5C4BA

Crystal structure of gta + udp-glc + di
Total Genus 92
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
92
sequence length
288
structure length
288
Chain Sequence
AIGEFMVSLPRMVYPQPKVLTPCRKDVLVVTPWLAPIVWEGTFNIDILNEQFRLQNTTIGLTVFAIKKYVAFLKLFLETAEKHFMVGHRVHYYVFTDQPAAVPRVTLGTGRQLSVLEVRAYKRWQDVSMRRMEMISDFCERRFLSEVDYLVCVDVDMEFRDHVGVEILTPLFGTLHPGFYGSSREAFTYERRPQSQAYIPKDEGDFYYLGGFFGGSVQEVQRLTRACHQAMMVDQANGIEAVWHDESHLNKYLLRHKPTKVLSPEYLWDQQLLGWPAVLRKLRFTAVP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Histo-blood group ABO system transferase
publication title High Resolution Structures of the Human ABO(H) Blood Group Enzymes in Complex with Donor Analogs Reveal That the Enzymes Utilize Multiple Donor Conformations to Bind Substrates in a Stepwise Manner.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 92
structure length 288
sequence length 288
ec nomenclature ec 2.4.1.37: Fucosylgalactoside 3-alpha-galactosyltransferase.
pdb deposition date 2015-06-17
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.550.10 Alpha Beta Alpha-Beta Complex Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A 5c4bA00
4NAIA 3K8DA 2XWNA 4M2AA 5FTVA 3U0YA 1W57A 3SX7A 5I1FA 2WVMA 4EE4A 1LZ0A 5CQLX 1R7VA 4M2BA 2VD4A 5C3AA 3I0LA 2D7IA 1MP5A 1ZI1A 5C4BA 2FYCB 2WGZA 1VGTA 1JV1A 1GA8A 1S4NA 2GGQA 1H4DA 3D5NA 1VZUA 1S4OA 1NMMB 2Z86A 3ST8A 4KNRA 2OI5A 2RJ8A 2A8UA 1G23A 2X5SA 4G87A 3SX8A 4B5BA 4AAWA 2V0JA 3QVBA 4KC2A 3IOIA 1VGUA 2YQJA 4ZDQA 2AM5A 1R7XA 2AECA 5C3BA 2P6WA 4AYLA 4B2XA 4D0ZA 4KQLA 4KC1A 1V83A 1ZDGA 2QGIA 3I0KA 1FGXA 1W55A 3ZGFA 3SXCA 1PZTA 1ZJOA 1Z90A 2VS4A 5CMIA 2JCLA 1JYKA 2VS3A 4Y63A 4Y6UA 1OMXA 3LW6A 1IINA 1LL3A 5CQOA 4ASJA 3OH4A 4GBPA 2AM4A 2RIYA 2YQCA 5EIYA 4HOCA 4Y62A 2WEEA 4G3PA 1G0RA 3SX3A 4YS8A 4UEGA 3F1YA 4LW6A 3ZLKA 4L41C 3CU0A 1FO8A 4MNDA 5C4CA 3SXBA 2YC5A 5FV9A 3V0QA 3I0HA 4FCEA 4P00A 1O0RA 2XMEA 4KC4A 3ZF8A 4MYBA 5L6VA 4FRQA 2GGOA 3V0NA 1TW1A 3KIAA 1ZCUA 1QG8A 1QGQA 4Y6NA 2DPWA 2FYDB 4D11A 3CKVA 1EYRA 3RMWA 3OH1A 2FY7A 2FYAA 2W0VA 1W77A 1NHEB 1GQ9A 1JV3A 3OGZA 4EEOA 1H7FA 4B4BA 3U2XA 3PKQA 2RIXA 5C47A 3F1CA 1FWYA 1TW5A 5AJNA 2FFUA 2PA4A 1E5KA 3NGWA 1H5RA 2NXVA 2PX7A 1G8OA 1JVGA 2RJ7A 2V0KA 5FTSA 3SPTA 2AH9A 5IDSA 1FXJA 3E26A 3I0EA 2ZU7A 1ZCVA 2RJ9A 2VSIA 2O1FA 2UX8A 2YQSA 3T7NA 2YC3A 1WSZA 1ON6A 2XMHA 3RMVA 5J49A 1MP3A 4AC3A 2AM3A 3SXDA 1YP2A 1FXOA 1R7YA 1FGGA 4LW3A 2YCMA 1ZJ0A 2RJ0A 2CU2A 1G1LA 5C1GA 4ASYA 2BO6A 1ZCTA 3T7OA 2ZU9A 4BQHA 1HM8A 3FWWA 1TZFA 3OC9A 4DECA 2OEGA 3V0OA 5EJZA 1VPAA 4IRPA 5JQQA 5C1HA 2FYBA 1R7TA 2X65A 2VFZA 4FQWA 2WE9A 1INJA 1LL0A 3TQDA 3K8EA 4B2WA 5L6SA 3D98A 2D7RA 3OH3A 4KNXA 5IDTA 1OQMB 2X5ZA 3V0LA 3SXAA 1H4CA 4ARWA 1LVWA 1INIA 3I0JA 2P72A 4EEGA 2Y7AA 4FRLA 3U2VA 1YP4A 2JCOA 2D0JA 4EE3A 1H7HA 5AJPA 5EJ1A 3CGXA 1IIMA 1H7GA 3I0FA 2QKXA 2E8BA 3SXGA 5FUHA 4BMAA 3R2WA 1MC3A 2W0WA 1QWJA 2V0IA 4KPZA 1HJLA 1XZ6A 3U2WA 4CJCA 5DDTA 1R80A 4HO5A 1KWSA 1NKHB 2I7BA 2APCA 1FOAA 2BO4A 1R7UA 4D11C 4B4MA 2P73A 4FRDA 2OI7A 1R82A 4EE5A 4Y7VA 2O1HA 1FG5N 2BO8A 4HO0A 4HO4A 2RJ4A 4EEMA 4Y7TA 1ZIZA 4NAKA 2PGVA 1ZI4A 3I0GA 4Y7UA 2MZBA 2V0HA 3CKOA 4P02A 5AJOA 2YQHA 4HO9A 4Y7FA 1VH1A 1FR8A 3JTJA 4JISA 3DK5A 4J18A 4K6RA 2ZU8A 3JUKA 1GQCA 1JVDA 2XWLA 1ZI5A 3V8ZA 4KPXA 5DDVA 5HS2A 1NF5B 2Y4KA 3V8YA 2ICYA 5CMGX 5C1LA 1ZHJA 2E3DA 3POLA 1H7LA 4NALA 3OH0A 4HO6A 3TZTA 4R7PA 5C49A 2O1GA 4HG6A 1HJJA 4CJBA 4DDZA 1NWGB 4HO3A 5CMFX 3I0DA 1H5TA 1ZJ3A 3EE5A 1H5SA 1WT3A 1XHBA 2RJ6A 4FRPA 2OEFA 3CKQA 2VXMA 3E25A 4NANA 1MP4A 4M4KA 1PZYB 3USRA 1VGZA 2Q4JA 2I5EA 2AGDA 1V84A 3O3PA 1GWWA 1G9RA 1ZDFA 3Q7UA 1WVCA 5FU0A 1FRWA 5CQPA 4EEAA 3USQA 1ZCYA 1H7QA 2WVLA 4FRHA 3FOQA 1VM8A 1GX4A 2QH5A 2RJ5A 2Y4LA 1O7QA 1H7TA 2VS5A 2V0LA 1YROB 4M28A 1YP3A 1FO9A 4FROA 4D0TA 2VSHA 2YESA 5IFYA 4KRVA 1VGWA 2Y4MA 1HM0A 1H4EA 5C4DA 5CMJA 2XWMA 1ON8A 1S4PA 1V82A 1HV9A 1LZIA 1G97A 1SS9A 2ICXA 3V90A 1G93A 2Y4JA 4B3UA 5CMHA 3IOHA 1O23B 3N9WA 4CVHA 1TVYA 3Q4SA 1G95A 1LL2A 4DE7A 3OKRA 1K4VA 4FRAA 1LZJA 3T7MA 1FZWA 1LZ7A 3HL3A 4B42A 2FFVA 3I0CA 4IRQA 3V0PA 1ZI3A 1H7EA 1I52A 5CQMX 5C38A 1QGSA 4C2SA 3ZGGA 1O7OA 3JUJA 1EZIA 5C4FA 1G3LA 4FRBA 3U2UA 3V91A 2OI6A 4E1KA 5C8RA 4FREA 3BRKX 3SXEA 1H5SD 5C3DA 4XWIA 3ZLLA 5CQNX 1H5RB 1OMZA 1ZJPA 4HO2A 2Y6PA 4ECMA 2RJ1A 1GWVA 4KXOA 1GX0A 2JCJA 3SX5A 3D8VA 3DUVA 3GUEA 3Q80A 3U0XA 1NQIB 4B4GA 2WAWA 1WT1A 1HM9A 3PNNA 4G3SA 3OH2A 4FRMA 2I5KA 3CKNA 4D48A 2X60A 5C48A 2Z87A 4CJ8A 5C36A 1VH3A 1ZJ1A 2AE7A 3PKPA 2RITA 1ZJ2A 5C4EA 1WT2A 1H5TB 4EVWA 1H5SB 4HCQA 5FU8A 1H5SC 3U2TA 1G2VA 4FCUA 2A8WA 2AESA 3DJ4A 4Y7GA 4KT7A 4Y64A 3RSBA 3I0IX 3V0MA 3CKJA 2PGYA 4JD0A 1H3MA 1VZXA 4Y9XA 4HO8A 3IOJA 2RIZA 4AYJA 3BCVA 1VZTA 4G3QA 5BXCA 1JYLA 2JCKA 2BO7A 1VICA 1R81A 1FR9A 2VXLA 3OAMA 5FYEA 3R3IA 2WVKA 1WT0A
chains in the Genus database with same CATH superfamily
4NAIA 3K8DA 2XWNA 4M2AA 5FTVA 3U0YA 1W57A 3SX7A 5I1FA 2WVMA 4EE4A 1LZ0A 5CQLX 1R7VA 4M2BA 2VD4A 5C3AA 3I0LA 2D7IA 1MP5A 1ZI1A 5C4BA 2FYCB 2WGZA 1VGTA 1JV1A 1GA8A 1S4NA 2GGQA 1H4DA 3D5NA 1VZUA 1S4OA 1NMMB 2Z86A 3ST8A 4KNRA 2OI5A 2RJ8A 2A8UA 1G23A 2X5SA 4G87A 3SX8A 4B5BA 4AAWA 2V0JA 3QVBA 4KC2A 3IOIA 1VGUA 2YQJA 4ZDQA 2AM5A 1R7XA 2AECA 5C3BA 2P6WA 4AYLA 4B2XA 4D0ZA 4KQLA 4KC1A 1V83A 1ZDGA 2QGIA 3I0KA 1FGXA 1W55A 3ZGFA 3SXCA 1PZTA 1ZJOA 1Z90A 2VS4A 5CMIA 2JCLA 1JYKA 2VS3A 4Y63A 4Y6UA 1OMXA 3LW6A 1IINA 1LL3A 5CQOA 4ASJA 3OH4A 4GBPA 2AM4A 2RIYA 2YQCA 5EIYA 4HOCA 4Y62A 2WEEA 4G3PA 1G0RA 3SX3A 4YS8A 4UEGA 3F1YA 4LW6A 3ZLKA 4L41C 3CU0A 1FO8A 4MNDA 5C4CA 4FIYA 3SXBA 2YC5A 5FV9A 3V0QA 3I0HA 4FCEA 4P00A 1O0RA 2XMEA 4KC4A 3ZF8A 4MYBA 5D92A 5L6VA 4FRQA 2GGOA 3V0NA 1TW1A 2J0AA 3KIAA 1ZCUA 1QG8A 1QGQA 4Y6NA 2DPWA 2FYDB 4D11A 3CKVA 1EYRA 3RMWA 3OH1A 2FY7A 2FYAA 2W0VA 1W77A 1NHEB 1GQ9A 1JV3A 3OGZA 4EEOA 1H7FA 4B4BA 3U2XA 3PKQA 2RIXA 5C47A 3F1CA 1FWYA 1TW5A 5AJNA 2FFUA 2PA4A 1E5KA 3NGWA 1H5RA 2VK9A 2NXVA 2PX7A 1G8OA 1JVGA 2RJ7A 2V0KA 5FTSA 3SPTA 2AH9A 5IDSA 1FXJA 3E26A 3I0EA 2ZU7A 1ZCVA 2RJ9A 2VSIA 2O1FA 2UX8A 2YQSA 3T7NA 2YC3A 1WSZA 1ON6A 2XMHA 3RMVA 5J49A 1MP3A 4AC3A 2AM3A 3SXDA 1YP2A 1FXOA 1R7YA 1FGGA 4LW3A 2YCMA 1ZJ0A 2RJ0A 2CU2A 1G1LA 5C1GA 4ASYA 2BO6A 1ZCTA 3T7OA 2ZU9A 4BQHA 1HM8A 3FWWA 1TZFA 3OC9A 4DECA 2OEGA 4O6NA 3V0OA 5EJZA 1VPAA 4IRPA 5JQQA 5C1HA 2FYBA 1R7TA 2X65A 2VFZA 4FQWA 2WE9A 1INJA 1LL0A 3TQDA 3K8EA 4B2WA 5L6SA 4O6MA 3D98A 2D7RA 3OH3A 4KNXA 5IDTA 1OQMB 2X5ZA 3V0LA 3SXAA 1H4CA 4ARWA 1LVWA 1INIA 3I0JA 2P72A 4EEGA 2Y7AA 4FRLA 3U2VA 1YP4A 2JCOA 2D0JA 4EE3A 1H7HA 5AJPA 5EJ1A 3CGXA 1IIMA 1H7GA 3I0FA 2QKXA 2E8BA 3SXGA 5FUHA 4BMAA 3R2WA 1MC3A 2W0WA 1QWJA 2V0IA 4KPZA 1HJLA 1XZ6A 3U2WA 4CJCA 5DDTA 1R80A 4HO5A 1KWSA 1NKHB 4MIXA 2I7BA 2APCA 1FOAA 2BO4A 1R7UA 4D11C 4B4MA 2P73A 4FRDA 2OI7A 1R82A 4EE5A 4Y7VA 2O1HA 1FG5N 2BO8A 4HO0A 4HO4A 2RJ4A 4EEMA 4Y7TA 1ZIZA 4NAKA 2PGVA 1ZI4A 3I0GA 4Y7UA 2MZBA 2V0HA 3CKOA 4P02A 5AJOA 2YQHA 4HO9A 4Y7FA 1VH1A 1FR8A 3JTJA 4JISA 3DK5A 4J18A 4K6RA 2ZU8A 3JUKA 1GQCA 1JVDA 2XWLA 1ZI5A 5D91A 3V8ZA 4KPXA 5DDVA 5HS2A 1NF5B 2Y4KA 3V8YA 2ICYA 5CMGX 5C1LA 1ZHJA 2E3DA 3POLA 1H7LA 4NALA 3OH0A 4HO6A 3TZTA 4R7PA 5C49A 2O1GA 4HG6A 1HJJA 4CJBA 4DDZA 1NWGB 4HO3A 5CMFX 3I0DA 1H5TA 1ZJ3A 3EE5A 1H5SA 1WT3A 1XHBA 2RJ6A 4FRPA 2OEFA 3CKQA 2VXMA 3E25A 4NANA 1MP4A 4M4KA 1PZYB 3USRA 1VGZA 2Q4JA 2I5EA 2C0NA 2AGDA 1V84A 3O3PA 1GWWA 1G9RA 1ZDFA 3Q7UA 1WVCA 5FU0A 1FRWA 5CQPA 4EEAA 3USQA 1ZCYA 1H7QA 2WVLA 4FRHA 3FOQA 1VM8A 1GX4A 2QH5A 2RJ5A 2Y4LA 1O7QA 1H7TA 2VS5A 2V0LA 1YROB 4M28A 1YP3A 1FO9A 4FROA 4D0TA 2VSHA 2YESA 5IFYA 4KRVA 1VGWA 2Y4MA 1HM0A 1H4EA 5C4DA 5CMJA 2XWMA 1ON8A 1S4PA 1V82A 1HV9A 1LZIA 1G97A 1SS9A 2ICXA 3V90A 1G93A 2Y4JA 4B3UA 5CMHA 3IOHA 1O23B 3N9WA 4CVHA 1TVYA 3Q4SA 1G95A 1LL2A 4DE7A 4FIXA 3OKRA 1K4VA 4FRAA 1LZJA 3T7MA 1FZWA 1LZ7A 3HL3A 4B42A 2FFVA 3I0CA 4IRQA 3V0PA 1ZI3A 1H7EA 1I52A 5CQMX 5C38A 1QGSA 4C2SA 3ZGGA 1O7OA 3JUJA 1EZIA 5C4FA 1G3LA 4FRBA 3U2UA 3V91A 2OI6A 4E1KA 5C8RA 4FREA 3BRKX 2J0BA 1H5SD 3SXEA 5C3DA 4XWIA 3ZLLA 5CQNX 1H5RB 1OMZA 1ZJPA 4HO2A 4Q7CA 2Y6PA 4ECMA 2RJ1A 1GWVA 4KXOA 1GX0A 2JCJA 3SX5A 3D8VA 3DUVA 3GUEA 3Q80A 3U0XA 1NQIB 4B4GA 2WAWA 1WT1A 1HM9A 3PNNA 4G3SA 3OH2A 4FRMA 2I5KA 3CKNA 4D48A 2X60A 5C48A 2Z87A 4CJ8A 5C36A 1VH3A 1ZJ1A 2AE7A 3PKPA 2RITA 1ZJ2A 5C4EA 1WT2A 1H5TB 4EVWA 1H5SB 4HCQA 5FU8A 1H5SC 3U2TA 1G2VA 4FCUA 2A8WA 2AESA 3DJ4A 4Y7GA 4KT7A 4Y64A 3RSBA 3I0IX 3V0MA 3CKJA 2PGYA 4JD0A 1H3MA 1VZXA 4Y9XA 4HO8A 3IOJA 2RIZA 4AYJA 3BCVA 1VZTA 4G3QA 5BXCA 1JYLA 2JCKA 2BO7A 1VICA 1R81A 1FR9A 2VXLA 3OAMA 5FYEA 3R3IA 2WVKA 1WT0A
chains in the Genus database with same CATH topology
4NAIA 3K8DA 2XWNA 4M2AA 5FTVA 3U0YA 1W57A 3SX7A 5I1FA 2WVMA 4EE4A 1LZ0A 5CQLX 1R7VA 4M2BA 2VD4A 5C3AA 3I0LA 2D7IA 1MP5A 1ZI1A 5C4BA 2FYCB 2WGZA 1VGTA 1JV1A 1GA8A 1S4NA 2GGQA 1H4DA 3D5NA 1VZUA 1S4OA 1NMMB 2Z86A 3ST8A 4KNRA 2OI5A 2RJ8A 2A8UA 1G23A 2X5SA 4G87A 3SX8A 4B5BA 4AAWA 2V0JA 3QVBA 4KC2A 3IOIA 1VGUA 2YQJA 4ZDQA 2AM5A 1R7XA 2AECA 5C3BA 2P6WA 4AYLA 4B2XA 4D0ZA 4KQLA 4KC1A 1V83A 1ZDGA 2QGIA 3I0KA 1FGXA 1W55A 3ZGFA 3SXCA 1PZTA 1ZJOA 1Z90A 2VS4A 5CMIA 2JCLA 1JYKA 2VS3A 4Y63A 4Y6UA 1OMXA 3LW6A 1IINA 1LL3A 5CQOA 4ASJA 3OH4A 4GBPA 2AM4A 2RIYA 2YQCA 5EIYA 4HOCA 4Y62A 2WEEA 4G3PA 1G0RA 3SX3A 4YS8A 4UEGA 3F1YA 4LW6A 3ZLKA 4L41C 3CU0A 1FO8A 4MNDA 5C4CA 4FIYA 3SXBA 2YC5A 5FV9A 3V0QA 3I0HA 4FCEA 4P00A 1O0RA 2XMEA 4KC4A 3ZF8A 4MYBA 5D92A 5L6VA 4FRQA 2GGOA 3V0NA 1TW1A 2J0AA 3KIAA 1ZCUA 1QG8A 1QGQA 4Y6NA 2DPWA 2FYDB 4D11A 3CKVA 1EYRA 3RMWA 3OH1A 2FY7A 2FYAA 2W0VA 1W77A 1NHEB 1GQ9A 1JV3A 3OGZA 4EEOA 1H7FA 4B4BA 3U2XA 3PKQA 2RIXA 5C47A 3F1CA 1FWYA 1TW5A 5AJNA 2FFUA 2PA4A 1E5KA 3NGWA 1H5RA 2VK9A 2NXVA 2PX7A 1G8OA 1JVGA 2RJ7A 2V0KA 5FTSA 3SPTA 2AH9A 5IDSA 1FXJA 3E26A 3I0EA 2ZU7A 1ZCVA 2RJ9A 2VSIA 2O1FA 2UX8A 2YQSA 3T7NA 2YC3A 1WSZA 1ON6A 2XMHA 3RMVA 5J49A 1MP3A 4AC3A 2AM3A 3SXDA 1YP2A 1FXOA 1R7YA 1FGGA 4LW3A 2YCMA 1ZJ0A 2RJ0A 2CU2A 1G1LA 5C1GA 4ASYA 2BO6A 1ZCTA 3T7OA 2ZU9A 4BQHA 1HM8A 3FWWA 1TZFA 3OC9A 4DECA 2OEGA 4O6NA 3V0OA 5EJZA 1VPAA 4IRPA 5JQQA 5C1HA 2FYBA 1R7TA 2X65A 2VFZA 4FQWA 2WE9A 1INJA 1LL0A 3TQDA 3K8EA 4B2WA 5L6SA 4O6MA 3D98A 2D7RA 3OH3A 4KNXA 5IDTA 1OQMB 2X5ZA 3V0LA 3SXAA 1H4CA 4ARWA 1LVWA 1INIA 3I0JA 2P72A 4EEGA 2Y7AA 4FRLA 3U2VA 1YP4A 2JCOA 2D0JA 4EE3A 1H7HA 5AJPA 5EJ1A 3CGXA 1IIMA 1H7GA 3I0FA 2QKXA 2E8BA 3SXGA 5FUHA 4BMAA 3R2WA 1MC3A 2W0WA 1QWJA 2V0IA 4KPZA 1HJLA 1XZ6A 3U2WA 4CJCA 5DDTA 1R80A 4HO5A 1KWSA 1NKHB 4MIXA 2I7BA 2APCA 1FOAA 2BO4A 1R7UA 4D11C 4B4MA 2P73A 4FRDA 2OI7A 1R82A 4EE5A 4Y7VA 2O1HA 1FG5N 2BO8A 4HO0A 4HO4A 2RJ4A 4EEMA 4Y7TA 1ZIZA 4NAKA 2PGVA 1ZI4A 3I0GA 4Y7UA 2MZBA 2V0HA 3CKOA 4P02A 5AJOA 2YQHA 4HO9A 4Y7FA 1VH1A 1FR8A 3JTJA 4JISA 3DK5A 4J18A 4K6RA 2ZU8A 3JUKA 1GQCA 1JVDA 2XWLA 1ZI5A 5D91A 3V8ZA 4KPXA 5DDVA 5HS2A 1NF5B 2Y4KA 3V8YA 2ICYA 5CMGX 5C1LA 1ZHJA 2E3DA 3POLA 1H7LA 4NALA 3OH0A 4HO6A 3TZTA 4R7PA 5C49A 2O1GA 4HG6A 1HJJA 4CJBA 4DDZA 1NWGB 4HO3A 5CMFX 3I0DA 1H5TA 1ZJ3A 3EE5A 1H5SA 1WT3A 1XHBA 2RJ6A 4FRPA 2OEFA 3CKQA 2VXMA 3E25A 4NANA 1MP4A 4M4KA 1PZYB 3USRA 1VGZA 2Q4JA 2I5EA 2C0NA 2AGDA 1V84A 3O3PA 1GWWA 1G9RA 1ZDFA 3Q7UA 1WVCA 5FU0A 1FRWA 5CQPA 4EEAA 3USQA 1ZCYA 1H7QA 2WVLA 4FRHA 3FOQA 1VM8A 1GX4A 2QH5A 2RJ5A 2Y4LA 1O7QA 1H7TA 2VS5A 2V0LA 1YROB 4M28A 1YP3A 1FO9A 4FROA 4D0TA 2VSHA 2YESA 5IFYA 4KRVA 1VGWA 2Y4MA 1HM0A 1H4EA 5C4DA 5CMJA 2XWMA 1ON8A 1S4PA 1V82A 1HV9A 1LZIA 1G97A 1SS9A 2ICXA 3V90A 1G93A 2Y4JA 4B3UA 5CMHA 3IOHA 1O23B 3N9WA 4CVHA 1TVYA 3Q4SA 1G95A 1LL2A 4DE7A 4FIXA 3OKRA 1K4VA 4FRAA 1LZJA 3T7MA 1FZWA 1LZ7A 3HL3A 4B42A 2FFVA 3I0CA 4IRQA 3V0PA 1ZI3A 1H7EA 1I52A 5CQMX 5C38A 1QGSA 4C2SA 3ZGGA 1O7OA 3JUJA 1EZIA 5C4FA 1G3LA 4FRBA 3U2UA 3V91A 2OI6A 4E1KA 5C8RA 4FREA 3BRKX 2J0BA 1H5SD 3SXEA 5C3DA 4XWIA 3ZLLA 5CQNX 1H5RB 1OMZA 1ZJPA 4HO2A 4Q7CA 2Y6PA 4ECMA 2RJ1A 1GWVA 4KXOA 1GX0A 2JCJA 3SX5A 3D8VA 3DUVA 3GUEA 3Q80A 3U0XA 1NQIB 4B4GA 2WAWA 1WT1A 1HM9A 3PNNA 4G3SA 3OH2A 4FRMA 2I5KA 3CKNA 4D48A 2X60A 5C48A 2Z87A 4CJ8A 5C36A 1VH3A 1ZJ1A 2AE7A 3PKPA 2RITA 1ZJ2A 5C4EA 1WT2A 1H5TB 4EVWA 1H5SB 4HCQA 5FU8A 1H5SC 3U2TA 1G2VA 4FCUA 2A8WA 2AESA 3DJ4A 4Y7GA 4KT7A 4Y64A 3RSBA 3I0IX 3V0MA 3CKJA 2PGYA 4JD0A 1H3MA 1VZXA 4Y9XA 4HO8A 3IOJA 2RIZA 4AYJA 3BCVA 1VZTA 4G3QA 5BXCA 1JYLA 2JCKA 2BO7A 1VICA 1R81A 1FR9A 2VXLA 3OAMA 5FYEA 3R3IA 2WVKA 1WT0A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4NAI A;  3K8D A;  2XWN A;  4M2A A;  5FTV A;  3U0Y A;  1W57 A;  3SX7 A;  5I1F A;  2WVM A;  4EE4 A;  1LZ0 A;  5CQL X;  1R7V A;  4M2B A;  2VD4 A;  5C3A A;  3I0L A;  2D7I A;  1MP5 A;  1ZI1 A;  5C4B A;  2FYC B;  2WGZ A;  1VGT A;  1JV1 A;  1GA8 A;  1S4N A;  2GGQ A;  1H4D A;  3D5N A;  1VZU A;  1S4O A;  1NMM B;  2Z86 A;  3ST8 A;  4KNR A;  2OI5 A;  2RJ8 A;  2A8U A;  1G23 A;  2X5S A;  4G87 A;  3SX8 A;  4B5B A;  4AAW A;  2V0J A;  3QVB A;  4KC2 A;  3IOI A;  1VGU A;  2YQJ A;  4ZDQ A;  2AM5 A;  1R7X A;  2AEC A;  5C3B A;  2P6W A;  4AYL A;  4B2X A;  4D0Z A;  4KQL A;  4KC1 A;  1V83 A;  1ZDG A;  2QGI A;  3I0K A;  1FGX A;  1W55 A;  3ZGF A;  3SXC A;  1PZT A;  1ZJO A;  1Z90 A;  2VS4 A;  5CMI A;  2JCL A;  1JYK A;  2VS3 A;  4Y63 A;  4Y6U A;  1OMX A;  3LW6 A;  1IIN A;  1LL3 A;  5CQO A;  4ASJ A;  3OH4 A;  4GBP A;  2AM4 A;  2RIY A;  2YQC A;  5EIY A;  4HOC A;  4Y62 A;  2WEE A;  4G3P A;  1G0R A;  3SX3 A;  4YS8 A;  4UEG A;  3F1Y A;  4LW6 A;  3ZLK A;  4L41 C;  3CU0 A;  1FO8 A;  4MND A;  5C4C A;  3SXB A;  2YC5 A;  5FV9 A;  3V0Q A;  3I0H A;  4FCE A;  4P00 A;  1O0R A;  2XME A;  4KC4 A;  3ZF8 A;  4MYB A;  5L6V A;  4FRQ A;  2GGO A;  3V0N A;  1TW1 A;  3KIA A;  1ZCU A;  1QG8 A;  1QGQ A;  4Y6N A;  2DPW A;  2FYD B;  4D11 A;  3CKV A;  1EYR A;  3RMW A;  3OH1 A;  2FY7 A;  2FYA A;  2W0V A;  1W77 A;  1NHE B;  1GQ9 A;  1JV3 A;  3OGZ A;  4EEO A;  1H7F A;  4B4B A;  3U2X A;  3PKQ A;  2RIX A;  5C47 A;  3F1C A;  1FWY A;  1TW5 A;  5AJN A;  2FFU A;  2PA4 A;  1E5K A;  3NGW A;  1H5R A;  2NXV A;  2PX7 A;  1G8O A;  1JVG A;  2RJ7 A;  2V0K A;  5FTS A;  3SPT A;  2AH9 A;  5IDS A;  1FXJ A;  3E26 A;  3I0E A;  2ZU7 A;  1ZCV A;  2RJ9 A;  2VSI A;  2O1F A;  2UX8 A;  2YQS A;  3T7N A;  2YC3 A;  1WSZ A;  1ON6 A;  2XMH A;  3RMV A;  5J49 A;  1MP3 A;  4AC3 A;  2AM3 A;  3SXD A;  1YP2 A;  1FXO A;  1R7Y A;  1FGG A;  4LW3 A;  2YCM A;  1ZJ0 A;  2RJ0 A;  2CU2 A;  1G1L A;  5C1G A;  4ASY A;  2BO6 A;  1ZCT A;  3T7O A;  2ZU9 A;  4BQH A;  1HM8 A;  3FWW A;  1TZF A;  3OC9 A;  4DEC A;  2OEG A;  3V0O A;  5EJZ A;  1VPA A;  4IRP A;  5JQQ A;  5C1H A;  2FYB A;  1R7T A;  2X65 A;  2VFZ A;  4FQW A;  2WE9 A;  1INJ A;  1LL0 A;  3TQD A;  3K8E A;  4B2W A;  5L6S A;  3D98 A;  2D7R A;  3OH3 A;  4KNX A;  5IDT A;  1OQM B;  2X5Z A;  3V0L A;  3SXA A;  1H4C A;  4ARW A;  1LVW A;  1INI A;  3I0J A;  2P72 A;  4EEG A;  2Y7A A;  4FRL A;  3U2V A;  1YP4 A;  2JCO A;  2D0J A;  4EE3 A;  1H7H A;  5AJP A;  5EJ1 A;  3CGX A;  1IIM A;  1H7G A;  3I0F A;  2QKX A;  2E8B A;  3SXG A;  5FUH A;  4BMA A;  3R2W A;  1MC3 A;  2W0W A;  1QWJ A;  2V0I A;  4KPZ A;  1HJL A;  1XZ6 A;  3U2W A;  4CJC A;  5DDT A;  1R80 A;  4HO5 A;  1KWS A;  1NKH B;  2I7B A;  2APC A;  1FOA A;  2BO4 A;  1R7U A;  4D11 C;  4B4M A;  2P73 A;  4FRD A;  2OI7 A;  1R82 A;  4EE5 A;  4Y7V A;  2O1H A;  1FG5 N;  2BO8 A;  4HO0 A;  4HO4 A;  2RJ4 A;  4EEM A;  4Y7T A;  1ZIZ A;  4NAK A;  2PGV A;  1ZI4 A;  3I0G A;  4Y7U A;  2MZB A;  2V0H A;  3CKO A;  4P02 A;  5AJO A;  2YQH A;  4HO9 A;  4Y7F A;  1VH1 A;  1FR8 A;  3JTJ A;  4JIS A;  3DK5 A;  4J18 A;  4K6R A;  2ZU8 A;  3JUK A;  1GQC A;  1JVD A;  2XWL A;  1ZI5 A;  3V8Z A;  4KPX A;  5DDV A;  5HS2 A;  1NF5 B;  2Y4K A;  3V8Y A;  2ICY A;  5CMG X;  5C1L A;  1ZHJ A;  2E3D A;  3POL A;  1H7L A;  4NAL A;  3OH0 A;  4HO6 A;  3TZT A;  4R7P A;  5C49 A;  2O1G A;  4HG6 A;  1HJJ A;  4CJB A;  4DDZ A;  1NWG B;  4HO3 A;  5CMF X;  3I0D A;  1H5T A;  1ZJ3 A;  3EE5 A;  1H5S A;  1WT3 A;  1XHB A;  2RJ6 A;  4FRP A;  2OEF A;  3CKQ A;  2VXM A;  3E25 A;  4NAN A;  1MP4 A;  4M4K A;  1PZY B;  3USR A;  1VGZ A;  2Q4J A;  2I5E A;  2AGD A;  1V84 A;  3O3P A;  1GWW A;  1G9R A;  1ZDF A;  3Q7U A;  1WVC A;  5FU0 A;  1FRW A;  5CQP A;  4EEA A;  3USQ A;  1ZCY A;  1H7Q A;  2WVL A;  4FRH A;  3FOQ A;  1VM8 A;  1GX4 A;  2QH5 A;  2RJ5 A;  2Y4L A;  1O7Q A;  1H7T A;  2VS5 A;  2V0L A;  1YRO B;  4M28 A;  1YP3 A;  1FO9 A;  4FRO A;  4D0T A;  2VSH A;  2YES A;  5IFY A;  4KRV A;  1VGW A;  2Y4M A;  1HM0 A;  1H4E A;  5C4D A;  5CMJ A;  2XWM A;  1ON8 A;  1S4P A;  1V82 A;  1HV9 A;  1LZI A;  1G97 A;  1SS9 A;  2ICX A;  3V90 A;  1G93 A;  2Y4J A;  4B3U A;  5CMH A;  3IOH A;  1O23 B;  3N9W A;  4CVH A;  1TVY A;  3Q4S A;  1G95 A;  1LL2 A;  4DE7 A;  3OKR A;  1K4V A;  4FRA A;  1LZJ A;  3T7M A;  1FZW A;  1LZ7 A;  3HL3 A;  4B42 A;  2FFV A;  3I0C A;  4IRQ A;  3V0P A;  1ZI3 A;  1H7E A;  1I52 A;  5CQM X;  5C38 A;  1QGS A;  4C2S A;  3ZGG A;  1O7O A;  3JUJ A;  1EZI A;  5C4F A;  1G3L A;  4FRB A;  3U2U A;  3V91 A;  2OI6 A;  4E1K A;  5C8R A;  4FRE A;  3BRK X;  3SXE A;  1H5S D;  5C3D A;  4XWI A;  3ZLL A;  5CQN X;  1H5R B;  1OMZ A;  1ZJP A;  4HO2 A;  2Y6P A;  4ECM A;  2RJ1 A;  1GWV A;  4KXO A;  1GX0 A;  2JCJ A;  3SX5 A;  3D8V A;  3DUV A;  3GUE A;  3Q80 A;  3U0X A;  1NQI B;  4B4G A;  2WAW A;  1WT1 A;  1HM9 A;  3PNN A;  4G3S A;  3OH2 A;  4FRM A;  2I5K A;  3CKN A;  4D48 A;  2X60 A;  5C48 A;  2Z87 A;  4CJ8 A;  5C36 A;  1VH3 A;  1ZJ1 A;  2AE7 A;  3PKP A;  2RIT A;  1ZJ2 A;  5C4E A;  1WT2 A;  1H5T B;  4EVW A;  1H5S B;  4HCQ A;  5FU8 A;  1H5S C;  3U2T A;  1G2V A;  4FCU A;  2A8W A;  2AES A;  3DJ4 A;  4Y7G A;  4KT7 A;  4Y64 A;  3RSB A;  3I0I X;  3V0M A;  3CKJ A;  2PGY A;  4JD0 A;  1H3M A;  1VZX A;  4Y9X A;  4HO8 A;  3IOJ A;  2RIZ A;  4AYJ A;  3BCV A;  1VZT A;  4G3Q A;  5BXC A;  1JYL A;  2JCK A;  2BO7 A;  1VIC A;  1R81 A;  1FR9 A;  2VXL A;  3OAM A;  5FYE A;  3R3I A;  2WVK A;  1WT0 A; 
#chains in the Genus database with same CATH topology
 4NAI A;  3K8D A;  2XWN A;  4M2A A;  5FTV A;  3U0Y A;  1W57 A;  3SX7 A;  5I1F A;  2WVM A;  4EE4 A;  1LZ0 A;  5CQL X;  1R7V A;  4M2B A;  2VD4 A;  5C3A A;  3I0L A;  2D7I A;  1MP5 A;  1ZI1 A;  5C4B A;  2FYC B;  2WGZ A;  1VGT A;  1JV1 A;  1GA8 A;  1S4N A;  2GGQ A;  1H4D A;  3D5N A;  1VZU A;  1S4O A;  1NMM B;  2Z86 A;  3ST8 A;  4KNR A;  2OI5 A;  2RJ8 A;  2A8U A;  1G23 A;  2X5S A;  4G87 A;  3SX8 A;  4B5B A;  4AAW A;  2V0J A;  3QVB A;  4KC2 A;  3IOI A;  1VGU A;  2YQJ A;  4ZDQ A;  2AM5 A;  1R7X A;  2AEC A;  5C3B A;  2P6W A;  4AYL A;  4B2X A;  4D0Z A;  4KQL A;  4KC1 A;  1V83 A;  1ZDG A;  2QGI A;  3I0K A;  1FGX A;  1W55 A;  3ZGF A;  3SXC A;  1PZT A;  1ZJO A;  1Z90 A;  2VS4 A;  5CMI A;  2JCL A;  1JYK A;  2VS3 A;  4Y63 A;  4Y6U A;  1OMX A;  3LW6 A;  1IIN A;  1LL3 A;  5CQO A;  4ASJ A;  3OH4 A;  4GBP A;  2AM4 A;  2RIY A;  2YQC A;  5EIY A;  4HOC A;  4Y62 A;  2WEE A;  4G3P A;  1G0R A;  3SX3 A;  4YS8 A;  4UEG A;  3F1Y A;  4LW6 A;  3ZLK A;  4L41 C;  3CU0 A;  1FO8 A;  4MND A;  5C4C A;  4FIY A;  3SXB A;  2YC5 A;  5FV9 A;  3V0Q A;  3I0H A;  4FCE A;  4P00 A;  1O0R A;  2XME A;  4KC4 A;  3ZF8 A;  4MYB A;  5D92 A;  5L6V A;  4FRQ A;  2GGO A;  3V0N A;  1TW1 A;  2J0A A;  3KIA A;  1ZCU A;  1QG8 A;  1QGQ A;  4Y6N A;  2DPW A;  2FYD B;  4D11 A;  3CKV A;  1EYR A;  3RMW A;  3OH1 A;  2FY7 A;  2FYA A;  2W0V A;  1W77 A;  1NHE B;  1GQ9 A;  1JV3 A;  3OGZ A;  4EEO A;  1H7F A;  4B4B A;  3U2X A;  3PKQ A;  2RIX A;  5C47 A;  3F1C A;  1FWY A;  1TW5 A;  5AJN A;  2FFU A;  2PA4 A;  1E5K A;  3NGW A;  1H5R A;  2VK9 A;  2NXV A;  2PX7 A;  1G8O A;  1JVG A;  2RJ7 A;  2V0K A;  5FTS A;  3SPT A;  2AH9 A;  5IDS A;  1FXJ A;  3E26 A;  3I0E A;  2ZU7 A;  1ZCV A;  2RJ9 A;  2VSI A;  2O1F A;  2UX8 A;  2YQS A;  3T7N A;  2YC3 A;  1WSZ A;  1ON6 A;  2XMH A;  3RMV A;  5J49 A;  1MP3 A;  4AC3 A;  2AM3 A;  3SXD A;  1YP2 A;  1FXO A;  1R7Y A;  1FGG A;  4LW3 A;  2YCM A;  1ZJ0 A;  2RJ0 A;  2CU2 A;  1G1L A;  5C1G A;  4ASY A;  2BO6 A;  1ZCT A;  3T7O A;  2ZU9 A;  4BQH A;  1HM8 A;  3FWW A;  1TZF A;  3OC9 A;  4DEC A;  2OEG A;  4O6N A;  3V0O A;  5EJZ A;  1VPA A;  4IRP A;  5JQQ A;  5C1H A;  2FYB A;  1R7T A;  2X65 A;  2VFZ A;  4FQW A;  2WE9 A;  1INJ A;  1LL0 A;  3TQD A;  3K8E A;  4B2W A;  5L6S A;  4O6M A;  3D98 A;  2D7R A;  3OH3 A;  4KNX A;  5IDT A;  1OQM B;  2X5Z A;  3V0L A;  3SXA A;  1H4C A;  4ARW A;  1LVW A;  1INI A;  3I0J A;  2P72 A;  4EEG A;  2Y7A A;  4FRL A;  3U2V A;  1YP4 A;  2JCO A;  2D0J A;  4EE3 A;  1H7H A;  5AJP A;  5EJ1 A;  3CGX A;  1IIM A;  1H7G A;  3I0F A;  2QKX A;  2E8B A;  3SXG A;  5FUH A;  4BMA A;  3R2W A;  1MC3 A;  2W0W A;  1QWJ A;  2V0I A;  4KPZ A;  1HJL A;  1XZ6 A;  3U2W A;  4CJC A;  5DDT A;  1R80 A;  4HO5 A;  1KWS A;  1NKH B;  4MIX A;  2I7B A;  2APC A;  1FOA A;  2BO4 A;  1R7U A;  4D11 C;  4B4M A;  2P73 A;  4FRD A;  2OI7 A;  1R82 A;  4EE5 A;  4Y7V A;  2O1H A;  1FG5 N;  2BO8 A;  4HO0 A;  4HO4 A;  2RJ4 A;  4EEM A;  4Y7T A;  1ZIZ A;  4NAK A;  2PGV A;  1ZI4 A;  3I0G A;  4Y7U A;  2MZB A;  2V0H A;  3CKO A;  4P02 A;  5AJO A;  2YQH A;  4HO9 A;  4Y7F A;  1VH1 A;  1FR8 A;  3JTJ A;  4JIS A;  3DK5 A;  4J18 A;  4K6R A;  2ZU8 A;  3JUK A;  1GQC A;  1JVD A;  2XWL A;  1ZI5 A;  5D91 A;  3V8Z A;  4KPX A;  5DDV A;  5HS2 A;  1NF5 B;  2Y4K A;  3V8Y A;  2ICY A;  5CMG X;  5C1L A;  1ZHJ A;  2E3D A;  3POL A;  1H7L A;  4NAL A;  3OH0 A;  4HO6 A;  3TZT A;  4R7P A;  5C49 A;  2O1G A;  4HG6 A;  1HJJ A;  4CJB A;  4DDZ A;  1NWG B;  4HO3 A;  5CMF X;  3I0D A;  1H5T A;  1ZJ3 A;  3EE5 A;  1H5S A;  1WT3 A;  1XHB A;  2RJ6 A;  4FRP A;  2OEF A;  3CKQ A;  2VXM A;  3E25 A;  4NAN A;  1MP4 A;  4M4K A;  1PZY B;  3USR A;  1VGZ A;  2Q4J A;  2I5E A;  2C0N A;  2AGD A;  1V84 A;  3O3P A;  1GWW A;  1G9R A;  1ZDF A;  3Q7U A;  1WVC A;  5FU0 A;  1FRW A;  5CQP A;  4EEA A;  3USQ A;  1ZCY A;  1H7Q A;  2WVL A;  4FRH A;  3FOQ A;  1VM8 A;  1GX4 A;  2QH5 A;  2RJ5 A;  2Y4L A;  1O7Q A;  1H7T A;  2VS5 A;  2V0L A;  1YRO B;  4M28 A;  1YP3 A;  1FO9 A;  4FRO A;  4D0T A;  2VSH A;  2YES A;  5IFY A;  4KRV A;  1VGW A;  2Y4M A;  1HM0 A;  1H4E A;  5C4D A;  5CMJ A;  2XWM A;  1ON8 A;  1S4P A;  1V82 A;  1HV9 A;  1LZI A;  1G97 A;  1SS9 A;  2ICX A;  3V90 A;  1G93 A;  2Y4J A;  4B3U A;  5CMH A;  3IOH A;  1O23 B;  3N9W A;  4CVH A;  1TVY A;  3Q4S A;  1G95 A;  1LL2 A;  4DE7 A;  4FIX A;  3OKR A;  1K4V A;  4FRA A;  1LZJ A;  3T7M A;  1FZW A;  1LZ7 A;  3HL3 A;  4B42 A;  2FFV A;  3I0C A;  4IRQ A;  3V0P A;  1ZI3 A;  1H7E A;  1I52 A;  5CQM X;  5C38 A;  1QGS A;  4C2S A;  3ZGG A;  1O7O A;  3JUJ A;  1EZI A;  5C4F A;  1G3L A;  4FRB A;  3U2U A;  3V91 A;  2OI6 A;  4E1K A;  5C8R A;  4FRE A;  3BRK X;  2J0B A;  1H5S D;  3SXE A;  5C3D A;  4XWI A;  3ZLL A;  5CQN X;  1H5R B;  1OMZ A;  1ZJP A;  4HO2 A;  4Q7C A;  2Y6P A;  4ECM A;  2RJ1 A;  1GWV A;  4KXO A;  1GX0 A;  2JCJ A;  3SX5 A;  3D8V A;  3DUV A;  3GUE A;  3Q80 A;  3U0X A;  1NQI B;  4B4G A;  2WAW A;  1WT1 A;  1HM9 A;  3PNN A;  4G3S A;  3OH2 A;  4FRM A;  2I5K A;  3CKN A;  4D48 A;  2X60 A;  5C48 A;  2Z87 A;  4CJ8 A;  5C36 A;  1VH3 A;  1ZJ1 A;  2AE7 A;  3PKP A;  2RIT A;  1ZJ2 A;  5C4E A;  1WT2 A;  1H5T B;  4EVW A;  1H5S B;  4HCQ A;  5FU8 A;  1H5S C;  3U2T A;  1G2V A;  4FCU A;  2A8W A;  2AES A;  3DJ4 A;  4Y7G A;  4KT7 A;  4Y64 A;  3RSB A;  3I0I X;  3V0M A;  3CKJ A;  2PGY A;  4JD0 A;  1H3M A;  1VZX A;  4Y9X A;  4HO8 A;  3IOJ A;  2RIZ A;  4AYJ A;  3BCV A;  1VZT A;  4G3Q A;  5BXC A;  1JYL A;  2JCK A;  2BO7 A;  1VIC A;  1R81 A;  1FR9 A;  2VXL A;  3OAM A;  5FYE A;  3R3I A;  2WVK A;  1WT0 A; 
#chains in the Genus database with same CATH homology
 4NAI A;  3K8D A;  2XWN A;  4M2A A;  5FTV A;  3U0Y A;  1W57 A;  3SX7 A;  5I1F A;  2WVM A;  4EE4 A;  1LZ0 A;  5CQL X;  1R7V A;  4M2B A;  2VD4 A;  5C3A A;  3I0L A;  2D7I A;  1MP5 A;  1ZI1 A;  5C4B A;  2FYC B;  2WGZ A;  1VGT A;  1JV1 A;  1GA8 A;  1S4N A;  2GGQ A;  1H4D A;  3D5N A;  1VZU A;  1S4O A;  1NMM B;  2Z86 A;  3ST8 A;  4KNR A;  2OI5 A;  2RJ8 A;  2A8U A;  1G23 A;  2X5S A;  4G87 A;  3SX8 A;  4B5B A;  4AAW A;  2V0J A;  3QVB A;  4KC2 A;  3IOI A;  1VGU A;  2YQJ A;  4ZDQ A;  2AM5 A;  1R7X A;  2AEC A;  5C3B A;  2P6W A;  4AYL A;  4B2X A;  4D0Z A;  4KQL A;  4KC1 A;  1V83 A;  1ZDG A;  2QGI A;  3I0K A;  1FGX A;  1W55 A;  3ZGF A;  3SXC A;  1PZT A;  1ZJO A;  1Z90 A;  2VS4 A;  5CMI A;  2JCL A;  1JYK A;  2VS3 A;  4Y63 A;  4Y6U A;  1OMX A;  3LW6 A;  1IIN A;  1LL3 A;  5CQO A;  4ASJ A;  3OH4 A;  4GBP A;  2AM4 A;  2RIY A;  2YQC A;  5EIY A;  4HOC A;  4Y62 A;  2WEE A;  4G3P A;  1G0R A;  3SX3 A;  4YS8 A;  4UEG A;  3F1Y A;  4LW6 A;  3ZLK A;  4L41 C;  3CU0 A;  1FO8 A;  4MND A;  5C4C A;  4FIY A;  3SXB A;  2YC5 A;  5FV9 A;  3V0Q A;  3I0H A;  4FCE A;  4P00 A;  1O0R A;  2XME A;  4KC4 A;  3ZF8 A;  4MYB A;  5D92 A;  5L6V A;  4FRQ A;  2GGO A;  3V0N A;  1TW1 A;  2J0A A;  3KIA A;  1ZCU A;  1QG8 A;  1QGQ A;  4Y6N A;  2DPW A;  2FYD B;  4D11 A;  3CKV A;  1EYR A;  3RMW A;  3OH1 A;  2FY7 A;  2FYA A;  2W0V A;  1W77 A;  1NHE B;  1GQ9 A;  1JV3 A;  3OGZ A;  4EEO A;  1H7F A;  4B4B A;  3U2X A;  3PKQ A;  2RIX A;  5C47 A;  3F1C A;  1FWY A;  1TW5 A;  5AJN A;  2FFU A;  2PA4 A;  1E5K A;  3NGW A;  1H5R A;  2VK9 A;  2NXV A;  2PX7 A;  1G8O A;  1JVG A;  2RJ7 A;  2V0K A;  5FTS A;  3SPT A;  2AH9 A;  5IDS A;  1FXJ A;  3E26 A;  3I0E A;  2ZU7 A;  1ZCV A;  2RJ9 A;  2VSI A;  2O1F A;  2UX8 A;  2YQS A;  3T7N A;  2YC3 A;  1WSZ A;  1ON6 A;  2XMH A;  3RMV A;  5J49 A;  1MP3 A;  4AC3 A;  2AM3 A;  3SXD A;  1YP2 A;  1FXO A;  1R7Y A;  1FGG A;  4LW3 A;  2YCM A;  1ZJ0 A;  2RJ0 A;  2CU2 A;  1G1L A;  5C1G A;  4ASY A;  2BO6 A;  1ZCT A;  3T7O A;  2ZU9 A;  4BQH A;  1HM8 A;  3FWW A;  1TZF A;  3OC9 A;  4DEC A;  2OEG A;  4O6N A;  3V0O A;  5EJZ A;  1VPA A;  4IRP A;  5JQQ A;  5C1H A;  2FYB A;  1R7T A;  2X65 A;  2VFZ A;  4FQW A;  2WE9 A;  1INJ A;  1LL0 A;  3TQD A;  3K8E A;  4B2W A;  5L6S A;  4O6M A;  3D98 A;  2D7R A;  3OH3 A;  4KNX A;  5IDT A;  1OQM B;  2X5Z A;  3V0L A;  3SXA A;  1H4C A;  4ARW A;  1LVW A;  1INI A;  3I0J A;  2P72 A;  4EEG A;  2Y7A A;  4FRL A;  3U2V A;  1YP4 A;  2JCO A;  2D0J A;  4EE3 A;  1H7H A;  5AJP A;  5EJ1 A;  3CGX A;  1IIM A;  1H7G A;  3I0F A;  2QKX A;  2E8B A;  3SXG A;  5FUH A;  4BMA A;  3R2W A;  1MC3 A;  2W0W A;  1QWJ A;  2V0I A;  4KPZ A;  1HJL A;  1XZ6 A;  3U2W A;  4CJC A;  5DDT A;  1R80 A;  4HO5 A;  1KWS A;  1NKH B;  4MIX A;  2I7B A;  2APC A;  1FOA A;  2BO4 A;  1R7U A;  4D11 C;  4B4M A;  2P73 A;  4FRD A;  2OI7 A;  1R82 A;  4EE5 A;  4Y7V A;  2O1H A;  1FG5 N;  2BO8 A;  4HO0 A;  4HO4 A;  2RJ4 A;  4EEM A;  4Y7T A;  1ZIZ A;  4NAK A;  2PGV A;  1ZI4 A;  3I0G A;  4Y7U A;  2MZB A;  2V0H A;  3CKO A;  4P02 A;  5AJO A;  2YQH A;  4HO9 A;  4Y7F A;  1VH1 A;  1FR8 A;  3JTJ A;  4JIS A;  3DK5 A;  4J18 A;  4K6R A;  2ZU8 A;  3JUK A;  1GQC A;  1JVD A;  2XWL A;  1ZI5 A;  5D91 A;  3V8Z A;  4KPX A;  5DDV A;  5HS2 A;  1NF5 B;  2Y4K A;  3V8Y A;  2ICY A;  5CMG X;  5C1L A;  1ZHJ A;  2E3D A;  3POL A;  1H7L A;  4NAL A;  3OH0 A;  4HO6 A;  3TZT A;  4R7P A;  5C49 A;  2O1G A;  4HG6 A;  1HJJ A;  4CJB A;  4DDZ A;  1NWG B;  4HO3 A;  5CMF X;  3I0D A;  1H5T A;  1ZJ3 A;  3EE5 A;  1H5S A;  1WT3 A;  1XHB A;  2RJ6 A;  4FRP A;  2OEF A;  3CKQ A;  2VXM A;  3E25 A;  4NAN A;  1MP4 A;  4M4K A;  1PZY B;  3USR A;  1VGZ A;  2Q4J A;  2I5E A;  2C0N A;  2AGD A;  1V84 A;  3O3P A;  1GWW A;  1G9R A;  1ZDF A;  3Q7U A;  1WVC A;  5FU0 A;  1FRW A;  5CQP A;  4EEA A;  3USQ A;  1ZCY A;  1H7Q A;  2WVL A;  4FRH A;  3FOQ A;  1VM8 A;  1GX4 A;  2QH5 A;  2RJ5 A;  2Y4L A;  1O7Q A;  1H7T A;  2VS5 A;  2V0L A;  1YRO B;  4M28 A;  1YP3 A;  1FO9 A;  4FRO A;  4D0T A;  2VSH A;  2YES A;  5IFY A;  4KRV A;  1VGW A;  2Y4M A;  1HM0 A;  1H4E A;  5C4D A;  5CMJ A;  2XWM A;  1ON8 A;  1S4P A;  1V82 A;  1HV9 A;  1LZI A;  1G97 A;  1SS9 A;  2ICX A;  3V90 A;  1G93 A;  2Y4J A;  4B3U A;  5CMH A;  3IOH A;  1O23 B;  3N9W A;  4CVH A;  1TVY A;  3Q4S A;  1G95 A;  1LL2 A;  4DE7 A;  4FIX A;  3OKR A;  1K4V A;  4FRA A;  1LZJ A;  3T7M A;  1FZW A;  1LZ7 A;  3HL3 A;  4B42 A;  2FFV A;  3I0C A;  4IRQ A;  3V0P A;  1ZI3 A;  1H7E A;  1I52 A;  5CQM X;  5C38 A;  1QGS A;  4C2S A;  3ZGG A;  1O7O A;  3JUJ A;  1EZI A;  5C4F A;  1G3L A;  4FRB A;  3U2U A;  3V91 A;  2OI6 A;  4E1K A;  5C8R A;  4FRE A;  3BRK X;  2J0B A;  1H5S D;  3SXE A;  5C3D A;  4XWI A;  3ZLL A;  5CQN X;  1H5R B;  1OMZ A;  1ZJP A;  4HO2 A;  4Q7C A;  2Y6P A;  4ECM A;  2RJ1 A;  1GWV A;  4KXO A;  1GX0 A;  2JCJ A;  3SX5 A;  3D8V A;  3DUV A;  3GUE A;  3Q80 A;  3U0X A;  1NQI B;  4B4G A;  2WAW A;  1WT1 A;  1HM9 A;  3PNN A;  4G3S A;  3OH2 A;  4FRM A;  2I5K A;  3CKN A;  4D48 A;  2X60 A;  5C48 A;  2Z87 A;  4CJ8 A;  5C36 A;  1VH3 A;  1ZJ1 A;  2AE7 A;  3PKP A;  2RIT A;  1ZJ2 A;  5C4E A;  1WT2 A;  1H5T B;  4EVW A;  1H5S B;  4HCQ A;  5FU8 A;  1H5S C;  3U2T A;  1G2V A;  4FCU A;  2A8W A;  2AES A;  3DJ4 A;  4Y7G A;  4KT7 A;  4Y64 A;  3RSB A;  3I0I X;  3V0M A;  3CKJ A;  2PGY A;  4JD0 A;  1H3M A;  1VZX A;  4Y9X A;  4HO8 A;  3IOJ A;  2RIZ A;  4AYJ A;  3BCV A;  1VZT A;  4G3Q A;  5BXC A;  1JYL A;  2JCK A;  2BO7 A;  1VIC A;  1R81 A;  1FR9 A;  2VXL A;  3OAM A;  5FYE A;  3R3I A;  2WVK A;  1WT0 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...