2J0B A;  1NMM B;  4CJ8 A;  2V0J A;  4HO2 A;  2QGI A;  2E3D A;  5C3D A;  1H4E A;  1R80 A;  1R7Y A;  1H7F A;  1PZT A;  3K8E A;  4M2B A;  5C47 A;  3U0Y A;  5C3B A;  1VH3 A;  3SX3 A;  3V0P A;  2XWL A;  1SS9 A;  3T7O A;  4B4B A;  4ZDQ A;  2YQC A;  2RJ0 A;  1VZU A;  4DE7 A;  2P72 A;  4C2S A;  3SX8 A;  1WT2 A;  4D48 A;  1FGG A;  3JTJ A;  4AYL A;  2AM4 A;  4Y7U A;  5FU0 A;  4ARW A;  5C4F A;  2WAW A;  3I0D A;  4B3U A;  1JVD A;  3USQ A;  1R81 A;  1FR9 A;  1QWJ A;  3E25 A;  3I0J A;  1G3L A;  2RIZ A;  1ZI4 A;  3LW6 A;  2Z86 A;  2AE7 A;  4P02 A;  1V84 A;  1VIC A;  1MC3 A;  3OH0 A;  1GWV A;  3Q7U A;  2Y4L A;  1G8O A;  1G93 A;  1H7T A;  4FRB A;  4Y64 A;  4CJC A;  3KIA A;  1H3M A;  1WT1 A;  3D8V A;  2BO4 A;  1VGT A;  5AJN A;  1HV9 A;  1G1L A;  4E1K A;  1H7H A;  2RJ7 A;  3F1C A;  2DPW A;  2V0I A;  2JCO A;  4HOC A;  1MP5 A;  1H7G A;  5IDS A;  1LZJ A;  2Y4J A;  1W77 A;  2E8B A;  4LW6 A;  1TVY A;  2YQS A;  1QGS A;  1GX4 A;  3JUK A;  3Q4S A;  4O6M A;  4J18 A;  1ZJ1 A;  1FO9 A;  2NXV A;  2V0L A;  2I5E A;  3V0N A;  4GBP A;  4UEG A;  1JYL A;  1YP3 A;  3OGZ A;  2OI7 A;  4FQW A;  3TQD A;  3Q80 A;  2OEG A;  4R7P A;  3V8Y A;  3SX5 A;  2ZU7 A;  3CKO A;  2RIX A;  4KC2 A;  4FCU A;  2D7I A;  3QVB A;  4G3S A;  3CU0 A;  4AYJ A;  2AGD A;  4FRQ A;  2YES A;  4Y6U A;  1G0R A;  1H4D A;  4Y7F A;  1W55 A;  1ZJ2 A;  3I0H A;  3OH1 A;  3R2W A;  1Z90 A;  3TZT A;  3BRK X;  2WE9 A;  5JQQ A;  1ON8 A;  4KC1 A;  3USR A;  5D91 A;  2OEF A;  5C36 A;  2I7B A;  3ST8 A;  2WVM A;  4ECM A;  1HJJ A;  2AEC A;  2RJ5 A;  2XME A;  3V0M A;  4B4M A;  5FYE A;  2RIT A;  1G9R A;  2YC5 A;  1NF5 B;  2VSI A;  1I52 A;  2VXM A;  2XWM A;  4D0T A;  4EVW A;  3OH2 A;  2WGZ A;  5IDT A;  5CQO A;  3U2U A;  4HCQ A;  1PZY B;  2YQH A;  2VD4 A;  2XMH A;  4Y9X A;  1XHB A;  1INJ A;  4P00 A;  3I0E A;  2UX8 A;  3CKV A;  5FTS A;  1JV3 A;  4Y7G A;  3SXD A;  5EJ1 A;  3SXC A;  1ZI1 A;  4B4G A;  3OAM A;  1OQM B;  2BO6 A;  1JVG A;  1ZJ3 A;  3RMV A;  3U2T A;  4ASY A;  5L6V A;  1ZCT A;  1W57 A;  5CMH A;  1H5R B;  2O1F A;  3V0L A;  1ZJO A;  1H5R A;  4Q7C A;  2FY7 A;  5FU8 A;  1LVW A;  4KXO A;  1LZI A;  2XWN A;  1WVC A;  4KRV A;  3U2W A;  2WVK A;  1NHE B;  4KT7 A;  3PKQ A;  2QH5 A;  1NKH B;  4IRP A;  2RJ4 A;  4EE5 A;  1FO8 A;  1ZCV A;  4YS8 A;  4Y63 A;  5CMI A;  2RIY A;  1EYR A;  3I0I X;  2Y7A A;  2RJ6 A;  1VGZ A;  1LL0 A;  3DK5 A;  4LW3 A;  2V0K A;  1YP4 A;  4D11 C;  4M28 A;  2GGQ A;  2FYB A;  2APC A;  4FRH A;  2YCM A;  1S4N A;  4HO4 A;  1TW5 A;  3ZLK A;  1K4V A;  1G97 A;  2PA4 A;  3ZGG A;  3I0G A;  1O7O A;  4KPZ A;  2OI5 A;  1GA8 A;  2AH9 A;  1VM8 A;  1MP4 A;  3SXG A;  2OI6 A;  4G3P A;  1VGW A;  3I0K A;  3DJ4 A;  5C4E A;  4D0Z A;  5AJP A;  1FGX A;  3IOH A;  1ZDG A;  1G95 A;  3CKJ A;  3CKQ A;  1NWG B;  2VXL A;  1ZCY A;  2W0V A;  3K8D A;  2PX7 A;  4K6R A;  4JIS A;  5CMJ A;  2Y4K A;  5CQL X;  3OH4 A;  2WVL A;  4NAK A;  4NAL A;  5C38 A;  2X65 A;  1JYK A;  4KPX A;  5CMG X;  1ZJP A;  2O1G A;  4BMA A;  3IOI A;  3FWW A;  3OH3 A;  1XZ6 A;  4FRA A;  1E5K A;  2FYC B;  1ZI3 A;  2YC3 A;  1FZW A;  2JCK A;  1O7Q A;  4KC4 A;  3E26 A;  2JCL A;  5C4C A;  3ZLL A;  4FRE A;  1FRW A;  4DEC A;  3FOQ A;  1ZHJ A;  2D7R A;  4CVH A;  1YP2 A;  2RJ9 A;  4M2A A;  1HM9 A;  3T7M A;  1EZI A;  1LL3 A;  3I0C A;  1NQI B;  1LZ7 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...