1R82A

Glycosyltransferase b in complex with 3-amino-acceptor analog inhibitor, and uridine diphosphate-galactose
Total Genus 84
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
84
sequence length
283
structure length
263
Chain Sequence
MVSLPRMVYPQPKVLTPCRKDVLVVTPWLAPIVWEGTFNIDILNEQFRLQNTTIGLTVFAIKKYVAFLKLFLETAEKHFMVGHRVHYYVFTDQPAAVPRVTLGTGRQLSVLEVCERRFLSEVDYLVCVDVDMEFRDHVGVEILTPLFGTLHPSFYGSSREAFTYERRPQSQAYIPKDEGDFYYMGAFFGGSVQEVQRLTRACHQAMMVDQANGIEAVWHDESHLNKYLLRHKPTKVLSPEYLWDQQLLGWPAVLRKLRFTAVP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords Glycoprotein-fucosylgalactoside alpha-galactosyltransferase
publication title The influence of an intramolecular hydrogen bond in differential recognition of inhibitory acceptor analogs by human ABO(H) blood group A and B glycosyltransferases
pubmed doi rcsb
source organism Homo sapiens
total genus 84
structure length 263
sequence length 283
ec nomenclature ec 2.4.1.37: Fucosylgalactoside 3-alpha-galactosyltransferase.
pdb deposition date 2003-10-22
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.550.10 Alpha Beta Alpha-Beta Complex Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A 1r82A00
5HS2A 3OH2A 4KRVA 1LZJA 1H7QA 2X5SA 4NANA 3R2WA 1PZTA 1GQCA 1VICA 5CQMX 5DDVA 1FZWA 2Z86A 3E25A 1GQ9A 1H5TA 2O1GA 2AM4A 1VH1A 4ASYA 1OMXA 1R7YA 1VH3A 4FRMA 1WT2A 2FYCB 3ZLKA 4KNXA 1I52A 1TVYA 2JCKA 2D7IA 3PKPA 1G95A 2YQCA 1NQIB 2JCLA 1E5KA 3Q4SA 3D98A 4EE5A 2YQJA 1ZHJA 5EIYA 4C2SA 3Q80A 4KPXA 3V8YA 4AYLA 5FV9A 3TQDA 4Y62A 1SS9A 3CKJA 2WVMA 3ZGGA 2GGOA 4CVHA 1H5SB 1H5SC 1YROB 3PNNA 1VZXA 1INIA 2GGQA 3CKVA 4Y63A 3U2XA 2X65A 4G3QA 1FGXA 1ZJ1A 2V0HA 1JVGA 4HO4A 1PZYB 1G3LA 2PGVA 1HV9A 1OQMB 3D5NA 5C4EA 4FROA 3I0HA 1FOAA 1V82A 1KWSA 2OEGA 3RMWA 5C4CA 1HM9A 3OH1A 2P73A 3SX8A 1ZCVA 3JUJA 5EJ1A 3V0QA 2BO7A 1ZI3A 1WVCA 4CJ8A 1G9RA 5IFYA 3OKRA 2DPWA 1ZIZA 4MYBA 2VS4A 4CJBA 3PKQA 1GWVA 1G1LA 4L41C 5FUHA 2V0LA 4D11A 1ZDGA 1HJLA 3NGWA 1LZ0A 5C1HA 1YP3A 2QGIA 3EE5A 3U0XA 2O1FA 1ZJOA 3HL3A 1IIMA 3OGZA 5CQPA 3O3PA 3T7OA 4DDZA 4HCQA 5C3BA 2VXLA 1H7LA 3CGXA 4Y7FA 5C1GA 4FREA 2OI6A 2PA4A 2PGYA 1LL2A 2X60A 3V90A 2V0KA 1H7FA 2RJ9A 3U2VA 2VXMA 2YCMA 4AC3A 5AJNA 2Y7AA 3F1CA 1H7GA 4FRQA 4J18A 4G3PA 1H5SA 1WT0A 1LL3A 2WVKA 2YQHA 5J49A 1NF5B 1ZJPA 4FRDA 4P02A 1XZ6A 3I0LA 1LL0A 2V0IA 4FQWA 4B4BA 1H7HA 5C4FA 1NHEB 4EE4A 4K6RA 2RJ6A 4GBPA 1VZUA 3IOHA 2AESA 1MC3A 2E8BA 4B2WA 3GUEA 2YC5A 2P72A 4Y64A 1H3MA 3FWWA 5AJPA 5C38A 4EVWA 1ZJ3A 4JISA 4Y6NA 3ZF8A 2XWMA 4KT7A 4R7PA 4DECA 2RJ8A 4M2BA 1ZI4A 1ZCTA 1ZJ2A 1VGWA 3DUVA 1FGGA 5CMGX 3SXGA 1G93A 5CMJA 1R81A 3IOIA 1G2VA 1TW5A 1WT3A 1K4VA 2I7BA 1QWJA 1G97A 3I0FA 3SX3A 1QG8A 2W0WA 3U2TA 4ASJA 1O0RA 1R7TA 1FG5N 1FXJA 3I0GA 1JV1A 2QH5A 4HO8A 4ARWA 1EZIA 5DDTA 2NXVA 3N9WA 2BO6A 3F1YA 4NAKA 2W0VA 4FRPA 3I0EA 1MP4A 2XMEA 4KC1A 4DE7A 2RJ4A 3SXBA 1NWGB 3I0CA 1GA8A 1ZJ0A 4KXOA 4CJCA 3FOQA 5C8RA 4KC2A 1WSZA 1R7XA 2AECA 2FYBA 2ZU7A 2OEFA 2WE9A 1H5RA 1VGZA 2CU2A 3CU0A 2XMHA 2RJ7A 3DJ4A 3JTJA 1JYKA 4B2XA 2VSHA 1W55A 1H5TB 5FU0A 3SX5A 3SXCA 3V8ZA 2Z87A 3U0YA 4NALA 3IOJA 5JQQA 4FRHA 4P00A 2AGDA 1ZDFA 4HG6A 3SXEA 1JYLA 3DK5A 1ZI5A 3V0PA 5L6VA 4HO9A 2VS3A 4FRAA 5CQLX 3V0MA 1HM0A 2E3DA 3LW6A 4AYJA 2ZU9A 1MP3A 3I0IX 5CQNX 1R7VA 1VZTA 3ZGFA 4Y9XA 4HO3A 4EEGA 4HOCA 1G0RA 2OI7A 5FYEA 2QKXA 4FRBA 5IDTA 4IRQA 1NKHB 3E26A 3I0DA 1LZIA 4EEMA 3R3IA 1Z90A 3BRKX 3SX7A 1V83A 2BO8A 4UEGA 1ZCYA 1HJJA 3V0OA 1YP4A 1IINA 1TZFA 2APCA 4LW6A 5C3DA 2WVLA 4EEOA 3ST8A 3JUKA 5AJOA 3U2WA 1H7EA 1H4DA 1MP5A 3KIAA 3SXDA 5C3AA 2Y4LA 2ZU8A 1EYRA 1JVDA 1H4CA 5IDSA 4XWIA 4Y7VA 3D8VA 5CMHA 3U2UA 3ZLLA 1R82A 2Y6PA 1W57A 4Y7TA 1H7TA 2I5EA 4AAWA 1TW1A 2I5KA 1FXOA 2VFZA 1ZCUA 1VGTA 2FY7A 2RJ1A 3CKNA 3SPTA 1O7OA 2WGZA 2FFVA 5C47A 2Y4KA 2UX8A 3RMVA 2D7RA 5C4BA 1NMMB 3K8EA 1S4OA 4M28A 3V91A 2FFUA 4E1KA 1VPAA 4D0TA 1QGSA 4D48A 1ZI1A 2RITA 2OI5A 4BMAA 3T7NA 3OH0A 1H5SD 1ON8A 3OH3A 4YS8A 1FR8A 4KNRA 1S4NA 1LVWA 4M4KA 4ZDQA 5C4DA 3USRA 2AM5A 1W77A 2ICXA 1LZ7A 3Q7UA 4B3UA 2VS5A 5FU8A 2A8UA 1FO9A 1ON6A 4G3SA 1VM8A 2Y4JA 2V0JA 2VD4A 3RSBA 3BCVA 4Y6UA 2YESA 1G8OA 1QGQA 3CKQA 1YP2A 1R80A 4JD0A 2MZBA 2PX7A 1S4PA 2AM3A 3OAMA 4KC4A 1FWYA 1G23A 3I0KA 5CMIA 4M2AA 1XHBA 3I0JA 5L6SA 5FTSA 4B5BA 5FTVA 2AE7A 2RIZA 3T7MA 1WT1A 2O1HA 3USQA 4IRPA 2RJ0A 4HO6A 3V0LA 2YC3A 2RJ5A 1GWWA 1H4EA 2A8WA 2JCJA 1FR9A 1GX0A 2D0JA 4KQLA 3OH4A 4HO0A 3V0NA 1R7UA 4FCUA 4LW3A 4NAIA 2ICYA 2P6WA 1FRWA 2XWNA 2Y4MA 2YQSA 5CMFX 2RIXA 2FYAA 1GX4A 5C1LA 2FYDB 5C48A 2X5ZA 1VGUA 4B42A 3K8DA 5C36A 1FO8A 1OMZA 2JCOA 4MNDA 5CQOA 4D0ZA 4ECMA 2XWLA 2VSIA 1HM8A 3SXAA 5C49A 4FCEA 1H5RB 3OC9A 1O7QA 2WAWA 4HO2A 4Y7UA 4FRLA 2AH9A 3POLA 5BXCA 4B4GA 3TZTA 1INJA 4D11C 4EEAA 4Y7GA 4HO5A 2RIYA 2BO4A 4EE3A 3QVBA 5I1FA 5EJZA 4B4MA 3CKOA 4BQHA 1O23B 2WEEA 1V84A 2Q4JA 4G87A 1JV3A 4KPZA
chains in the Genus database with same CATH superfamily
5HS2A 3OH2A 4KRVA 1LZJA 1H7QA 2X5SA 4NANA 3R2WA 1PZTA 1GQCA 1VICA 5CQMX 5DDVA 1FZWA 2Z86A 3E25A 1GQ9A 1H5TA 2O1GA 2AM4A 1VH1A 4ASYA 1OMXA 1R7YA 1VH3A 4FRMA 1WT2A 2FYCB 3ZLKA 4KNXA 1I52A 1TVYA 2JCKA 2D7IA 3PKPA 1G95A 2YQCA 1NQIB 2JCLA 1E5KA 3Q4SA 3D98A 4EE5A 2YQJA 1ZHJA 5EIYA 4C2SA 3Q80A 4KPXA 3V8YA 4AYLA 5FV9A 3TQDA 4Y62A 1SS9A 3CKJA 2WVMA 3ZGGA 2GGOA 4CVHA 1H5SB 1H5SC 1YROB 3PNNA 1VZXA 1INIA 2GGQA 3CKVA 4Y63A 3U2XA 2X65A 4G3QA 1FGXA 1ZJ1A 2V0HA 1JVGA 4HO4A 1PZYB 1G3LA 2PGVA 2C0NA 1HV9A 1OQMB 3D5NA 5C4EA 4FROA 3I0HA 1FOAA 1V82A 1KWSA 2OEGA 3RMWA 5C4CA 1HM9A 3OH1A 2P73A 3SX8A 1ZCVA 3JUJA 5EJ1A 3V0QA 2BO7A 1ZI3A 1WVCA 4CJ8A 1G9RA 5IFYA 3OKRA 2DPWA 4FIYA 1ZIZA 4MYBA 5D91A 2VS4A 4CJBA 3PKQA 1GWVA 1G1LA 4L41C 5FUHA 2V0LA 4D11A 1ZDGA 1HJLA 3NGWA 1LZ0A 5C1HA 1YP3A 2QGIA 3EE5A 3U0XA 2O1FA 1ZJOA 3HL3A 1IIMA 3OGZA 5CQPA 3O3PA 3T7OA 4DDZA 4HCQA 5C3BA 2VXLA 1H7LA 3CGXA 4MIXA 4Y7FA 5C1GA 4FREA 2OI6A 2PA4A 2PGYA 1LL2A 2X60A 3V90A 2V0KA 1H7FA 2RJ9A 3U2VA 2VXMA 2YCMA 4AC3A 5AJNA 2Y7AA 3F1CA 1H7GA 4FRQA 4J18A 4G3PA 1H5SA 1WT0A 1LL3A 2WVKA 2YQHA 5J49A 1NF5B 1ZJPA 4FRDA 4P02A 1XZ6A 3I0LA 1LL0A 2V0IA 4FQWA 4B4BA 1H7HA 5C4FA 1NHEB 4EE4A 4K6RA 2RJ6A 4GBPA 1VZUA 3IOHA 2AESA 1MC3A 2E8BA 4B2WA 3GUEA 2YC5A 2P72A 4Y64A 1H3MA 3FWWA 5AJPA 5C38A 4EVWA 1ZJ3A 4JISA 4Y6NA 3ZF8A 2XWMA 4KT7A 4R7PA 4DECA 2RJ8A 4M2BA 1ZI4A 1ZCTA 1ZJ2A 1VGWA 3DUVA 1FGGA 5CMGX 3SXGA 1G93A 5CMJA 1R81A 3IOIA 1G2VA 1TW5A 1WT3A 1K4VA 2I7BA 1QWJA 1G97A 3I0FA 4FIXA 3SX3A 1QG8A 2W0WA 3U2TA 4ASJA 1O0RA 1R7TA 1FG5N 1FXJA 3I0GA 1JV1A 2QH5A 4HO8A 4ARWA 1EZIA 5DDTA 2NXVA 3N9WA 2BO6A 3F1YA 4NAKA 2W0VA 4FRPA 3I0EA 1MP4A 2XMEA 4KC1A 4DE7A 2RJ4A 3SXBA 1NWGB 3I0CA 1GA8A 1ZJ0A 4KXOA 4CJCA 3FOQA 5C8RA 4KC2A 1WSZA 1R7XA 2AECA 2FYBA 2ZU7A 2OEFA 2WE9A 1H5RA 1VGZA 2CU2A 3CU0A 2XMHA 2RJ7A 3DJ4A 3JTJA 1JYKA 4B2XA 2VSHA 1W55A 1H5TB 5FU0A 3SX5A 3SXCA 2J0BA 3V8ZA 2Z87A 3U0YA 4NALA 3IOJA 5JQQA 4FRHA 4P00A 2AGDA 1ZDFA 4HG6A 3SXEA 1JYLA 3DK5A 1ZI5A 3V0PA 5L6VA 4HO9A 2VS3A 4FRAA 5CQLX 3V0MA 1HM0A 2E3DA 3LW6A 4AYJA 2ZU9A 1MP3A 3I0IX 5CQNX 1R7VA 1VZTA 3ZGFA 4Y9XA 4HO3A 4EEGA 2VK9A 4HOCA 1G0RA 2OI7A 5FYEA 2QKXA 4FRBA 5IDTA 4IRQA 1NKHB 3E26A 3I0DA 1LZIA 4EEMA 3R3IA 1Z90A 3BRKX 3SX7A 1V83A 2BO8A 4UEGA 1ZCYA 1HJJA 3V0OA 1YP4A 1IINA 1TZFA 2APCA 4LW6A 5C3DA 2WVLA 4EEOA 3ST8A 3JUKA 5AJOA 3U2WA 1H7EA 1H4DA 1MP5A 3KIAA 3SXDA 5C3AA 2Y4LA 2ZU8A 1EYRA 1JVDA 1H4CA 5IDSA 4XWIA 4Y7VA 3D8VA 5CMHA 3U2UA 3ZLLA 1R82A 2Y6PA 1W57A 4Y7TA 1H7TA 2I5EA 4AAWA 1TW1A 2I5KA 1FXOA 2VFZA 1ZCUA 1VGTA 2FY7A 2RJ1A 3CKNA 3SPTA 1O7OA 2WGZA 2FFVA 5C47A 2Y4KA 2UX8A 3RMVA 2D7RA 5C4BA 1NMMB 3K8EA 1S4OA 4M28A 3V91A 2FFUA 4E1KA 1VPAA 4D0TA 1QGSA 4D48A 1ZI1A 2RITA 2OI5A 4BMAA 3T7NA 3OH0A 1H5SD 1ON8A 3OH3A 4YS8A 1FR8A 4KNRA 1S4NA 1LVWA 4M4KA 4ZDQA 5C4DA 3USRA 2AM5A 1W77A 2ICXA 1LZ7A 3Q7UA 4B3UA 2VS5A 5FU8A 2A8UA 1FO9A 1ON6A 4G3SA 1VM8A 2Y4JA 2V0JA 2VD4A 3RSBA 3BCVA 4Y6UA 2YESA 1G8OA 1QGQA 3CKQA 1YP2A 1R80A 4O6MA 4JD0A 2MZBA 2PX7A 1S4PA 2AM3A 3OAMA 4KC4A 1FWYA 1G23A 3I0KA 5CMIA 4M2AA 1XHBA 3I0JA 5L6SA 5FTSA 4B5BA 5FTVA 2AE7A 2RIZA 3T7MA 1WT1A 2O1HA 3USQA 4IRPA 2RJ0A 4HO6A 3V0LA 2YC3A 2RJ5A 1GWWA 1H4EA 2A8WA 2JCJA 1FR9A 1GX0A 2D0JA 4KQLA 3OH4A 4HO0A 3V0NA 1R7UA 4FCUA 4LW3A 4NAIA 2ICYA 2P6WA 1FRWA 2XWNA 2Y4MA 2J0AA 2YQSA 5CMFX 2RIXA 2FYAA 1GX4A 5C1LA 2FYDB 5C48A 2X5ZA 1VGUA 4B42A 3K8DA 5C36A 1FO8A 1OMZA 2JCOA 4MNDA 5CQOA 4D0ZA 4ECMA 2XWLA 2VSIA 1HM8A 3SXAA 5C49A 4FCEA 1H5RB 3OC9A 1O7QA 2WAWA 4HO2A 4Y7UA 4FRLA 2AH9A 3POLA 5BXCA 4B4GA 3TZTA 1INJA 4D11C 5D92A 4EEAA 4Y7GA 4HO5A 2RIYA 4O6NA 2BO4A 4EE3A 3QVBA 5I1FA 5EJZA 4B4MA 3CKOA 4BQHA 1O23B 2WEEA 1V84A 2Q4JA 4G87A 1JV3A 4KPZA 4Q7CA
chains in the Genus database with same CATH topology
5HS2A 3OH2A 4KRVA 1LZJA 1H7QA 2X5SA 4NANA 3R2WA 1PZTA 1GQCA 1VICA 5CQMX 5DDVA 1FZWA 2Z86A 3E25A 1GQ9A 1H5TA 2O1GA 2AM4A 1VH1A 4ASYA 1OMXA 1R7YA 1VH3A 4FRMA 1WT2A 2FYCB 3ZLKA 4KNXA 1I52A 1TVYA 2JCKA 2D7IA 3PKPA 1G95A 2YQCA 1NQIB 2JCLA 1E5KA 3Q4SA 3D98A 4EE5A 2YQJA 1ZHJA 5EIYA 4C2SA 3Q80A 4KPXA 3V8YA 4AYLA 5FV9A 3TQDA 4Y62A 1SS9A 3CKJA 2WVMA 3ZGGA 2GGOA 4CVHA 1H5SB 1H5SC 1YROB 3PNNA 1VZXA 1INIA 2GGQA 3CKVA 4Y63A 3U2XA 2X65A 4G3QA 1FGXA 1ZJ1A 2V0HA 1JVGA 4HO4A 1PZYB 1G3LA 2PGVA 2C0NA 1HV9A 1OQMB 3D5NA 5C4EA 4FROA 3I0HA 1FOAA 1V82A 1KWSA 2OEGA 3RMWA 5C4CA 1HM9A 3OH1A 2P73A 3SX8A 1ZCVA 3JUJA 5EJ1A 3V0QA 2BO7A 1ZI3A 1WVCA 4CJ8A 1G9RA 5IFYA 3OKRA 2DPWA 4FIYA 1ZIZA 4MYBA 5D91A 2VS4A 4CJBA 3PKQA 1GWVA 1G1LA 4L41C 5FUHA 2V0LA 4D11A 1ZDGA 1HJLA 3NGWA 1LZ0A 5C1HA 1YP3A 2QGIA 3EE5A 3U0XA 2O1FA 1ZJOA 3HL3A 1IIMA 3OGZA 5CQPA 3O3PA 3T7OA 4DDZA 4HCQA 5C3BA 2VXLA 1H7LA 3CGXA 4MIXA 4Y7FA 5C1GA 4FREA 2OI6A 2PA4A 2PGYA 1LL2A 2X60A 3V90A 2V0KA 1H7FA 2RJ9A 3U2VA 2VXMA 2YCMA 4AC3A 5AJNA 2Y7AA 3F1CA 1H7GA 4FRQA 4J18A 4G3PA 1H5SA 1WT0A 1LL3A 2WVKA 2YQHA 5J49A 1NF5B 1ZJPA 4FRDA 4P02A 1XZ6A 3I0LA 1LL0A 2V0IA 4FQWA 4B4BA 1H7HA 5C4FA 1NHEB 4EE4A 4K6RA 2RJ6A 4GBPA 1VZUA 3IOHA 2AESA 1MC3A 2E8BA 4B2WA 3GUEA 2YC5A 2P72A 4Y64A 1H3MA 3FWWA 5AJPA 5C38A 4EVWA 1ZJ3A 4JISA 4Y6NA 3ZF8A 2XWMA 4KT7A 4R7PA 4DECA 2RJ8A 4M2BA 1ZI4A 1ZCTA 1ZJ2A 1VGWA 3DUVA 1FGGA 5CMGX 3SXGA 1G93A 5CMJA 1R81A 3IOIA 1G2VA 1TW5A 1WT3A 1K4VA 2I7BA 1QWJA 1G97A 3I0FA 4FIXA 3SX3A 1QG8A 2W0WA 3U2TA 4ASJA 1O0RA 1R7TA 1FG5N 1FXJA 3I0GA 1JV1A 2QH5A 4HO8A 4ARWA 1EZIA 5DDTA 2NXVA 3N9WA 2BO6A 3F1YA 4NAKA 2W0VA 4FRPA 3I0EA 1MP4A 2XMEA 4KC1A 4DE7A 2RJ4A 3SXBA 1NWGB 3I0CA 1GA8A 1ZJ0A 4KXOA 4CJCA 3FOQA 5C8RA 4KC2A 1WSZA 1R7XA 2AECA 2FYBA 2ZU7A 2OEFA 2WE9A 1H5RA 1VGZA 2CU2A 3CU0A 2XMHA 2RJ7A 3DJ4A 3JTJA 1JYKA 4B2XA 2VSHA 1W55A 1H5TB 5FU0A 3SX5A 3SXCA 2J0BA 3V8ZA 2Z87A 3U0YA 4NALA 3IOJA 5JQQA 4FRHA 4P00A 2AGDA 1ZDFA 4HG6A 3SXEA 1JYLA 3DK5A 1ZI5A 3V0PA 5L6VA 4HO9A 2VS3A 4FRAA 5CQLX 3V0MA 1HM0A 2E3DA 3LW6A 4AYJA 2ZU9A 1MP3A 3I0IX 5CQNX 1R7VA 1VZTA 3ZGFA 4Y9XA 4HO3A 4EEGA 2VK9A 4HOCA 1G0RA 2OI7A 5FYEA 2QKXA 4FRBA 5IDTA 4IRQA 1NKHB 3E26A 3I0DA 1LZIA 4EEMA 3R3IA 1Z90A 3BRKX 3SX7A 1V83A 2BO8A 4UEGA 1ZCYA 1HJJA 3V0OA 1YP4A 1IINA 1TZFA 2APCA 4LW6A 5C3DA 2WVLA 4EEOA 3ST8A 3JUKA 5AJOA 3U2WA 1H7EA 1H4DA 1MP5A 3KIAA 3SXDA 5C3AA 2Y4LA 2ZU8A 1EYRA 1JVDA 1H4CA 5IDSA 4XWIA 4Y7VA 3D8VA 5CMHA 3U2UA 3ZLLA 1R82A 2Y6PA 1W57A 4Y7TA 1H7TA 2I5EA 4AAWA 1TW1A 2I5KA 1FXOA 2VFZA 1ZCUA 1VGTA 2FY7A 2RJ1A 3CKNA 3SPTA 1O7OA 2WGZA 2FFVA 5C47A 2Y4KA 2UX8A 3RMVA 2D7RA 5C4BA 1NMMB 3K8EA 1S4OA 4M28A 3V91A 2FFUA 4E1KA 1VPAA 4D0TA 1QGSA 4D48A 1ZI1A 2RITA 2OI5A 4BMAA 3T7NA 3OH0A 1H5SD 1ON8A 3OH3A 4YS8A 1FR8A 4KNRA 1S4NA 1LVWA 4M4KA 4ZDQA 5C4DA 3USRA 2AM5A 1W77A 2ICXA 1LZ7A 3Q7UA 4B3UA 2VS5A 5FU8A 2A8UA 1FO9A 1ON6A 4G3SA 1VM8A 2Y4JA 2V0JA 2VD4A 3RSBA 3BCVA 4Y6UA 2YESA 1G8OA 1QGQA 3CKQA 1YP2A 1R80A 4O6MA 4JD0A 2MZBA 2PX7A 1S4PA 2AM3A 3OAMA 4KC4A 1FWYA 1G23A 3I0KA 5CMIA 4M2AA 1XHBA 3I0JA 5L6SA 5FTSA 4B5BA 5FTVA 2AE7A 2RIZA 3T7MA 1WT1A 2O1HA 3USQA 4IRPA 2RJ0A 4HO6A 3V0LA 2YC3A 2RJ5A 1GWWA 1H4EA 2A8WA 2JCJA 1FR9A 1GX0A 2D0JA 4KQLA 3OH4A 4HO0A 3V0NA 1R7UA 4FCUA 4LW3A 4NAIA 2ICYA 2P6WA 1FRWA 2XWNA 2Y4MA 2J0AA 2YQSA 5CMFX 2RIXA 2FYAA 1GX4A 5C1LA 2FYDB 5C48A 2X5ZA 1VGUA 4B42A 3K8DA 5C36A 1FO8A 1OMZA 2JCOA 4MNDA 5CQOA 4D0ZA 4ECMA 2XWLA 2VSIA 1HM8A 3SXAA 5C49A 4FCEA 1H5RB 3OC9A 1O7QA 2WAWA 4HO2A 4Y7UA 4FRLA 2AH9A 3POLA 5BXCA 4B4GA 3TZTA 1INJA 4D11C 5D92A 4EEAA 4Y7GA 4HO5A 2RIYA 4O6NA 2BO4A 4EE3A 3QVBA 5I1FA 5EJZA 4B4MA 3CKOA 4BQHA 1O23B 2WEEA 1V84A 2Q4JA 4G87A 1JV3A 4KPZA 4Q7CA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5HS2 A;  3OH2 A;  4KRV A;  1LZJ A;  1H7Q A;  2X5S A;  4NAN A;  3R2W A;  1PZT A;  1GQC A;  1VIC A;  5CQM X;  5DDV A;  1FZW A;  2Z86 A;  3E25 A;  1GQ9 A;  1H5T A;  2O1G A;  2AM4 A;  1VH1 A;  4ASY A;  1OMX A;  1R7Y A;  1VH3 A;  4FRM A;  1WT2 A;  2FYC B;  3ZLK A;  4KNX A;  1I52 A;  1TVY A;  2JCK A;  2D7I A;  3PKP A;  1G95 A;  2YQC A;  1NQI B;  2JCL A;  1E5K A;  3Q4S A;  3D98 A;  4EE5 A;  2YQJ A;  1ZHJ A;  5EIY A;  4C2S A;  3Q80 A;  4KPX A;  3V8Y A;  4AYL A;  5FV9 A;  3TQD A;  4Y62 A;  1SS9 A;  3CKJ A;  2WVM A;  3ZGG A;  2GGO A;  4CVH A;  1H5S B;  1H5S C;  1YRO B;  3PNN A;  1VZX A;  1INI A;  2GGQ A;  3CKV A;  4Y63 A;  3U2X A;  2X65 A;  4G3Q A;  1FGX A;  1ZJ1 A;  2V0H A;  1JVG A;  4HO4 A;  1PZY B;  1G3L A;  2PGV A;  1HV9 A;  1OQM B;  3D5N A;  5C4E A;  4FRO A;  3I0H A;  1FOA A;  1V82 A;  1KWS A;  2OEG A;  3RMW A;  5C4C A;  1HM9 A;  3OH1 A;  2P73 A;  3SX8 A;  1ZCV A;  3JUJ A;  5EJ1 A;  3V0Q A;  2BO7 A;  1ZI3 A;  1WVC A;  4CJ8 A;  1G9R A;  5IFY A;  3OKR A;  2DPW A;  1ZIZ A;  4MYB A;  2VS4 A;  4CJB A;  3PKQ A;  1GWV A;  1G1L A;  4L41 C;  5FUH A;  2V0L A;  4D11 A;  1ZDG A;  1HJL A;  3NGW A;  1LZ0 A;  5C1H A;  1YP3 A;  2QGI A;  3EE5 A;  3U0X A;  2O1F A;  1ZJO A;  3HL3 A;  1IIM A;  3OGZ A;  5CQP A;  3O3P A;  3T7O A;  4DDZ A;  4HCQ A;  5C3B A;  2VXL A;  1H7L A;  3CGX A;  4Y7F A;  5C1G A;  4FRE A;  2OI6 A;  2PA4 A;  2PGY A;  1LL2 A;  2X60 A;  3V90 A;  2V0K A;  1H7F A;  2RJ9 A;  3U2V A;  2VXM A;  2YCM A;  4AC3 A;  5AJN A;  2Y7A A;  3F1C A;  1H7G A;  4FRQ A;  4J18 A;  4G3P A;  1H5S A;  1WT0 A;  1LL3 A;  2WVK A;  2YQH A;  5J49 A;  1NF5 B;  1ZJP A;  4FRD A;  4P02 A;  1XZ6 A;  3I0L A;  1LL0 A;  2V0I A;  4FQW A;  4B4B A;  1H7H A;  5C4F A;  1NHE B;  4EE4 A;  4K6R A;  2RJ6 A;  4GBP A;  1VZU A;  3IOH A;  2AES A;  1MC3 A;  2E8B A;  4B2W A;  3GUE A;  2YC5 A;  2P72 A;  4Y64 A;  1H3M A;  3FWW A;  5AJP A;  5C38 A;  4EVW A;  1ZJ3 A;  4JIS A;  4Y6N A;  3ZF8 A;  2XWM A;  4KT7 A;  4R7P A;  4DEC A;  2RJ8 A;  4M2B A;  1ZI4 A;  1ZCT A;  1ZJ2 A;  1VGW A;  3DUV A;  1FGG A;  5CMG X;  3SXG A;  1G93 A;  5CMJ A;  1R81 A;  3IOI A;  1G2V A;  1TW5 A;  1WT3 A;  1K4V A;  2I7B A;  1QWJ A;  1G97 A;  3I0F A;  3SX3 A;  1QG8 A;  2W0W A;  3U2T A;  4ASJ A;  1O0R A;  1R7T A;  1FG5 N;  1FXJ A;  3I0G A;  1JV1 A;  2QH5 A;  4HO8 A;  4ARW A;  1EZI A;  5DDT A;  2NXV A;  3N9W A;  2BO6 A;  3F1Y A;  4NAK A;  2W0V A;  4FRP A;  3I0E A;  1MP4 A;  2XME A;  4KC1 A;  4DE7 A;  2RJ4 A;  3SXB A;  1NWG B;  3I0C A;  1GA8 A;  1ZJ0 A;  4KXO A;  4CJC A;  3FOQ A;  5C8R A;  4KC2 A;  1WSZ A;  1R7X A;  2AEC A;  2FYB A;  2ZU7 A;  2OEF A;  2WE9 A;  1H5R A;  1VGZ A;  2CU2 A;  3CU0 A;  2XMH A;  2RJ7 A;  3DJ4 A;  3JTJ A;  1JYK A;  4B2X A;  2VSH A;  1W55 A;  1H5T B;  5FU0 A;  3SX5 A;  3SXC A;  3V8Z A;  2Z87 A;  3U0Y A;  4NAL A;  3IOJ A;  5JQQ A;  4FRH A;  4P00 A;  2AGD A;  1ZDF A;  4HG6 A;  3SXE A;  1JYL A;  3DK5 A;  1ZI5 A;  3V0P A;  5L6V A;  4HO9 A;  2VS3 A;  4FRA A;  5CQL X;  3V0M A;  1HM0 A;  2E3D A;  3LW6 A;  4AYJ A;  2ZU9 A;  1MP3 A;  3I0I X;  5CQN X;  1R7V A;  1VZT A;  3ZGF A;  4Y9X A;  4HO3 A;  4EEG A;  4HOC A;  1G0R A;  2OI7 A;  5FYE A;  2QKX A;  4FRB A;  5IDT A;  4IRQ A;  1NKH B;  3E26 A;  3I0D A;  1LZI A;  4EEM A;  3R3I A;  1Z90 A;  3BRK X;  3SX7 A;  1V83 A;  2BO8 A;  4UEG A;  1ZCY A;  1HJJ A;  3V0O A;  1YP4 A;  1IIN A;  1TZF A;  2APC A;  4LW6 A;  5C3D A;  2WVL A;  4EEO A;  3ST8 A;  3JUK A;  5AJO A;  3U2W A;  1H7E A;  1H4D A;  1MP5 A;  3KIA A;  3SXD A;  5C3A A;  2Y4L A;  2ZU8 A;  1EYR A;  1JVD A;  1H4C A;  5IDS A;  4XWI A;  4Y7V A;  3D8V A;  5CMH A;  3U2U A;  3ZLL A;  1R82 A;  2Y6P A;  1W57 A;  4Y7T A;  1H7T A;  2I5E A;  4AAW A;  1TW1 A;  2I5K A;  1FXO A;  2VFZ A;  1ZCU A;  1VGT A;  2FY7 A;  2RJ1 A;  3CKN A;  3SPT A;  1O7O A;  2WGZ A;  2FFV A;  5C47 A;  2Y4K A;  2UX8 A;  3RMV A;  2D7R A;  5C4B A;  1NMM B;  3K8E A;  1S4O A;  4M28 A;  3V91 A;  2FFU A;  4E1K A;  1VPA A;  4D0T A;  1QGS A;  4D48 A;  1ZI1 A;  2RIT A;  2OI5 A;  4BMA A;  3T7N A;  3OH0 A;  1H5S D;  1ON8 A;  3OH3 A;  4YS8 A;  1FR8 A;  4KNR A;  1S4N A;  1LVW A;  4M4K A;  4ZDQ A;  5C4D A;  3USR A;  2AM5 A;  1W77 A;  2ICX A;  1LZ7 A;  3Q7U A;  4B3U A;  2VS5 A;  5FU8 A;  2A8U A;  1FO9 A;  1ON6 A;  4G3S A;  1VM8 A;  2Y4J A;  2V0J A;  2VD4 A;  3RSB A;  3BCV A;  4Y6U A;  2YES A;  1G8O A;  1QGQ A;  3CKQ A;  1YP2 A;  1R80 A;  4JD0 A;  2MZB A;  2PX7 A;  1S4P A;  2AM3 A;  3OAM A;  4KC4 A;  1FWY A;  1G23 A;  3I0K A;  5CMI A;  4M2A A;  1XHB A;  3I0J A;  5L6S A;  5FTS A;  4B5B A;  5FTV A;  2AE7 A;  2RIZ A;  3T7M A;  1WT1 A;  2O1H A;  3USQ A;  4IRP A;  2RJ0 A;  4HO6 A;  3V0L A;  2YC3 A;  2RJ5 A;  1GWW A;  1H4E A;  2A8W A;  2JCJ A;  1FR9 A;  1GX0 A;  2D0J A;  4KQL A;  3OH4 A;  4HO0 A;  3V0N A;  1R7U A;  4FCU A;  4LW3 A;  4NAI A;  2ICY A;  2P6W A;  1FRW A;  2XWN A;  2Y4M A;  2YQS A;  5CMF X;  2RIX A;  2FYA A;  1GX4 A;  5C1L A;  2FYD B;  5C48 A;  2X5Z A;  1VGU A;  4B42 A;  3K8D A;  5C36 A;  1FO8 A;  1OMZ A;  2JCO A;  4MND A;  5CQO A;  4D0Z A;  4ECM A;  2XWL A;  2VSI A;  1HM8 A;  3SXA A;  5C49 A;  4FCE A;  1H5R B;  3OC9 A;  1O7Q A;  2WAW A;  4HO2 A;  4Y7U A;  4FRL A;  2AH9 A;  3POL A;  5BXC A;  4B4G A;  3TZT A;  1INJ A;  4D11 C;  4EEA A;  4Y7G A;  4HO5 A;  2RIY A;  2BO4 A;  4EE3 A;  3QVB A;  5I1F A;  5EJZ A;  4B4M A;  3CKO A;  4BQH A;  1O23 B;  2WEE A;  1V84 A;  2Q4J A;  4G87 A;  1JV3 A;  4KPZ A; 
#chains in the Genus database with same CATH topology
 5HS2 A;  3OH2 A;  4KRV A;  1LZJ A;  1H7Q A;  2X5S A;  4NAN A;  3R2W A;  1PZT A;  1GQC A;  1VIC A;  5CQM X;  5DDV A;  1FZW A;  2Z86 A;  3E25 A;  1GQ9 A;  1H5T A;  2O1G A;  2AM4 A;  1VH1 A;  4ASY A;  1OMX A;  1R7Y A;  1VH3 A;  4FRM A;  1WT2 A;  2FYC B;  3ZLK A;  4KNX A;  1I52 A;  1TVY A;  2JCK A;  2D7I A;  3PKP A;  1G95 A;  2YQC A;  1NQI B;  2JCL A;  1E5K A;  3Q4S A;  3D98 A;  4EE5 A;  2YQJ A;  1ZHJ A;  5EIY A;  4C2S A;  3Q80 A;  4KPX A;  3V8Y A;  4AYL A;  5FV9 A;  3TQD A;  4Y62 A;  1SS9 A;  3CKJ A;  2WVM A;  3ZGG A;  2GGO A;  4CVH A;  1H5S B;  1H5S C;  1YRO B;  3PNN A;  1VZX A;  1INI A;  2GGQ A;  3CKV A;  4Y63 A;  3U2X A;  2X65 A;  4G3Q A;  1FGX A;  1ZJ1 A;  2V0H A;  1JVG A;  4HO4 A;  1PZY B;  1G3L A;  2PGV A;  2C0N A;  1HV9 A;  1OQM B;  3D5N A;  5C4E A;  4FRO A;  3I0H A;  1FOA A;  1V82 A;  1KWS A;  2OEG A;  3RMW A;  5C4C A;  1HM9 A;  3OH1 A;  2P73 A;  3SX8 A;  1ZCV A;  3JUJ A;  5EJ1 A;  3V0Q A;  2BO7 A;  1ZI3 A;  1WVC A;  4CJ8 A;  1G9R A;  5IFY A;  3OKR A;  2DPW A;  4FIY A;  1ZIZ A;  4MYB A;  5D91 A;  2VS4 A;  4CJB A;  3PKQ A;  1GWV A;  1G1L A;  4L41 C;  5FUH A;  2V0L A;  4D11 A;  1ZDG A;  1HJL A;  3NGW A;  1LZ0 A;  5C1H A;  1YP3 A;  2QGI A;  3EE5 A;  3U0X A;  2O1F A;  1ZJO A;  3HL3 A;  1IIM A;  3OGZ A;  5CQP A;  3O3P A;  3T7O A;  4DDZ A;  4HCQ A;  5C3B A;  2VXL A;  1H7L A;  3CGX A;  4MIX A;  4Y7F A;  5C1G A;  4FRE A;  2OI6 A;  2PA4 A;  2PGY A;  1LL2 A;  2X60 A;  3V90 A;  2V0K A;  1H7F A;  2RJ9 A;  3U2V A;  2VXM A;  2YCM A;  4AC3 A;  5AJN A;  2Y7A A;  3F1C A;  1H7G A;  4FRQ A;  4J18 A;  4G3P A;  1H5S A;  1WT0 A;  1LL3 A;  2WVK A;  2YQH A;  5J49 A;  1NF5 B;  1ZJP A;  4FRD A;  4P02 A;  1XZ6 A;  3I0L A;  1LL0 A;  2V0I A;  4FQW A;  4B4B A;  1H7H A;  5C4F A;  1NHE B;  4EE4 A;  4K6R A;  2RJ6 A;  4GBP A;  1VZU A;  3IOH A;  2AES A;  1MC3 A;  2E8B A;  4B2W A;  3GUE A;  2YC5 A;  2P72 A;  4Y64 A;  1H3M A;  3FWW A;  5AJP A;  5C38 A;  4EVW A;  1ZJ3 A;  4JIS A;  4Y6N A;  3ZF8 A;  2XWM A;  4KT7 A;  4R7P A;  4DEC A;  2RJ8 A;  4M2B A;  1ZI4 A;  1ZCT A;  1ZJ2 A;  1VGW A;  3DUV A;  1FGG A;  5CMG X;  3SXG A;  1G93 A;  5CMJ A;  1R81 A;  3IOI A;  1G2V A;  1TW5 A;  1WT3 A;  1K4V A;  2I7B A;  1QWJ A;  1G97 A;  3I0F A;  4FIX A;  3SX3 A;  1QG8 A;  2W0W A;  3U2T A;  4ASJ A;  1O0R A;  1R7T A;  1FG5 N;  1FXJ A;  3I0G A;  1JV1 A;  2QH5 A;  4HO8 A;  4ARW A;  1EZI A;  5DDT A;  2NXV A;  3N9W A;  2BO6 A;  3F1Y A;  4NAK A;  2W0V A;  4FRP A;  3I0E A;  1MP4 A;  2XME A;  4KC1 A;  4DE7 A;  2RJ4 A;  3SXB A;  1NWG B;  3I0C A;  1GA8 A;  1ZJ0 A;  4KXO A;  4CJC A;  3FOQ A;  5C8R A;  4KC2 A;  1WSZ A;  1R7X A;  2AEC A;  2FYB A;  2ZU7 A;  2OEF A;  2WE9 A;  1H5R A;  1VGZ A;  2CU2 A;  3CU0 A;  2XMH A;  2RJ7 A;  3DJ4 A;  3JTJ A;  1JYK A;  4B2X A;  2VSH A;  1W55 A;  1H5T B;  5FU0 A;  3SX5 A;  3SXC A;  2J0B A;  3V8Z A;  2Z87 A;  3U0Y A;  4NAL A;  3IOJ A;  5JQQ A;  4FRH A;  4P00 A;  2AGD A;  1ZDF A;  4HG6 A;  3SXE A;  1JYL A;  3DK5 A;  1ZI5 A;  3V0P A;  5L6V A;  4HO9 A;  2VS3 A;  4FRA A;  5CQL X;  3V0M A;  1HM0 A;  2E3D A;  3LW6 A;  4AYJ A;  2ZU9 A;  1MP3 A;  3I0I X;  5CQN X;  1R7V A;  1VZT A;  3ZGF A;  4Y9X A;  4HO3 A;  4EEG A;  2VK9 A;  4HOC A;  1G0R A;  2OI7 A;  5FYE A;  2QKX A;  4FRB A;  5IDT A;  4IRQ A;  1NKH B;  3E26 A;  3I0D A;  1LZI A;  4EEM A;  3R3I A;  1Z90 A;  3BRK X;  3SX7 A;  1V83 A;  2BO8 A;  4UEG A;  1ZCY A;  1HJJ A;  3V0O A;  1YP4 A;  1IIN A;  1TZF A;  2APC A;  4LW6 A;  5C3D A;  2WVL A;  4EEO A;  3ST8 A;  3JUK A;  5AJO A;  3U2W A;  1H7E A;  1H4D A;  1MP5 A;  3KIA A;  3SXD A;  5C3A A;  2Y4L A;  2ZU8 A;  1EYR A;  1JVD A;  1H4C A;  5IDS A;  4XWI A;  4Y7V A;  3D8V A;  5CMH A;  3U2U A;  3ZLL A;  1R82 A;  2Y6P A;  1W57 A;  4Y7T A;  1H7T A;  2I5E A;  4AAW A;  1TW1 A;  2I5K A;  1FXO A;  2VFZ A;  1ZCU A;  1VGT A;  2FY7 A;  2RJ1 A;  3CKN A;  3SPT A;  1O7O A;  2WGZ A;  2FFV A;  5C47 A;  2Y4K A;  2UX8 A;  3RMV A;  2D7R A;  5C4B A;  1NMM B;  3K8E A;  1S4O A;  4M28 A;  3V91 A;  2FFU A;  4E1K A;  1VPA A;  4D0T A;  1QGS A;  4D48 A;  1ZI1 A;  2RIT A;  2OI5 A;  4BMA A;  3T7N A;  3OH0 A;  1H5S D;  1ON8 A;  3OH3 A;  4YS8 A;  1FR8 A;  4KNR A;  1S4N A;  1LVW A;  4M4K A;  4ZDQ A;  5C4D A;  3USR A;  2AM5 A;  1W77 A;  2ICX A;  1LZ7 A;  3Q7U A;  4B3U A;  2VS5 A;  5FU8 A;  2A8U A;  1FO9 A;  1ON6 A;  4G3S A;  1VM8 A;  2Y4J A;  2V0J A;  2VD4 A;  3RSB A;  3BCV A;  4Y6U A;  2YES A;  1G8O A;  1QGQ A;  3CKQ A;  1YP2 A;  1R80 A;  4O6M A;  4JD0 A;  2MZB A;  2PX7 A;  1S4P A;  2AM3 A;  3OAM A;  4KC4 A;  1FWY A;  1G23 A;  3I0K A;  5CMI A;  4M2A A;  1XHB A;  3I0J A;  5L6S A;  5FTS A;  4B5B A;  5FTV A;  2AE7 A;  2RIZ A;  3T7M A;  1WT1 A;  2O1H A;  3USQ A;  4IRP A;  2RJ0 A;  4HO6 A;  3V0L A;  2YC3 A;  2RJ5 A;  1GWW A;  1H4E A;  2A8W A;  2JCJ A;  1FR9 A;  1GX0 A;  2D0J A;  4KQL A;  3OH4 A;  4HO0 A;  3V0N A;  1R7U A;  4FCU A;  4LW3 A;  4NAI A;  2ICY A;  2P6W A;  1FRW A;  2XWN A;  2Y4M A;  2J0A A;  2YQS A;  5CMF X;  2RIX A;  2FYA A;  1GX4 A;  5C1L A;  2FYD B;  5C48 A;  2X5Z A;  1VGU A;  4B42 A;  3K8D A;  5C36 A;  1FO8 A;  1OMZ A;  2JCO A;  4MND A;  5CQO A;  4D0Z A;  4ECM A;  2XWL A;  2VSI A;  1HM8 A;  3SXA A;  5C49 A;  4FCE A;  1H5R B;  3OC9 A;  1O7Q A;  2WAW A;  4HO2 A;  4Y7U A;  4FRL A;  2AH9 A;  3POL A;  5BXC A;  4B4G A;  3TZT A;  1INJ A;  4D11 C;  5D92 A;  4EEA A;  4Y7G A;  4HO5 A;  2RIY A;  4O6N A;  2BO4 A;  4EE3 A;  3QVB A;  5I1F A;  5EJZ A;  4B4M A;  3CKO A;  4BQH A;  1O23 B;  2WEE A;  1V84 A;  2Q4J A;  4G87 A;  1JV3 A;  4KPZ A;  4Q7C A; 
#chains in the Genus database with same CATH homology
 5HS2 A;  3OH2 A;  4KRV A;  1LZJ A;  1H7Q A;  2X5S A;  4NAN A;  3R2W A;  1PZT A;  1GQC A;  1VIC A;  5CQM X;  5DDV A;  1FZW A;  2Z86 A;  3E25 A;  1GQ9 A;  1H5T A;  2O1G A;  2AM4 A;  1VH1 A;  4ASY A;  1OMX A;  1R7Y A;  1VH3 A;  4FRM A;  1WT2 A;  2FYC B;  3ZLK A;  4KNX A;  1I52 A;  1TVY A;  2JCK A;  2D7I A;  3PKP A;  1G95 A;  2YQC A;  1NQI B;  2JCL A;  1E5K A;  3Q4S A;  3D98 A;  4EE5 A;  2YQJ A;  1ZHJ A;  5EIY A;  4C2S A;  3Q80 A;  4KPX A;  3V8Y A;  4AYL A;  5FV9 A;  3TQD A;  4Y62 A;  1SS9 A;  3CKJ A;  2WVM A;  3ZGG A;  2GGO A;  4CVH A;  1H5S B;  1H5S C;  1YRO B;  3PNN A;  1VZX A;  1INI A;  2GGQ A;  3CKV A;  4Y63 A;  3U2X A;  2X65 A;  4G3Q A;  1FGX A;  1ZJ1 A;  2V0H A;  1JVG A;  4HO4 A;  1PZY B;  1G3L A;  2PGV A;  2C0N A;  1HV9 A;  1OQM B;  3D5N A;  5C4E A;  4FRO A;  3I0H A;  1FOA A;  1V82 A;  1KWS A;  2OEG A;  3RMW A;  5C4C A;  1HM9 A;  3OH1 A;  2P73 A;  3SX8 A;  1ZCV A;  3JUJ A;  5EJ1 A;  3V0Q A;  2BO7 A;  1ZI3 A;  1WVC A;  4CJ8 A;  1G9R A;  5IFY A;  3OKR A;  2DPW A;  4FIY A;  1ZIZ A;  4MYB A;  5D91 A;  2VS4 A;  4CJB A;  3PKQ A;  1GWV A;  1G1L A;  4L41 C;  5FUH A;  2V0L A;  4D11 A;  1ZDG A;  1HJL A;  3NGW A;  1LZ0 A;  5C1H A;  1YP3 A;  2QGI A;  3EE5 A;  3U0X A;  2O1F A;  1ZJO A;  3HL3 A;  1IIM A;  3OGZ A;  5CQP A;  3O3P A;  3T7O A;  4DDZ A;  4HCQ A;  5C3B A;  2VXL A;  1H7L A;  3CGX A;  4MIX A;  4Y7F A;  5C1G A;  4FRE A;  2OI6 A;  2PA4 A;  2PGY A;  1LL2 A;  2X60 A;  3V90 A;  2V0K A;  1H7F A;  2RJ9 A;  3U2V A;  2VXM A;  2YCM A;  4AC3 A;  5AJN A;  2Y7A A;  3F1C A;  1H7G A;  4FRQ A;  4J18 A;  4G3P A;  1H5S A;  1WT0 A;  1LL3 A;  2WVK A;  2YQH A;  5J49 A;  1NF5 B;  1ZJP A;  4FRD A;  4P02 A;  1XZ6 A;  3I0L A;  1LL0 A;  2V0I A;  4FQW A;  4B4B A;  1H7H A;  5C4F A;  1NHE B;  4EE4 A;  4K6R A;  2RJ6 A;  4GBP A;  1VZU A;  3IOH A;  2AES A;  1MC3 A;  2E8B A;  4B2W A;  3GUE A;  2YC5 A;  2P72 A;  4Y64 A;  1H3M A;  3FWW A;  5AJP A;  5C38 A;  4EVW A;  1ZJ3 A;  4JIS A;  4Y6N A;  3ZF8 A;  2XWM A;  4KT7 A;  4R7P A;  4DEC A;  2RJ8 A;  4M2B A;  1ZI4 A;  1ZCT A;  1ZJ2 A;  1VGW A;  3DUV A;  1FGG A;  5CMG X;  3SXG A;  1G93 A;  5CMJ A;  1R81 A;  3IOI A;  1G2V A;  1TW5 A;  1WT3 A;  1K4V A;  2I7B A;  1QWJ A;  1G97 A;  3I0F A;  4FIX A;  3SX3 A;  1QG8 A;  2W0W A;  3U2T A;  4ASJ A;  1O0R A;  1R7T A;  1FG5 N;  1FXJ A;  3I0G A;  1JV1 A;  2QH5 A;  4HO8 A;  4ARW A;  1EZI A;  5DDT A;  2NXV A;  3N9W A;  2BO6 A;  3F1Y A;  4NAK A;  2W0V A;  4FRP A;  3I0E A;  1MP4 A;  2XME A;  4KC1 A;  4DE7 A;  2RJ4 A;  3SXB A;  1NWG B;  3I0C A;  1GA8 A;  1ZJ0 A;  4KXO A;  4CJC A;  3FOQ A;  5C8R A;  4KC2 A;  1WSZ A;  1R7X A;  2AEC A;  2FYB A;  2ZU7 A;  2OEF A;  2WE9 A;  1H5R A;  1VGZ A;  2CU2 A;  3CU0 A;  2XMH A;  2RJ7 A;  3DJ4 A;  3JTJ A;  1JYK A;  4B2X A;  2VSH A;  1W55 A;  1H5T B;  5FU0 A;  3SX5 A;  3SXC A;  2J0B A;  3V8Z A;  2Z87 A;  3U0Y A;  4NAL A;  3IOJ A;  5JQQ A;  4FRH A;  4P00 A;  2AGD A;  1ZDF A;  4HG6 A;  3SXE A;  1JYL A;  3DK5 A;  1ZI5 A;  3V0P A;  5L6V A;  4HO9 A;  2VS3 A;  4FRA A;  5CQL X;  3V0M A;  1HM0 A;  2E3D A;  3LW6 A;  4AYJ A;  2ZU9 A;  1MP3 A;  3I0I X;  5CQN X;  1R7V A;  1VZT A;  3ZGF A;  4Y9X A;  4HO3 A;  4EEG A;  2VK9 A;  4HOC A;  1G0R A;  2OI7 A;  5FYE A;  2QKX A;  4FRB A;  5IDT A;  4IRQ A;  1NKH B;  3E26 A;  3I0D A;  1LZI A;  4EEM A;  3R3I A;  1Z90 A;  3BRK X;  3SX7 A;  1V83 A;  2BO8 A;  4UEG A;  1ZCY A;  1HJJ A;  3V0O A;  1YP4 A;  1IIN A;  1TZF A;  2APC A;  4LW6 A;  5C3D A;  2WVL A;  4EEO A;  3ST8 A;  3JUK A;  5AJO A;  3U2W A;  1H7E A;  1H4D A;  1MP5 A;  3KIA A;  3SXD A;  5C3A A;  2Y4L A;  2ZU8 A;  1EYR A;  1JVD A;  1H4C A;  5IDS A;  4XWI A;  4Y7V A;  3D8V A;  5CMH A;  3U2U A;  3ZLL A;  1R82 A;  2Y6P A;  1W57 A;  4Y7T A;  1H7T A;  2I5E A;  4AAW A;  1TW1 A;  2I5K A;  1FXO A;  2VFZ A;  1ZCU A;  1VGT A;  2FY7 A;  2RJ1 A;  3CKN A;  3SPT A;  1O7O A;  2WGZ A;  2FFV A;  5C47 A;  2Y4K A;  2UX8 A;  3RMV A;  2D7R A;  5C4B A;  1NMM B;  3K8E A;  1S4O A;  4M28 A;  3V91 A;  2FFU A;  4E1K A;  1VPA A;  4D0T A;  1QGS A;  4D48 A;  1ZI1 A;  2RIT A;  2OI5 A;  4BMA A;  3T7N A;  3OH0 A;  1H5S D;  1ON8 A;  3OH3 A;  4YS8 A;  1FR8 A;  4KNR A;  1S4N A;  1LVW A;  4M4K A;  4ZDQ A;  5C4D A;  3USR A;  2AM5 A;  1W77 A;  2ICX A;  1LZ7 A;  3Q7U A;  4B3U A;  2VS5 A;  5FU8 A;  2A8U A;  1FO9 A;  1ON6 A;  4G3S A;  1VM8 A;  2Y4J A;  2V0J A;  2VD4 A;  3RSB A;  3BCV A;  4Y6U A;  2YES A;  1G8O A;  1QGQ A;  3CKQ A;  1YP2 A;  1R80 A;  4O6M A;  4JD0 A;  2MZB A;  2PX7 A;  1S4P A;  2AM3 A;  3OAM A;  4KC4 A;  1FWY A;  1G23 A;  3I0K A;  5CMI A;  4M2A A;  1XHB A;  3I0J A;  5L6S A;  5FTS A;  4B5B A;  5FTV A;  2AE7 A;  2RIZ A;  3T7M A;  1WT1 A;  2O1H A;  3USQ A;  4IRP A;  2RJ0 A;  4HO6 A;  3V0L A;  2YC3 A;  2RJ5 A;  1GWW A;  1H4E A;  2A8W A;  2JCJ A;  1FR9 A;  1GX0 A;  2D0J A;  4KQL A;  3OH4 A;  4HO0 A;  3V0N A;  1R7U A;  4FCU A;  4LW3 A;  4NAI A;  2ICY A;  2P6W A;  1FRW A;  2XWN A;  2Y4M A;  2J0A A;  2YQS A;  5CMF X;  2RIX A;  2FYA A;  1GX4 A;  5C1L A;  2FYD B;  5C48 A;  2X5Z A;  1VGU A;  4B42 A;  3K8D A;  5C36 A;  1FO8 A;  1OMZ A;  2JCO A;  4MND A;  5CQO A;  4D0Z A;  4ECM A;  2XWL A;  2VSI A;  1HM8 A;  3SXA A;  5C49 A;  4FCE A;  1H5R B;  3OC9 A;  1O7Q A;  2WAW A;  4HO2 A;  4Y7U A;  4FRL A;  2AH9 A;  3POL A;  5BXC A;  4B4G A;  3TZT A;  1INJ A;  4D11 C;  5D92 A;  4EEA A;  4Y7G A;  4HO5 A;  2RIY A;  4O6N A;  2BO4 A;  4EE3 A;  3QVB A;  5I1F A;  5EJZ A;  4B4M A;  3CKO A;  4BQH A;  1O23 B;  2WEE A;  1V84 A;  2Q4J A;  4G87 A;  1JV3 A;  4KPZ A;  4Q7C A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...