5C4BA

Crystal structure of gta + udp-glc + di
Total Genus 92
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
92
sequence length
288
structure length
288
Chain Sequence
AIGEFMVSLPRMVYPQPKVLTPCRKDVLVVTPWLAPIVWEGTFNIDILNEQFRLQNTTIGLTVFAIKKYVAFLKLFLETAEKHFMVGHRVHYYVFTDQPAAVPRVTLGTGRQLSVLEVRAYKRWQDVSMRRMEMISDFCERRFLSEVDYLVCVDVDMEFRDHVGVEILTPLFGTLHPGFYGSSREAFTYERRPQSQAYIPKDEGDFYYLGGFFGGSVQEVQRLTRACHQAMMVDQANGIEAVWHDESHLNKYLLRHKPTKVLSPEYLWDQQLLGWPAVLRKLRFTAVP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords Histo-blood group ABO system transferase
publication title High Resolution Structures of the Human ABO(H) Blood Group Enzymes in Complex with Donor Analogs Reveal That the Enzymes Utilize Multiple Donor Conformations to Bind Substrates in a Stepwise Manner.
pubmed doi rcsb
source organism Homo sapiens
total genus 92
structure length 288
sequence length 288
ec nomenclature ec 2.4.1.37: Fucosylgalactoside 3-alpha-galactosyltransferase.
pdb deposition date 2015-06-17
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.550.10 Alpha Beta Alpha-Beta Complex Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A 5c4bA00
4D11C 3KIAA 2JCJA 2OI6A 1JYKA 3OGZA 4HG6A 2UX8A 4Y6NA 2FYBA 2YCMA 2VXLA 1WT3A 4DDZA 1H5RB 1TVYA 3CKJA 1G97A 4HO4A 4DE7A 4CVHA 5CQPA 3RMWA 3O3PA 1INIA 1G3LA 1OQMB 2WVLA 1R82A 2E3DA 1TW1A 5JQQA 2VFZA 1ZJOA 4KXOA 1WVCA 1R7VA 5J49A 4AYJA 4B3UA 5FTSA 4ASJA 5FV9A 3I0LA 1VICA 3QVBA 4KPXA 1VGUA 1ZCVA 2FFUA 5CMIA 5FUHA 1NWGB 1GQCA 3SXAA 4Y7UA 4FRBA 5C3DA 4KC4A 5C47A 3ZLLA 5FTVA 2WEEA 2P6WA 4CJ8A 4DECA 2O1GA 1VPAA 4EE5A 1ZCYA 4B2WA 5C48A 4KRVA 1EYRA 4KQLA 3Q80A 4FQWA 1QG8A 1JV3A 5DDTA 4HO5A 5AJNA 5DDVA 4BMAA 3CKNA 3D8VA 2P73A 3PKQA 2AM4A 3JTJA 5AJOA 2YESA 1H4CA 1H5SB 3RSBA 3U2WA 4M2BA 3V90A 2PGYA 2V0IA 4LW6A 2CU2A 1MP5A 1FO9A 3K8DA 1HM0A 2AE7A 2D7RA 2XWMA 4Y62A 4EEGA 2XMHA 1IIMA 2W0VA 5AJPA 5L6SA 4P02A 1S4NA 1IINA 2BO7A 4KC2A 3OH2A 4Y63A 1H7GA 3SX5A 1XZ6A 1W57A 4IRQA 3LW6A 4NAKA 4KNXA 1FR8A 4ZDQA 1V82A 5C8RA 2DPWA 2RJ8A 2OI7A 1WT1A 2VS3A 2D0JA 4G87A 5CMFX 1HJJA 3U2VA 2ZU9A 1K4VA 3K8EA 3IOIA 1W77A 1HJLA 1H7FA 3I0KA 2V0KA 4CJCA 2V0LA 3Q7UA 4HOCA 1NMMB 1VZUA 5CMGX 3GUEA 2PGVA 2RITA 4D48A 4M4KA 1S4OA 3HL3A 3I0EA 2P72A 3CGXA 2RJ6A 1QGQA 3USRA 4HO8A 3SX3A 1VH3A 3SX7A 1R7YA 2GGQA 2A8UA 2E8BA 3ZGGA 4Y6UA 4CJBA 4C2SA 3V8YA 4MNDA 1MC3A 2X5ZA 2JCOA 1ZDGA 2O1FA 1G9RA 1JVGA 1O7QA 1MP4A 4EVWA 4AC3A 2RJ9A 5EJZA 5FU8A 2VXMA 2PA4A 1LZ7A 3U2TA 3U0YA 4MYBA 2AESA 2ZU7A 1HM8A 3U0XA 5C4CA 1NHEB 5C4BA 1LZIA 2RIXA 3I0IX 3N9WA 2D7IA 3IOHA 3DUVA 2Y6PA 2X65A 1ZJ1A 4LW3A 1H5SC 4NAIA 4FCEA 1E5KA 4ARWA 2RJ1A 4NANA 2AM3A 1FG5N 4P00A 1ZI1A 3DJ4A 1H7HA 1YP2A 3CU0A 3POLA 2VS4A 1HM9A 2OI5A 2Y4MA 1G93A 3FWWA 1WT0A 2XWNA 1S4PA 2FY7A 4R7PA 2BO4A 2QKXA 2APCA 1JV1A 3T7MA 3F1CA 1FXJA 4UEGA 1WSZA 1ZIZA 5CMHA 1FWYA 2MZBA 2X60A 1NKHB 1H3MA 3V0MA 4EEAA 5CMJA 4FRQA 4M28A 1H7LA 1O23B 4B4MA 4ECMA 2WGZA 5HS2A 4HCQA 2OEFA 1KWSA 1FRWA 3IOJA 5C4EA 2V0JA 1ZJPA 2I5KA 2YQSA 1GA8A 2YQCA 4B4BA 4EE4A 2JCLA 1GX4A 3D5NA 3JUKA 5C3AA 3R3IA 1VGZA 1V83A 3SX8A 3V8ZA 4FCUA 1VM8A 3TQDA 4Y9XA 2Y7AA 1H7TA 1INJA 2AH9A 2RJ7A 3SXGA 4KC1A 2RJ0A 2WVKA 2Y4JA 4FROA 2YC5A 3CKVA 1TW5A 1LZJA 4KPZA 1GQ9A 2Y4KA 1QWJA 2WE9A 2FYCB 5C1HA 2VSIA 2YC3A 1ZHJA 2ZU8A 4KNRA 4IRPA 4FREA 4E1KA 1VGTA 2I5EA 3E25A 3SXCA 1WT2A 1ZDFA 3PNNA 1PZYB 2A8WA 4K6RA 3F1YA 1GWVA 1VGWA 1R7XA 5CQOA 3U2UA 2RJ5A 2Z86A 3V0PA 1ZI3A 1H4EA 5C4FA 2GGOA 4J18A 1FO8A 2OEGA 1ZI5A 1H5TB 3T7OA 2FYDB 3OC9A 2FFVA 2FYAA 3OH3A 3SPTA 5C1LA 4M2AA 1H5TA 1G2VA 3I0DA 4B2XA 4Y64A 1H7EA 5CQNX 4B42A 1YROB 1HV9A 4L41C 3BCVA 1EZIA 1ZJ3A 1G8OA 4Y7TA 2NXVA 4Y7VA 1TZFA 3I0FA 4JISA 2ICXA 3NGWA 4GBPA 1FOAA 3V0OA 1OMXA 2VS5A 1G0RA 2Z87A 1VH1A 2ICYA 3EE5A 4NALA 2AECA 4FRDA 3V0QA 2YQHA 3OH1A 1FGXA 2Q4JA 4YS8A 3ZLKA 5CQLX 1R81A 4AAWA 1QGSA 2V0HA 4G3SA 5EJ1A 2Y4LA 1H5RA 1LL2A 3V91A 4D0ZA 1R80A 3BRKX 1W55A 1GWWA 2AGDA 3V0NA 5C1GA 2WVMA 1LL0A 4XWIA 2YQJA 3R2WA 1OMZA 1NF5B 1FZWA 5C49A 2QH5A 2PX7A 3CKOA 4Y7GA 1G1LA 2X5SA 4EEMA 4G3PA 4D11A 4D0TA 3ZGFA 5EIYA 1SS9A 2O1HA 4FRMA 3OH0A 4HO3A 3V0LA 5C38A 3OAMA 2QGIA 1ZJ2A 4EEOA 1JYLA 3U2XA 3DK5A 1YP3A 1GX0A 4KT7A 2AM5A 2JCKA 2XWLA 4HO2A 3JUJA 3PKPA 3FOQA 5I1FA 1MP3A 5IDTA 1LVWA 1NQIB 1ON8A 2I7BA 4FRPA 1H4DA 3T7NA 3I0CA 1FR9A 1I52A 2W0WA 3D98A 3RMVA 3I0JA 2RIZA 2RJ4A 4EE3A 3ST8A 1JVDA 1H5SA 1ZCTA 2RIYA 1G95A 4FRAA 4B4GA 4AYLA 5IDSA 5C3BA 1H7QA 4HO9A 2WAWA 1FXOA 1FGGA 1G23A 5C36A 5L6VA 5FYEA 4BQHA 1ZJ0A 4HO0A 2VD4A 3TZTA 1VZTA 2BO6A 3SXEA 2XMEA 2BO8A 3I0GA 1R7TA 1R7UA 3E26A 4G3QA 5C4DA 1ZCUA 1VZXA 4FRHA 4ASYA 1O0RA 5IFYA 3OKRA 1Z90A 4HO6A 3ZF8A 3SXDA 1LZ0A 3OH4A 4FRLA 5CQMX 3SXBA 1LL3A 1YP4A 2VSHA 3I0HA 3CKQA 1ON6A 3Q4SA 4B5BA 1ZI4A 1H5SD 1V84A 5FU0A 3USQA 4JD0A 1O7OA 1XHBA 4Y7FA 5BXCA 1PZTA
chains in the Genus database with same CATH superfamily
4D11C 3KIAA 2JCJA 2OI6A 4O6MA 1JYKA 3OGZA 4HG6A 2UX8A 4Y6NA 2FYBA 2YCMA 2VXLA 1WT3A 4DDZA 1H5RB 1TVYA 3CKJA 1G97A 4HO4A 4DE7A 4CVHA 5CQPA 3RMWA 3O3PA 1INIA 1G3LA 1OQMB 4O6NA 2WVLA 1R82A 2E3DA 1TW1A 5JQQA 2VFZA 1ZJOA 4KXOA 1WVCA 1R7VA 5J49A 4AYJA 4B3UA 5FTSA 4ASJA 5FV9A 3I0LA 1VICA 3QVBA 4KPXA 1VGUA 1ZCVA 2FFUA 5CMIA 5FUHA 1NWGB 1GQCA 3SXAA 4Y7UA 4FRBA 5C3DA 4KC4A 5C47A 3ZLLA 2VK9A 5FTVA 2WEEA 2P6WA 4CJ8A 4DECA 2O1GA 1VPAA 4EE5A 1ZCYA 4B2WA 5C48A 4KRVA 1EYRA 4KQLA 3Q80A 4FQWA 1QG8A 1JV3A 5DDTA 4HO5A 5AJNA 5DDVA 4BMAA 3CKNA 3D8VA 2P73A 3PKQA 2AM4A 3JTJA 5AJOA 2YESA 1H4CA 1H5SB 3RSBA 3U2WA 4M2BA 3V90A 2PGYA 2V0IA 4LW6A 2CU2A 1MP5A 1FO9A 3K8DA 1HM0A 4MIXA 2AE7A 2D7RA 2XWMA 4Y62A 4EEGA 2XMHA 1IIMA 2W0VA 5AJPA 5L6SA 4P02A 1S4NA 5D92A 1IINA 2BO7A 4KC2A 3OH2A 4Y63A 1H7GA 3SX5A 1XZ6A 1W57A 4IRQA 3LW6A 4NAKA 4KNXA 1FR8A 4ZDQA 1V82A 5C8RA 2DPWA 2RJ8A 2OI7A 1WT1A 2VS3A 2D0JA 4G87A 5CMFX 1HJJA 3U2VA 2ZU9A 1K4VA 3K8EA 3IOIA 1W77A 1HJLA 1H7FA 3I0KA 2V0KA 4CJCA 2V0LA 3Q7UA 4HOCA 1NMMB 1VZUA 5CMGX 3GUEA 2PGVA 2RITA 4D48A 4M4KA 1S4OA 3HL3A 3I0EA 2P72A 3CGXA 2RJ6A 1QGQA 3USRA 4HO8A 3SX3A 1VH3A 3SX7A 1R7YA 2GGQA 2A8UA 2E8BA 3ZGGA 4Y6UA 4CJBA 4C2SA 3V8YA 4MNDA 1MC3A 2X5ZA 2JCOA 1ZDGA 2O1FA 1G9RA 1JVGA 1O7QA 1MP4A 4EVWA 4AC3A 2RJ9A 5EJZA 5FU8A 2VXMA 2PA4A 1LZ7A 3U2TA 3U0YA 4MYBA 2AESA 2ZU7A 1HM8A 3U0XA 5C4CA 1NHEB 5C4BA 1LZIA 2RIXA 3I0IX 3N9WA 2D7IA 3IOHA 3DUVA 2Y6PA 2X65A 1ZJ1A 4LW3A 1H5SC 4NAIA 4FCEA 1E5KA 4ARWA 2RJ1A 4NANA 2AM3A 1FG5N 4P00A 1ZI1A 3DJ4A 1H7HA 1YP2A 3CU0A 3POLA 2VS4A 1HM9A 2OI5A 2Y4MA 1G93A 3FWWA 1WT0A 2XWNA 1S4PA 2FY7A 4R7PA 2BO4A 2QKXA 2APCA 1JV1A 3T7MA 3F1CA 1FXJA 4UEGA 1WSZA 1ZIZA 5CMHA 1FWYA 2MZBA 2X60A 1NKHB 1H3MA 3V0MA 4EEAA 5CMJA 4FRQA 4M28A 1H7LA 5D91A 1O23B 4B4MA 4ECMA 2WGZA 5HS2A 4HCQA 2OEFA 1KWSA 2J0AA 1FRWA 3IOJA 5C4EA 2V0JA 1ZJPA 2I5KA 2YQSA 1GA8A 2YQCA 4B4BA 4EE4A 2JCLA 1GX4A 3D5NA 3JUKA 5C3AA 3R3IA 1VGZA 1V83A 3SX8A 3V8ZA 4FCUA 1VM8A 3TQDA 4Y9XA 2Y7AA 1H7TA 1INJA 2AH9A 2RJ7A 3SXGA 4KC1A 2RJ0A 2WVKA 2Y4JA 4FROA 2YC5A 3CKVA 1TW5A 1LZJA 4KPZA 1GQ9A 2Y4KA 1QWJA 2WE9A 2FYCB 5C1HA 2VSIA 2YC3A 1ZHJA 2ZU8A 4KNRA 4IRPA 4FREA 4E1KA 1VGTA 2I5EA 3E25A 3SXCA 1WT2A 1ZDFA 3PNNA 1PZYB 2A8WA 4K6RA 3F1YA 1GWVA 1VGWA 1R7XA 5CQOA 3U2UA 2RJ5A 2Z86A 3V0PA 1ZI3A 1H4EA 5C4FA 2GGOA 4J18A 1FO8A 2OEGA 1ZI5A 1H5TB 3T7OA 2FYDB 3OC9A 2FFVA 2FYAA 3OH3A 3SPTA 5C1LA 4M2AA 1H5TA 1G2VA 3I0DA 4B2XA 4Y64A 1H7EA 5CQNX 4B42A 1YROB 1HV9A 4L41C 3BCVA 1EZIA 1ZJ3A 1G8OA 4Y7TA 2NXVA 4Y7VA 1TZFA 3I0FA 4JISA 2ICXA 3NGWA 4GBPA 1FOAA 3V0OA 1OMXA 2VS5A 1G0RA 2Z87A 1VH1A 2ICYA 3EE5A 4NALA 2AECA 4FIXA 4FRDA 3V0QA 2YQHA 3OH1A 1FGXA 2Q4JA 4YS8A 3ZLKA 5CQLX 1R81A 4AAWA 1QGSA 2V0HA 4G3SA 5EJ1A 2Y4LA 1H5RA 1LL2A 3V91A 4D0ZA 1R80A 3BRKX 1W55A 1GWWA 2AGDA 3V0NA 5C1GA 2WVMA 1LL0A 2C0NA 4XWIA 2YQJA 3R2WA 1OMZA 1NF5B 1FZWA 5C49A 2QH5A 2PX7A 3CKOA 4Y7GA 1G1LA 2X5SA 4EEMA 4G3PA 4D11A 4D0TA 3ZGFA 5EIYA 1SS9A 2O1HA 4FRMA 3OH0A 4HO3A 3V0LA 5C38A 3OAMA 2QGIA 1ZJ2A 4EEOA 1JYLA 3U2XA 3DK5A 1YP3A 1GX0A 4KT7A 2AM5A 2JCKA 2XWLA 4HO2A 3JUJA 3PKPA 3FOQA 5I1FA 1MP3A 5IDTA 1LVWA 1NQIB 1ON8A 2I7BA 4FRPA 1H4DA 3T7NA 3I0CA 1FR9A 1I52A 2W0WA 3D98A 3RMVA 3I0JA 2RIZA 2RJ4A 4EE3A 3ST8A 1JVDA 4Q7CA 1H5SA 1ZCTA 2RIYA 1G95A 4FRAA 4B4GA 4AYLA 5IDSA 5C3BA 1H7QA 4HO9A 2WAWA 1FXOA 4FIYA 1FGGA 1G23A 5C36A 5L6VA 5FYEA 4BQHA 1ZJ0A 4HO0A 2VD4A 3TZTA 1VZTA 2BO6A 3SXEA 2XMEA 2BO8A 2J0BA 3I0GA 1R7TA 1R7UA 3E26A 4G3QA 5C4DA 1ZCUA 1VZXA 4FRHA 4ASYA 1O0RA 5IFYA 3OKRA 1Z90A 4HO6A 3ZF8A 3SXDA 1LZ0A 3OH4A 4FRLA 5CQMX 3SXBA 1LL3A 1YP4A 2VSHA 3I0HA 3CKQA 1ON6A 3Q4SA 4B5BA 1ZI4A 1H5SD 1V84A 5FU0A 3USQA 4JD0A 1O7OA 1XHBA 4Y7FA 5BXCA 1PZTA
chains in the Genus database with same CATH topology
4D11C 3KIAA 2JCJA 2OI6A 4O6MA 1JYKA 3OGZA 4HG6A 2UX8A 4Y6NA 2FYBA 2YCMA 2VXLA 1WT3A 4DDZA 1H5RB 1TVYA 3CKJA 1G97A 4HO4A 4DE7A 4CVHA 5CQPA 3RMWA 3O3PA 1INIA 1G3LA 1OQMB 4O6NA 2WVLA 1R82A 2E3DA 1TW1A 5JQQA 2VFZA 1ZJOA 4KXOA 1WVCA 1R7VA 5J49A 4AYJA 4B3UA 5FTSA 4ASJA 5FV9A 3I0LA 1VICA 3QVBA 4KPXA 1VGUA 1ZCVA 2FFUA 5CMIA 5FUHA 1NWGB 1GQCA 3SXAA 4Y7UA 4FRBA 5C3DA 4KC4A 5C47A 3ZLLA 2VK9A 5FTVA 2WEEA 2P6WA 4CJ8A 4DECA 2O1GA 1VPAA 4EE5A 1ZCYA 4B2WA 5C48A 4KRVA 1EYRA 4KQLA 3Q80A 4FQWA 1QG8A 1JV3A 5DDTA 4HO5A 5AJNA 5DDVA 4BMAA 3CKNA 3D8VA 2P73A 3PKQA 2AM4A 3JTJA 5AJOA 2YESA 1H4CA 1H5SB 3RSBA 3U2WA 4M2BA 3V90A 2PGYA 2V0IA 4LW6A 2CU2A 1MP5A 1FO9A 3K8DA 1HM0A 4MIXA 2AE7A 2D7RA 2XWMA 4Y62A 4EEGA 2XMHA 1IIMA 2W0VA 5AJPA 5L6SA 4P02A 1S4NA 5D92A 1IINA 2BO7A 4KC2A 3OH2A 4Y63A 1H7GA 3SX5A 1XZ6A 1W57A 4IRQA 3LW6A 4NAKA 4KNXA 1FR8A 4ZDQA 1V82A 5C8RA 2DPWA 2RJ8A 2OI7A 1WT1A 2VS3A 2D0JA 4G87A 5CMFX 1HJJA 3U2VA 2ZU9A 1K4VA 3K8EA 3IOIA 1W77A 1HJLA 1H7FA 3I0KA 2V0KA 4CJCA 2V0LA 3Q7UA 4HOCA 1NMMB 1VZUA 5CMGX 3GUEA 2PGVA 2RITA 4D48A 4M4KA 1S4OA 3HL3A 3I0EA 2P72A 3CGXA 2RJ6A 1QGQA 3USRA 4HO8A 3SX3A 1VH3A 3SX7A 1R7YA 2GGQA 2A8UA 2E8BA 3ZGGA 4Y6UA 4CJBA 4C2SA 3V8YA 4MNDA 1MC3A 2X5ZA 2JCOA 1ZDGA 2O1FA 1G9RA 1JVGA 1O7QA 1MP4A 4EVWA 4AC3A 2RJ9A 5EJZA 5FU8A 2VXMA 2PA4A 1LZ7A 3U2TA 3U0YA 4MYBA 2AESA 2ZU7A 1HM8A 3U0XA 5C4CA 1NHEB 5C4BA 1LZIA 2RIXA 3I0IX 3N9WA 2D7IA 3IOHA 3DUVA 2Y6PA 2X65A 1ZJ1A 4LW3A 1H5SC 4NAIA 4FCEA 1E5KA 4ARWA 2RJ1A 4NANA 2AM3A 1FG5N 4P00A 1ZI1A 3DJ4A 1H7HA 1YP2A 3CU0A 3POLA 2VS4A 1HM9A 2OI5A 2Y4MA 1G93A 3FWWA 1WT0A 2XWNA 1S4PA 2FY7A 4R7PA 2BO4A 2QKXA 2APCA 1JV1A 3T7MA 3F1CA 1FXJA 4UEGA 1WSZA 1ZIZA 5CMHA 1FWYA 2MZBA 2X60A 1NKHB 1H3MA 3V0MA 4EEAA 5CMJA 4FRQA 4M28A 1H7LA 5D91A 1O23B 4B4MA 4ECMA 2WGZA 5HS2A 4HCQA 2OEFA 1KWSA 2J0AA 1FRWA 3IOJA 5C4EA 2V0JA 1ZJPA 2I5KA 2YQSA 1GA8A 2YQCA 4B4BA 4EE4A 2JCLA 1GX4A 3D5NA 3JUKA 5C3AA 3R3IA 1VGZA 1V83A 3SX8A 3V8ZA 4FCUA 1VM8A 3TQDA 4Y9XA 2Y7AA 1H7TA 1INJA 2AH9A 2RJ7A 3SXGA 4KC1A 2RJ0A 2WVKA 2Y4JA 4FROA 2YC5A 3CKVA 1TW5A 1LZJA 4KPZA 1GQ9A 2Y4KA 1QWJA 2WE9A 2FYCB 5C1HA 2VSIA 2YC3A 1ZHJA 2ZU8A 4KNRA 4IRPA 4FREA 4E1KA 1VGTA 2I5EA 3E25A 3SXCA 1WT2A 1ZDFA 3PNNA 1PZYB 2A8WA 4K6RA 3F1YA 1GWVA 1VGWA 1R7XA 5CQOA 3U2UA 2RJ5A 2Z86A 3V0PA 1ZI3A 1H4EA 5C4FA 2GGOA 4J18A 1FO8A 2OEGA 1ZI5A 1H5TB 3T7OA 2FYDB 3OC9A 2FFVA 2FYAA 3OH3A 3SPTA 5C1LA 4M2AA 1H5TA 1G2VA 3I0DA 4B2XA 4Y64A 1H7EA 5CQNX 4B42A 1YROB 1HV9A 4L41C 3BCVA 1EZIA 1ZJ3A 1G8OA 4Y7TA 2NXVA 4Y7VA 1TZFA 3I0FA 4JISA 2ICXA 3NGWA 4GBPA 1FOAA 3V0OA 1OMXA 2VS5A 1G0RA 2Z87A 1VH1A 2ICYA 3EE5A 4NALA 2AECA 4FIXA 4FRDA 3V0QA 2YQHA 3OH1A 1FGXA 2Q4JA 4YS8A 3ZLKA 5CQLX 1R81A 4AAWA 1QGSA 2V0HA 4G3SA 5EJ1A 2Y4LA 1H5RA 1LL2A 3V91A 4D0ZA 1R80A 3BRKX 1W55A 1GWWA 2AGDA 3V0NA 5C1GA 2WVMA 1LL0A 2C0NA 4XWIA 2YQJA 3R2WA 1OMZA 1NF5B 1FZWA 5C49A 2QH5A 2PX7A 3CKOA 4Y7GA 1G1LA 2X5SA 4EEMA 4G3PA 4D11A 4D0TA 3ZGFA 5EIYA 1SS9A 2O1HA 4FRMA 3OH0A 4HO3A 3V0LA 5C38A 3OAMA 2QGIA 1ZJ2A 4EEOA 1JYLA 3U2XA 3DK5A 1YP3A 1GX0A 4KT7A 2AM5A 2JCKA 2XWLA 4HO2A 3JUJA 3PKPA 3FOQA 5I1FA 1MP3A 5IDTA 1LVWA 1NQIB 1ON8A 2I7BA 4FRPA 1H4DA 3T7NA 3I0CA 1FR9A 1I52A 2W0WA 3D98A 3RMVA 3I0JA 2RIZA 2RJ4A 4EE3A 3ST8A 1JVDA 4Q7CA 1H5SA 1ZCTA 2RIYA 1G95A 4FRAA 4B4GA 4AYLA 5IDSA 5C3BA 1H7QA 4HO9A 2WAWA 1FXOA 4FIYA 1FGGA 1G23A 5C36A 5L6VA 5FYEA 4BQHA 1ZJ0A 4HO0A 2VD4A 3TZTA 1VZTA 2BO6A 3SXEA 2XMEA 2BO8A 2J0BA 3I0GA 1R7TA 1R7UA 3E26A 4G3QA 5C4DA 1ZCUA 1VZXA 4FRHA 4ASYA 1O0RA 5IFYA 3OKRA 1Z90A 4HO6A 3ZF8A 3SXDA 1LZ0A 3OH4A 4FRLA 5CQMX 3SXBA 1LL3A 1YP4A 2VSHA 3I0HA 3CKQA 1ON6A 3Q4SA 4B5BA 1ZI4A 1H5SD 1V84A 5FU0A 3USQA 4JD0A 1O7OA 1XHBA 4Y7FA 5BXCA 1PZTA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4D11 C;  3KIA A;  2JCJ A;  2OI6 A;  1JYK A;  3OGZ A;  4HG6 A;  2UX8 A;  4Y6N A;  2FYB A;  2YCM A;  2VXL A;  1WT3 A;  4DDZ A;  1H5R B;  1TVY A;  3CKJ A;  1G97 A;  4HO4 A;  4DE7 A;  4CVH A;  5CQP A;  3RMW A;  3O3P A;  1INI A;  1G3L A;  1OQM B;  2WVL A;  1R82 A;  2E3D A;  1TW1 A;  5JQQ A;  2VFZ A;  1ZJO A;  4KXO A;  1WVC A;  1R7V A;  5J49 A;  4AYJ A;  4B3U A;  5FTS A;  4ASJ A;  5FV9 A;  3I0L A;  1VIC A;  3QVB A;  4KPX A;  1VGU A;  1ZCV A;  2FFU A;  5CMI A;  5FUH A;  1NWG B;  1GQC A;  3SXA A;  4Y7U A;  4FRB A;  5C3D A;  4KC4 A;  5C47 A;  3ZLL A;  5FTV A;  2WEE A;  2P6W A;  4CJ8 A;  4DEC A;  2O1G A;  1VPA A;  4EE5 A;  1ZCY A;  4B2W A;  5C48 A;  4KRV A;  1EYR A;  4KQL A;  3Q80 A;  4FQW A;  1QG8 A;  1JV3 A;  5DDT A;  4HO5 A;  5AJN A;  5DDV A;  4BMA A;  3CKN A;  3D8V A;  2P73 A;  3PKQ A;  2AM4 A;  3JTJ A;  5AJO A;  2YES A;  1H4C A;  1H5S B;  3RSB A;  3U2W A;  4M2B A;  3V90 A;  2PGY A;  2V0I A;  4LW6 A;  2CU2 A;  1MP5 A;  1FO9 A;  3K8D A;  1HM0 A;  2AE7 A;  2D7R A;  2XWM A;  4Y62 A;  4EEG A;  2XMH A;  1IIM A;  2W0V A;  5AJP A;  5L6S A;  4P02 A;  1S4N A;  1IIN A;  2BO7 A;  4KC2 A;  3OH2 A;  4Y63 A;  1H7G A;  3SX5 A;  1XZ6 A;  1W57 A;  4IRQ A;  3LW6 A;  4NAK A;  4KNX A;  1FR8 A;  4ZDQ A;  1V82 A;  5C8R A;  2DPW A;  2RJ8 A;  2OI7 A;  1WT1 A;  2VS3 A;  2D0J A;  4G87 A;  5CMF X;  1HJJ A;  3U2V A;  2ZU9 A;  1K4V A;  3K8E A;  3IOI A;  1W77 A;  1HJL A;  1H7F A;  3I0K A;  2V0K A;  4CJC A;  2V0L A;  3Q7U A;  4HOC A;  1NMM B;  1VZU A;  5CMG X;  3GUE A;  2PGV A;  2RIT A;  4D48 A;  4M4K A;  1S4O A;  3HL3 A;  3I0E A;  2P72 A;  3CGX A;  2RJ6 A;  1QGQ A;  3USR A;  4HO8 A;  3SX3 A;  1VH3 A;  3SX7 A;  1R7Y A;  2GGQ A;  2A8U A;  2E8B A;  3ZGG A;  4Y6U A;  4CJB A;  4C2S A;  3V8Y A;  4MND A;  1MC3 A;  2X5Z A;  2JCO A;  1ZDG A;  2O1F A;  1G9R A;  1JVG A;  1O7Q A;  1MP4 A;  4EVW A;  4AC3 A;  2RJ9 A;  5EJZ A;  5FU8 A;  2VXM A;  2PA4 A;  1LZ7 A;  3U2T A;  3U0Y A;  4MYB A;  2AES A;  2ZU7 A;  1HM8 A;  3U0X A;  5C4C A;  1NHE B;  5C4B A;  1LZI A;  2RIX A;  3I0I X;  3N9W A;  2D7I A;  3IOH A;  3DUV A;  2Y6P A;  2X65 A;  1ZJ1 A;  4LW3 A;  1H5S C;  4NAI A;  4FCE A;  1E5K A;  4ARW A;  2RJ1 A;  4NAN A;  2AM3 A;  1FG5 N;  4P00 A;  1ZI1 A;  3DJ4 A;  1H7H A;  1YP2 A;  3CU0 A;  3POL A;  2VS4 A;  1HM9 A;  2OI5 A;  2Y4M A;  1G93 A;  3FWW A;  1WT0 A;  2XWN A;  1S4P A;  2FY7 A;  4R7P A;  2BO4 A;  2QKX A;  2APC A;  1JV1 A;  3T7M A;  3F1C A;  1FXJ A;  4UEG A;  1WSZ A;  1ZIZ A;  5CMH A;  1FWY A;  2MZB A;  2X60 A;  1NKH B;  1H3M A;  3V0M A;  4EEA A;  5CMJ A;  4FRQ A;  4M28 A;  1H7L A;  1O23 B;  4B4M A;  4ECM A;  2WGZ A;  5HS2 A;  4HCQ A;  2OEF A;  1KWS A;  1FRW A;  3IOJ A;  5C4E A;  2V0J A;  1ZJP A;  2I5K A;  2YQS A;  1GA8 A;  2YQC A;  4B4B A;  4EE4 A;  2JCL A;  1GX4 A;  3D5N A;  3JUK A;  5C3A A;  3R3I A;  1VGZ A;  1V83 A;  3SX8 A;  3V8Z A;  4FCU A;  1VM8 A;  3TQD A;  4Y9X A;  2Y7A A;  1H7T A;  1INJ A;  2AH9 A;  2RJ7 A;  3SXG A;  4KC1 A;  2RJ0 A;  2WVK A;  2Y4J A;  4FRO A;  2YC5 A;  3CKV A;  1TW5 A;  1LZJ A;  4KPZ A;  1GQ9 A;  2Y4K A;  1QWJ A;  2WE9 A;  2FYC B;  5C1H A;  2VSI A;  2YC3 A;  1ZHJ A;  2ZU8 A;  4KNR A;  4IRP A;  4FRE A;  4E1K A;  1VGT A;  2I5E A;  3E25 A;  3SXC A;  1WT2 A;  1ZDF A;  3PNN A;  1PZY B;  2A8W A;  4K6R A;  3F1Y A;  1GWV A;  1VGW A;  1R7X A;  5CQO A;  3U2U A;  2RJ5 A;  2Z86 A;  3V0P A;  1ZI3 A;  1H4E A;  5C4F A;  2GGO A;  4J18 A;  1FO8 A;  2OEG A;  1ZI5 A;  1H5T B;  3T7O A;  2FYD B;  3OC9 A;  2FFV A;  2FYA A;  3OH3 A;  3SPT A;  5C1L A;  4M2A A;  1H5T A;  1G2V A;  3I0D A;  4B2X A;  4Y64 A;  1H7E A;  5CQN X;  4B42 A;  1YRO B;  1HV9 A;  4L41 C;  3BCV A;  1EZI A;  1ZJ3 A;  1G8O A;  4Y7T A;  2NXV A;  4Y7V A;  1TZF A;  3I0F A;  4JIS A;  2ICX A;  3NGW A;  4GBP A;  1FOA A;  3V0O A;  1OMX A;  2VS5 A;  1G0R A;  2Z87 A;  1VH1 A;  2ICY A;  3EE5 A;  4NAL A;  2AEC A;  4FRD A;  3V0Q A;  2YQH A;  3OH1 A;  1FGX A;  2Q4J A;  4YS8 A;  3ZLK A;  5CQL X;  1R81 A;  4AAW A;  1QGS A;  2V0H A;  4G3S A;  5EJ1 A;  2Y4L A;  1H5R A;  1LL2 A;  3V91 A;  4D0Z A;  1R80 A;  3BRK X;  1W55 A;  1GWW A;  2AGD A;  3V0N A;  5C1G A;  2WVM A;  1LL0 A;  4XWI A;  2YQJ A;  3R2W A;  1OMZ A;  1NF5 B;  1FZW A;  5C49 A;  2QH5 A;  2PX7 A;  3CKO A;  4Y7G A;  1G1L A;  2X5S A;  4EEM A;  4G3P A;  4D11 A;  4D0T A;  3ZGF A;  5EIY A;  1SS9 A;  2O1H A;  4FRM A;  3OH0 A;  4HO3 A;  3V0L A;  5C38 A;  3OAM A;  2QGI A;  1ZJ2 A;  4EEO A;  1JYL A;  3U2X A;  3DK5 A;  1YP3 A;  1GX0 A;  4KT7 A;  2AM5 A;  2JCK A;  2XWL A;  4HO2 A;  3JUJ A;  3PKP A;  3FOQ A;  5I1F A;  1MP3 A;  5IDT A;  1LVW A;  1NQI B;  1ON8 A;  2I7B A;  4FRP A;  1H4D A;  3T7N A;  3I0C A;  1FR9 A;  1I52 A;  2W0W A;  3D98 A;  3RMV A;  3I0J A;  2RIZ A;  2RJ4 A;  4EE3 A;  3ST8 A;  1JVD A;  1H5S A;  1ZCT A;  2RIY A;  1G95 A;  4FRA A;  4B4G A;  4AYL A;  5IDS A;  5C3B A;  1H7Q A;  4HO9 A;  2WAW A;  1FXO A;  1FGG A;  1G23 A;  5C36 A;  5L6V A;  5FYE A;  4BQH A;  1ZJ0 A;  4HO0 A;  2VD4 A;  3TZT A;  1VZT A;  2BO6 A;  3SXE A;  2XME A;  2BO8 A;  3I0G A;  1R7T A;  1R7U A;  3E26 A;  4G3Q A;  5C4D A;  1ZCU A;  1VZX A;  4FRH A;  4ASY A;  1O0R A;  5IFY A;  3OKR A;  1Z90 A;  4HO6 A;  3ZF8 A;  3SXD A;  1LZ0 A;  3OH4 A;  4FRL A;  5CQM X;  3SXB A;  1LL3 A;  1YP4 A;  2VSH A;  3I0H A;  3CKQ A;  1ON6 A;  3Q4S A;  4B5B A;  1ZI4 A;  1H5S D;  1V84 A;  5FU0 A;  3USQ A;  4JD0 A;  1O7O A;  1XHB A;  4Y7F A;  5BXC A;  1PZT A; 
#chains in the Genus database with same CATH topology
 4D11 C;  3KIA A;  2JCJ A;  2OI6 A;  4O6M A;  1JYK A;  3OGZ A;  4HG6 A;  2UX8 A;  4Y6N A;  2FYB A;  2YCM A;  2VXL A;  1WT3 A;  4DDZ A;  1H5R B;  1TVY A;  3CKJ A;  1G97 A;  4HO4 A;  4DE7 A;  4CVH A;  5CQP A;  3RMW A;  3O3P A;  1INI A;  1G3L A;  1OQM B;  4O6N A;  2WVL A;  1R82 A;  2E3D A;  1TW1 A;  5JQQ A;  2VFZ A;  1ZJO A;  4KXO A;  1WVC A;  1R7V A;  5J49 A;  4AYJ A;  4B3U A;  5FTS A;  4ASJ A;  5FV9 A;  3I0L A;  1VIC A;  3QVB A;  4KPX A;  1VGU A;  1ZCV A;  2FFU A;  5CMI A;  5FUH A;  1NWG B;  1GQC A;  3SXA A;  4Y7U A;  4FRB A;  5C3D A;  4KC4 A;  5C47 A;  3ZLL A;  2VK9 A;  5FTV A;  2WEE A;  2P6W A;  4CJ8 A;  4DEC A;  2O1G A;  1VPA A;  4EE5 A;  1ZCY A;  4B2W A;  5C48 A;  4KRV A;  1EYR A;  4KQL A;  3Q80 A;  4FQW A;  1QG8 A;  1JV3 A;  5DDT A;  4HO5 A;  5AJN A;  5DDV A;  4BMA A;  3CKN A;  3D8V A;  2P73 A;  3PKQ A;  2AM4 A;  3JTJ A;  5AJO A;  2YES A;  1H4C A;  1H5S B;  3RSB A;  3U2W A;  4M2B A;  3V90 A;  2PGY A;  2V0I A;  4LW6 A;  2CU2 A;  1MP5 A;  1FO9 A;  3K8D A;  1HM0 A;  4MIX A;  2AE7 A;  2D7R A;  2XWM A;  4Y62 A;  4EEG A;  2XMH A;  1IIM A;  2W0V A;  5AJP A;  5L6S A;  4P02 A;  1S4N A;  5D92 A;  1IIN A;  2BO7 A;  4KC2 A;  3OH2 A;  4Y63 A;  1H7G A;  3SX5 A;  1XZ6 A;  1W57 A;  4IRQ A;  3LW6 A;  4NAK A;  4KNX A;  1FR8 A;  4ZDQ A;  1V82 A;  5C8R A;  2DPW A;  2RJ8 A;  2OI7 A;  1WT1 A;  2VS3 A;  2D0J A;  4G87 A;  5CMF X;  1HJJ A;  3U2V A;  2ZU9 A;  1K4V A;  3K8E A;  3IOI A;  1W77 A;  1HJL A;  1H7F A;  3I0K A;  2V0K A;  4CJC A;  2V0L A;  3Q7U A;  4HOC A;  1NMM B;  1VZU A;  5CMG X;  3GUE A;  2PGV A;  2RIT A;  4D48 A;  4M4K A;  1S4O A;  3HL3 A;  3I0E A;  2P72 A;  3CGX A;  2RJ6 A;  1QGQ A;  3USR A;  4HO8 A;  3SX3 A;  1VH3 A;  3SX7 A;  1R7Y A;  2GGQ A;  2A8U A;  2E8B A;  3ZGG A;  4Y6U A;  4CJB A;  4C2S A;  3V8Y A;  4MND A;  1MC3 A;  2X5Z A;  2JCO A;  1ZDG A;  2O1F A;  1G9R A;  1JVG A;  1O7Q A;  1MP4 A;  4EVW A;  4AC3 A;  2RJ9 A;  5EJZ A;  5FU8 A;  2VXM A;  2PA4 A;  1LZ7 A;  3U2T A;  3U0Y A;  4MYB A;  2AES A;  2ZU7 A;  1HM8 A;  3U0X A;  5C4C A;  1NHE B;  5C4B A;  1LZI A;  2RIX A;  3I0I X;  3N9W A;  2D7I A;  3IOH A;  3DUV A;  2Y6P A;  2X65 A;  1ZJ1 A;  4LW3 A;  1H5S C;  4NAI A;  4FCE A;  1E5K A;  4ARW A;  2RJ1 A;  4NAN A;  2AM3 A;  1FG5 N;  4P00 A;  1ZI1 A;  3DJ4 A;  1H7H A;  1YP2 A;  3CU0 A;  3POL A;  2VS4 A;  1HM9 A;  2OI5 A;  2Y4M A;  1G93 A;  3FWW A;  1WT0 A;  2XWN A;  1S4P A;  2FY7 A;  4R7P A;  2BO4 A;  2QKX A;  2APC A;  1JV1 A;  3T7M A;  3F1C A;  1FXJ A;  4UEG A;  1WSZ A;  1ZIZ A;  5CMH A;  1FWY A;  2MZB A;  2X60 A;  1NKH B;  1H3M A;  3V0M A;  4EEA A;  5CMJ A;  4FRQ A;  4M28 A;  1H7L A;  5D91 A;  1O23 B;  4B4M A;  4ECM A;  2WGZ A;  5HS2 A;  4HCQ A;  2OEF A;  1KWS A;  2J0A A;  1FRW A;  3IOJ A;  5C4E A;  2V0J A;  1ZJP A;  2I5K A;  2YQS A;  1GA8 A;  2YQC A;  4B4B A;  4EE4 A;  2JCL A;  1GX4 A;  3D5N A;  3JUK A;  5C3A A;  3R3I A;  1VGZ A;  1V83 A;  3SX8 A;  3V8Z A;  4FCU A;  1VM8 A;  3TQD A;  4Y9X A;  2Y7A A;  1H7T A;  1INJ A;  2AH9 A;  2RJ7 A;  3SXG A;  4KC1 A;  2RJ0 A;  2WVK A;  2Y4J A;  4FRO A;  2YC5 A;  3CKV A;  1TW5 A;  1LZJ A;  4KPZ A;  1GQ9 A;  2Y4K A;  1QWJ A;  2WE9 A;  2FYC B;  5C1H A;  2VSI A;  2YC3 A;  1ZHJ A;  2ZU8 A;  4KNR A;  4IRP A;  4FRE A;  4E1K A;  1VGT A;  2I5E A;  3E25 A;  3SXC A;  1WT2 A;  1ZDF A;  3PNN A;  1PZY B;  2A8W A;  4K6R A;  3F1Y A;  1GWV A;  1VGW A;  1R7X A;  5CQO A;  3U2U A;  2RJ5 A;  2Z86 A;  3V0P A;  1ZI3 A;  1H4E A;  5C4F A;  2GGO A;  4J18 A;  1FO8 A;  2OEG A;  1ZI5 A;  1H5T B;  3T7O A;  2FYD B;  3OC9 A;  2FFV A;  2FYA A;  3OH3 A;  3SPT A;  5C1L A;  4M2A A;  1H5T A;  1G2V A;  3I0D A;  4B2X A;  4Y64 A;  1H7E A;  5CQN X;  4B42 A;  1YRO B;  1HV9 A;  4L41 C;  3BCV A;  1EZI A;  1ZJ3 A;  1G8O A;  4Y7T A;  2NXV A;  4Y7V A;  1TZF A;  3I0F A;  4JIS A;  2ICX A;  3NGW A;  4GBP A;  1FOA A;  3V0O A;  1OMX A;  2VS5 A;  1G0R A;  2Z87 A;  1VH1 A;  2ICY A;  3EE5 A;  4NAL A;  2AEC A;  4FIX A;  4FRD A;  3V0Q A;  2YQH A;  3OH1 A;  1FGX A;  2Q4J A;  4YS8 A;  3ZLK A;  5CQL X;  1R81 A;  4AAW A;  1QGS A;  2V0H A;  4G3S A;  5EJ1 A;  2Y4L A;  1H5R A;  1LL2 A;  3V91 A;  4D0Z A;  1R80 A;  3BRK X;  1W55 A;  1GWW A;  2AGD A;  3V0N A;  5C1G A;  2WVM A;  1LL0 A;  2C0N A;  4XWI A;  2YQJ A;  3R2W A;  1OMZ A;  1NF5 B;  1FZW A;  5C49 A;  2QH5 A;  2PX7 A;  3CKO A;  4Y7G A;  1G1L A;  2X5S A;  4EEM A;  4G3P A;  4D11 A;  4D0T A;  3ZGF A;  5EIY A;  1SS9 A;  2O1H A;  4FRM A;  3OH0 A;  4HO3 A;  3V0L A;  5C38 A;  3OAM A;  2QGI A;  1ZJ2 A;  4EEO A;  1JYL A;  3U2X A;  3DK5 A;  1YP3 A;  1GX0 A;  4KT7 A;  2AM5 A;  2JCK A;  2XWL A;  4HO2 A;  3JUJ A;  3PKP A;  3FOQ A;  5I1F A;  1MP3 A;  5IDT A;  1LVW A;  1NQI B;  1ON8 A;  2I7B A;  4FRP A;  1H4D A;  3T7N A;  3I0C A;  1FR9 A;  1I52 A;  2W0W A;  3D98 A;  3RMV A;  3I0J A;  2RIZ A;  2RJ4 A;  4EE3 A;  3ST8 A;  1JVD A;  4Q7C A;  1H5S A;  1ZCT A;  2RIY A;  1G95 A;  4FRA A;  4B4G A;  4AYL A;  5IDS A;  5C3B A;  1H7Q A;  4HO9 A;  2WAW A;  1FXO A;  4FIY A;  1FGG A;  1G23 A;  5C36 A;  5L6V A;  5FYE A;  4BQH A;  1ZJ0 A;  4HO0 A;  2VD4 A;  3TZT A;  1VZT A;  2BO6 A;  3SXE A;  2XME A;  2BO8 A;  2J0B A;  3I0G A;  1R7T A;  1R7U A;  3E26 A;  4G3Q A;  5C4D A;  1ZCU A;  1VZX A;  4FRH A;  4ASY A;  1O0R A;  5IFY A;  3OKR A;  1Z90 A;  4HO6 A;  3ZF8 A;  3SXD A;  1LZ0 A;  3OH4 A;  4FRL A;  5CQM X;  3SXB A;  1LL3 A;  1YP4 A;  2VSH A;  3I0H A;  3CKQ A;  1ON6 A;  3Q4S A;  4B5B A;  1ZI4 A;  1H5S D;  1V84 A;  5FU0 A;  3USQ A;  4JD0 A;  1O7O A;  1XHB A;  4Y7F A;  5BXC A;  1PZT A; 
#chains in the Genus database with same CATH homology
 4D11 C;  3KIA A;  2JCJ A;  2OI6 A;  4O6M A;  1JYK A;  3OGZ A;  4HG6 A;  2UX8 A;  4Y6N A;  2FYB A;  2YCM A;  2VXL A;  1WT3 A;  4DDZ A;  1H5R B;  1TVY A;  3CKJ A;  1G97 A;  4HO4 A;  4DE7 A;  4CVH A;  5CQP A;  3RMW A;  3O3P A;  1INI A;  1G3L A;  1OQM B;  4O6N A;  2WVL A;  1R82 A;  2E3D A;  1TW1 A;  5JQQ A;  2VFZ A;  1ZJO A;  4KXO A;  1WVC A;  1R7V A;  5J49 A;  4AYJ A;  4B3U A;  5FTS A;  4ASJ A;  5FV9 A;  3I0L A;  1VIC A;  3QVB A;  4KPX A;  1VGU A;  1ZCV A;  2FFU A;  5CMI A;  5FUH A;  1NWG B;  1GQC A;  3SXA A;  4Y7U A;  4FRB A;  5C3D A;  4KC4 A;  5C47 A;  3ZLL A;  2VK9 A;  5FTV A;  2WEE A;  2P6W A;  4CJ8 A;  4DEC A;  2O1G A;  1VPA A;  4EE5 A;  1ZCY A;  4B2W A;  5C48 A;  4KRV A;  1EYR A;  4KQL A;  3Q80 A;  4FQW A;  1QG8 A;  1JV3 A;  5DDT A;  4HO5 A;  5AJN A;  5DDV A;  4BMA A;  3CKN A;  3D8V A;  2P73 A;  3PKQ A;  2AM4 A;  3JTJ A;  5AJO A;  2YES A;  1H4C A;  1H5S B;  3RSB A;  3U2W A;  4M2B A;  3V90 A;  2PGY A;  2V0I A;  4LW6 A;  2CU2 A;  1MP5 A;  1FO9 A;  3K8D A;  1HM0 A;  4MIX A;  2AE7 A;  2D7R A;  2XWM A;  4Y62 A;  4EEG A;  2XMH A;  1IIM A;  2W0V A;  5AJP A;  5L6S A;  4P02 A;  1S4N A;  5D92 A;  1IIN A;  2BO7 A;  4KC2 A;  3OH2 A;  4Y63 A;  1H7G A;  3SX5 A;  1XZ6 A;  1W57 A;  4IRQ A;  3LW6 A;  4NAK A;  4KNX A;  1FR8 A;  4ZDQ A;  1V82 A;  5C8R A;  2DPW A;  2RJ8 A;  2OI7 A;  1WT1 A;  2VS3 A;  2D0J A;  4G87 A;  5CMF X;  1HJJ A;  3U2V A;  2ZU9 A;  1K4V A;  3K8E A;  3IOI A;  1W77 A;  1HJL A;  1H7F A;  3I0K A;  2V0K A;  4CJC A;  2V0L A;  3Q7U A;  4HOC A;  1NMM B;  1VZU A;  5CMG X;  3GUE A;  2PGV A;  2RIT A;  4D48 A;  4M4K A;  1S4O A;  3HL3 A;  3I0E A;  2P72 A;  3CGX A;  2RJ6 A;  1QGQ A;  3USR A;  4HO8 A;  3SX3 A;  1VH3 A;  3SX7 A;  1R7Y A;  2GGQ A;  2A8U A;  2E8B A;  3ZGG A;  4Y6U A;  4CJB A;  4C2S A;  3V8Y A;  4MND A;  1MC3 A;  2X5Z A;  2JCO A;  1ZDG A;  2O1F A;  1G9R A;  1JVG A;  1O7Q A;  1MP4 A;  4EVW A;  4AC3 A;  2RJ9 A;  5EJZ A;  5FU8 A;  2VXM A;  2PA4 A;  1LZ7 A;  3U2T A;  3U0Y A;  4MYB A;  2AES A;  2ZU7 A;  1HM8 A;  3U0X A;  5C4C A;  1NHE B;  5C4B A;  1LZI A;  2RIX A;  3I0I X;  3N9W A;  2D7I A;  3IOH A;  3DUV A;  2Y6P A;  2X65 A;  1ZJ1 A;  4LW3 A;  1H5S C;  4NAI A;  4FCE A;  1E5K A;  4ARW A;  2RJ1 A;  4NAN A;  2AM3 A;  1FG5 N;  4P00 A;  1ZI1 A;  3DJ4 A;  1H7H A;  1YP2 A;  3CU0 A;  3POL A;  2VS4 A;  1HM9 A;  2OI5 A;  2Y4M A;  1G93 A;  3FWW A;  1WT0 A;  2XWN A;  1S4P A;  2FY7 A;  4R7P A;  2BO4 A;  2QKX A;  2APC A;  1JV1 A;  3T7M A;  3F1C A;  1FXJ A;  4UEG A;  1WSZ A;  1ZIZ A;  5CMH A;  1FWY A;  2MZB A;  2X60 A;  1NKH B;  1H3M A;  3V0M A;  4EEA A;  5CMJ A;  4FRQ A;  4M28 A;  1H7L A;  5D91 A;  1O23 B;  4B4M A;  4ECM A;  2WGZ A;  5HS2 A;  4HCQ A;  2OEF A;  1KWS A;  2J0A A;  1FRW A;  3IOJ A;  5C4E A;  2V0J A;  1ZJP A;  2I5K A;  2YQS A;  1GA8 A;  2YQC A;  4B4B A;  4EE4 A;  2JCL A;  1GX4 A;  3D5N A;  3JUK A;  5C3A A;  3R3I A;  1VGZ A;  1V83 A;  3SX8 A;  3V8Z A;  4FCU A;  1VM8 A;  3TQD A;  4Y9X A;  2Y7A A;  1H7T A;  1INJ A;  2AH9 A;  2RJ7 A;  3SXG A;  4KC1 A;  2RJ0 A;  2WVK A;  2Y4J A;  4FRO A;  2YC5 A;  3CKV A;  1TW5 A;  1LZJ A;  4KPZ A;  1GQ9 A;  2Y4K A;  1QWJ A;  2WE9 A;  2FYC B;  5C1H A;  2VSI A;  2YC3 A;  1ZHJ A;  2ZU8 A;  4KNR A;  4IRP A;  4FRE A;  4E1K A;  1VGT A;  2I5E A;  3E25 A;  3SXC A;  1WT2 A;  1ZDF A;  3PNN A;  1PZY B;  2A8W A;  4K6R A;  3F1Y A;  1GWV A;  1VGW A;  1R7X A;  5CQO A;  3U2U A;  2RJ5 A;  2Z86 A;  3V0P A;  1ZI3 A;  1H4E A;  5C4F A;  2GGO A;  4J18 A;  1FO8 A;  2OEG A;  1ZI5 A;  1H5T B;  3T7O A;  2FYD B;  3OC9 A;  2FFV A;  2FYA A;  3OH3 A;  3SPT A;  5C1L A;  4M2A A;  1H5T A;  1G2V A;  3I0D A;  4B2X A;  4Y64 A;  1H7E A;  5CQN X;  4B42 A;  1YRO B;  1HV9 A;  4L41 C;  3BCV A;  1EZI A;  1ZJ3 A;  1G8O A;  4Y7T A;  2NXV A;  4Y7V A;  1TZF A;  3I0F A;  4JIS A;  2ICX A;  3NGW A;  4GBP A;  1FOA A;  3V0O A;  1OMX A;  2VS5 A;  1G0R A;  2Z87 A;  1VH1 A;  2ICY A;  3EE5 A;  4NAL A;  2AEC A;  4FIX A;  4FRD A;  3V0Q A;  2YQH A;  3OH1 A;  1FGX A;  2Q4J A;  4YS8 A;  3ZLK A;  5CQL X;  1R81 A;  4AAW A;  1QGS A;  2V0H A;  4G3S A;  5EJ1 A;  2Y4L A;  1H5R A;  1LL2 A;  3V91 A;  4D0Z A;  1R80 A;  3BRK X;  1W55 A;  1GWW A;  2AGD A;  3V0N A;  5C1G A;  2WVM A;  1LL0 A;  2C0N A;  4XWI A;  2YQJ A;  3R2W A;  1OMZ A;  1NF5 B;  1FZW A;  5C49 A;  2QH5 A;  2PX7 A;  3CKO A;  4Y7G A;  1G1L A;  2X5S A;  4EEM A;  4G3P A;  4D11 A;  4D0T A;  3ZGF A;  5EIY A;  1SS9 A;  2O1H A;  4FRM A;  3OH0 A;  4HO3 A;  3V0L A;  5C38 A;  3OAM A;  2QGI A;  1ZJ2 A;  4EEO A;  1JYL A;  3U2X A;  3DK5 A;  1YP3 A;  1GX0 A;  4KT7 A;  2AM5 A;  2JCK A;  2XWL A;  4HO2 A;  3JUJ A;  3PKP A;  3FOQ A;  5I1F A;  1MP3 A;  5IDT A;  1LVW A;  1NQI B;  1ON8 A;  2I7B A;  4FRP A;  1H4D A;  3T7N A;  3I0C A;  1FR9 A;  1I52 A;  2W0W A;  3D98 A;  3RMV A;  3I0J A;  2RIZ A;  2RJ4 A;  4EE3 A;  3ST8 A;  1JVD A;  4Q7C A;  1H5S A;  1ZCT A;  2RIY A;  1G95 A;  4FRA A;  4B4G A;  4AYL A;  5IDS A;  5C3B A;  1H7Q A;  4HO9 A;  2WAW A;  1FXO A;  4FIY A;  1FGG A;  1G23 A;  5C36 A;  5L6V A;  5FYE A;  4BQH A;  1ZJ0 A;  4HO0 A;  2VD4 A;  3TZT A;  1VZT A;  2BO6 A;  3SXE A;  2XME A;  2BO8 A;  2J0B A;  3I0G A;  1R7T A;  1R7U A;  3E26 A;  4G3Q A;  5C4D A;  1ZCU A;  1VZX A;  4FRH A;  4ASY A;  1O0R A;  5IFY A;  3OKR A;  1Z90 A;  4HO6 A;  3ZF8 A;  3SXD A;  1LZ0 A;  3OH4 A;  4FRL A;  5CQM X;  3SXB A;  1LL3 A;  1YP4 A;  2VSH A;  3I0H A;  3CKQ A;  1ON6 A;  3Q4S A;  4B5B A;  1ZI4 A;  1H5S D;  1V84 A;  5FU0 A;  3USQ A;  4JD0 A;  1O7O A;  1XHB A;  4Y7F A;  5BXC A;  1PZT A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...