3JUJA

The crystal structure of apo- udp-glucose pyrophosphorylase
Total Genus 82
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
82
sequence length
273
structure length
273
Chain Sequence
MIKKCLFPAAGYGTRFLPITKTIPKEMLPIVDKPLIQYAVEEAMEAGCEVMAIVTGRNKRSLEDYFDTSYEIEHQIQGTNKENALKSIRNIIEKCCFSYVRQKQMKGLGHAILTGEALIGNEPFAVILADDLCISHDHPSVLKQMTSLYQKYQCSIVAIEEVALEEVSKYGVIRGEWLEEGVYEIKDMVEKPNQEDAPSNLAVIGRYILTPDIFEILSETKPGKNNEIQITDALRTQAKRKRIIAYQFKGKRYDCGSVEGYIEASNAYYKKRL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords UDP-glucose pyrophosphorylase (GalU)
publication title Structural basis for the reaction mechanism of UDP-glucose pyrophosphorylase
pubmed doi rcsb
source organism Helicobacter pylori
total genus 82
structure length 273
sequence length 273
chains with identical sequence B, C, D
ec nomenclature ec 2.7.7.9: UTP--glucose-1-phosphate uridylyltransferase.
pdb deposition date 2009-09-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00483 NTP_transferase Nucleotidyl transferase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.550.10 Alpha Beta Alpha-Beta Complex Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A 3jujA00
2ICXA 1S4OA 2WVMA 5C3AA 4ECMA 1QG8A 5CQLX 1G3LA 3USRA 2OEFA 4EEGA 1R82A 3POLA 2FYAA 4D0TA 1G1LA 1H5SB 3OH0A 1G97A 2AM3A 4Y7GA 2O1HA 3V0NA 4FRAA 2PGVA 1VPAA 1LZ7A 4L41C 1QGQA 4D0ZA 3F1CA 1V82A 1G93A 1GQCA 4FRMA 2APCA 4JISA 3OC9A 3T7MA 3JTJA 1Z90A 3U0XA 4B4BA 4FRHA 2YQJA 2P6WA 5IFYA 2FYBA 2WEEA 1O7OA 3DJ4A 1OMXA 4K6RA 4G87A 1VH3A 4IRQA 2XMEA 1W57A 4ASJA 3ST8A 4Y6NA 2O1FA 4P02A 5EJZA 5C1LA 1S4PA 3SXDA 5EIYA 5C4FA 3OH3A 4DDZA 1FWYA 5DDVA 4HO6A 4M2AA 1W77A 4MYBA 2V0HA 2VXMA 5JQQA 5L6VA 4CJ8A 1GWWA 1JV1A 1FXOA 2D0JA 1ZJ2A 1G0RA 1G2VA 3DK5A 5C47A 4KRVA 1GX0A 1EYRA 2AM5A 2W0WA 1VICA 2X5SA 2RJ9A 1ZJ3A 4M4KA 4FRLA 1LL3A 5FTSA 4D48A 4BMAA 3V0PA 1WT1A 2RIXA 2XWLA 3SX7A 4Y63A 1HM9A 5C4EA 2VS5A 2Y4MA 1H7FA 2WVLA 1I52A 2BO8A 1ZDFA 1YP2A 1VM8A 4KQLA 4B4GA 3U2WA 3R2WA 5AJNA 5HS2A 2RIZA 1G8OA 4HO8A 1H4DA 4NALA 2W0VA 4B2XA 2WE9A 4AC3A 2XWNA 1FR9A 1H7QA 1FR8A 2JCOA 4HG6A 4EVWA 4HO5A 1IIMA 1HJJA 1LZJA 2ZU8A 1ZCTA 1LL2A 1FRWA 5CMJA 1H7HA 3CKQA 3HL3A 2V0IA 3FWWA 2ZU9A 4HO4A 3T7OA 5CQMX 4FREA 4CJCA 4D11C 4DE7A 4MNDA 2BO6A 3U2UA 4DECA 4FRQA 3SX8A 2JCLA 1HJLA 5CMHA 4ZDQA 1MP4A 1MC3A 4EE4A 1PZYB 5CQOA 3LW6A 1MP3A 1KWSA 2QKXA 3CKOA 1SS9A 1ZCYA 1NF5B 5IDTA 2PX7A 4HO9A 2AM4A 2FYCB 5FYEA 3N9WA 2V0LA 3TZTA 4KNXA 1K4VA 2VS4A 1GA8A 1TW1A 4CJBA 1FGXA 4Y6UA 3SX5A 1ZI4A 3T7NA 1QGSA 1XZ6A 3JUKA 4C2SA 4J18A 2NXVA 3I0GA 5FU0A 2CU2A 3RSBA 3BRKX 5C8RA 4ARWA 2YC5A 3CU0A 3D98A 3E26A 1G9RA 3JUJA 3RMVA 2Q4JA 4KNRA 1H5RA 2AH9A 3K8EA 3OH2A 2FFVA 3USQA 3IOIA 3FOQA 4Y7UA 2DPWA 2MZBA 4FROA 5CMFX 5L6SA 3D8VA 1YROB 5IDSA 5C1HA 4AYLA 3ZGFA 5FTVA 2YQCA 2XMHA 1H5SC 1MP5A 4G3QA 4NAKA 2Z87A 1R7XA 4B3UA 1R7UA 4HCQA 4D11A 2JCJA 1G95A 3PKQA 1NKHB 1ZCUA 4IRPA 4EE3A 1ZDGA 3CKVA 3I0IX 2VFZA 4KC2A 2Y7AA 4NAIA 2BO4A 2Y6PA 3SPTA 2RJ1A 1H7LA 1FO8A 3F1YA 4HO2A 3OKRA 3GUEA 2FFUA 3U2VA 4B2WA 1VH1A 3IOHA 4KPXA 1H7TA 5C49A 1GQ9A 4B4MA 1ZIZA 1R7YA 2AE7A 4EE5A 4HO0A 2QGIA 4Y7FA 3SXEA 3RMWA 2QH5A 1H4EA 1W55A 5C4DA 5C48A 3OGZA 1ON6A 2P73A 2PA4A 5C36A 1JYLA 1GX4A 1ZJOA 4Y7TA 1OQMB 1H4CA 1R80A 2RJ5A 1VZXA 1NQIB 3I0HA 3V0QA 4FQWA 1PZTA 2AGDA 1FGGA 1JV3A 1NWGB 1FZWA 2ZU7A 2VSHA 1ZJ0A 3O3PA 5CQNX 3I0DA 4BQHA 2RJ8A 1XHBA 1H3MA 1HM0A 5C4BA 1ZHJA 3V90A 1IINA 2RIYA 3BCVA 4FRPA 1O0RA 1NMMB 4ASYA 1O7QA 1ZI5A 1VZTA 3I0KA 2RJ6A 4Y7VA 1H5SD 5J49A 2RJ0A 3V0OA 1R7TA 4NANA 1NHEB 1O23B 3ZLLA 2A8WA 4KC1A 4JD0A 1INJA 3NGWA 1ZJPA 3OAMA 2WGZA 3I0JA 2X5ZA 1VGZA 5AJOA 2I5EA 2V0JA 3SX3A 2OEGA 4Y9XA 3SXGA 5I1FA 1JVGA 5EJ1A 3U2XA 2BO7A 2GGQA 2A8UA 1LL0A 3ZF8A 4FCUA 1HV9A 2D7RA 1LZ0A 2Z86A 2RJ4A 4EEAA 3PNNA 4XWIA 5FV9A 3EE5A 3I0EA 1HM8A 2UX8A 1JVDA 2D7IA 2FY7A 2ICYA 5BXCA 1H5TA 4AAWA 3IOJA 1JYKA 2JCKA 2P72A 4HOCA 2OI6A 4R7PA 5C38A 3V0MA 4KPZA 2Y4LA 5C3DA 3Q4SA 3E25A 5CMGX 3CGXA 5AJPA 4FCEA 1FXJA 4G3PA 4Y62A 3SXAA 3Q7UA 3SXCA 1YP4A 3D5NA 3V0LA 2YQHA 4LW3A 1FOAA 1TZFA 2YESA 5C3BA 1VZUA 4G3SA 5FU8A 4EEMA 4P00A 3SXBA 1H5RB 2RITA 2O1GA 2X60A 3V8YA 4KXOA 3OH4A 1TW5A 2VXLA 4M28A 5FUHA 4CVHA 1QWJA 1TVYA 2YCMA 1ON8A 1WT2A 1ZCVA 2WVKA 4KT7A 1WVCA 2YC3A 2I5KA 2I7BA 1INIA 4FRBA 1H5TB 1R81A 1V83A 2X65A 3ZLKA 1G23A 1EZIA 4B42A 4GBPA 1WSZA 2YQSA 2AESA 1WT3A 2VD4A 2VS3A 3TQDA 4KC4A 3KIAA 1VGTA 1E5KA 1H7GA 1FG5N 5C4CA 1YP3A 2RJ7A 4UEGA 2PGYA 3CKNA 1FO9A 3U2TA 2XWMA 4M2BA 3I0FA 5CQPA 1WT0A 3V8ZA 2V0KA 3QVBA 1ZI3A 1H5SA 1V84A 2OI7A 1H7EA 2FYDB 3I0CA 1VGUA 4Y64A 1LZIA 4EEOA 3Q80A 1R7VA 1S4NA 4B5BA 1GWVA 2E8BA 3V91A 2WAWA 4HO3A 4FRDA 5C1GA 2OI5A 3OH1A 4LW6A 4E1KA 3CKJA 3U0YA 2Y4KA 3I0LA 2Y4JA 5DDTA 2AECA 4AYJA 3PKPA 2VSIA 5CMIA 2E3DA 1LVWA 3K8DA 3DUVA 3ZGGA 3R3IA 4YS8A 1OMZA 1ZI1A 1ZJ1A 1VGWA 2GGOA
chains in the Genus database with same CATH superfamily
2ICXA 1S4OA 2WVMA 5C3AA 4ECMA 1QG8A 5CQLX 1G3LA 3USRA 2OEFA 4EEGA 1R82A 3POLA 2FYAA 4D0TA 1G1LA 1H5SB 3OH0A 1G97A 2AM3A 4Y7GA 2O1HA 3V0NA 4FRAA 2PGVA 1VPAA 1LZ7A 4L41C 1QGQA 4D0ZA 3F1CA 1V82A 1G93A 1GQCA 4FRMA 2APCA 4JISA 3OC9A 3T7MA 3JTJA 1Z90A 3U0XA 4B4BA 4FRHA 2YQJA 2P6WA 5IFYA 2FYBA 2WEEA 1O7OA 3DJ4A 1OMXA 4K6RA 4G87A 1VH3A 4O6MA 4IRQA 2XMEA 1W57A 4ASJA 3ST8A 4Y6NA 2O1FA 4P02A 5EJZA 5C1LA 1S4PA 3SXDA 5EIYA 5C4FA 3OH3A 4DDZA 1FWYA 5DDVA 4HO6A 4M2AA 1W77A 4FIXA 4MYBA 2V0HA 2VXMA 5JQQA 5L6VA 4CJ8A 1GWWA 1JV1A 1FXOA 2D0JA 1ZJ2A 1G0RA 1G2VA 3DK5A 5C47A 4KRVA 1GX0A 1EYRA 2AM5A 2W0WA 1VICA 2X5SA 2RJ9A 1ZJ3A 4M4KA 4FRLA 1LL3A 5FTSA 4D48A 4BMAA 3V0PA 1WT1A 2RIXA 2XWLA 2J0BA 3SX7A 4Y63A 1HM9A 5C4EA 2VS5A 2Y4MA 1H7FA 2WVLA 1I52A 2BO8A 1ZDFA 1YP2A 1VM8A 4MIXA 4KQLA 4B4GA 3U2WA 3R2WA 5AJNA 5HS2A 2RIZA 1G8OA 4HO8A 1H4DA 4NALA 2W0VA 4B2XA 2WE9A 4AC3A 2XWNA 1FR9A 1H7QA 1FR8A 2JCOA 4HG6A 4EVWA 4HO5A 1IIMA 1HJJA 1LZJA 2ZU8A 1ZCTA 1LL2A 1FRWA 5CMJA 1H7HA 3CKQA 3HL3A 2V0IA 3FWWA 2ZU9A 4HO4A 3T7OA 5CQMX 4FREA 4CJCA 4D11C 4DE7A 4MNDA 2BO6A 3U2UA 4DECA 4FRQA 3SX8A 2JCLA 1HJLA 5CMHA 4ZDQA 1MP4A 1MC3A 4EE4A 1PZYB 5CQOA 3LW6A 1MP3A 1KWSA 2QKXA 3CKOA 1SS9A 1ZCYA 1NF5B 5IDTA 2PX7A 4HO9A 2AM4A 2FYCB 5FYEA 3N9WA 2V0LA 3TZTA 4KNXA 1K4VA 2VS4A 1GA8A 1TW1A 4CJBA 1FGXA 4Y6UA 5D91A 3SX5A 1ZI4A 3T7NA 1QGSA 1XZ6A 3JUKA 4C2SA 4J18A 2NXVA 3I0GA 5FU0A 2CU2A 3RSBA 3BRKX 5C8RA 4ARWA 2YC5A 3CU0A 3D98A 3E26A 1G9RA 3JUJA 3RMVA 2Q4JA 4KNRA 1H5RA 2AH9A 3K8EA 3OH2A 2FFVA 3USQA 3IOIA 3FOQA 4Y7UA 2DPWA 2MZBA 4FROA 5CMFX 5L6SA 3D8VA 1YROB 5IDSA 5C1HA 4AYLA 3ZGFA 5FTVA 2YQCA 2XMHA 1H5SC 1MP5A 4G3QA 4NAKA 2Z87A 1R7XA 4B3UA 1R7UA 4FIYA 4HCQA 4D11A 2JCJA 1G95A 3PKQA 1NKHB 1ZCUA 4IRPA 4EE3A 1ZDGA 3CKVA 3I0IX 2VFZA 4KC2A 2Y7AA 4NAIA 2BO4A 2Y6PA 3SPTA 2RJ1A 1H7LA 1FO8A 3F1YA 4HO2A 3OKRA 3GUEA 2FFUA 3U2VA 4B2WA 1VH1A 3IOHA 4KPXA 1H7TA 5C49A 1GQ9A 4B4MA 1ZIZA 1R7YA 2AE7A 4EE5A 4HO0A 2QGIA 4Y7FA 3SXEA 3RMWA 2QH5A 1H4EA 1W55A 5C4DA 5C48A 3OGZA 1ON6A 2J0AA 2P73A 2PA4A 5C36A 1JYLA 1GX4A 1ZJOA 4Y7TA 1OQMB 1H4CA 1R80A 2RJ5A 1VZXA 1NQIB 3I0HA 3V0QA 4FQWA 1PZTA 2AGDA 1FGGA 1JV3A 1NWGB 1FZWA 2ZU7A 2VSHA 1ZJ0A 3O3PA 5CQNX 3I0DA 4BQHA 2RJ8A 1XHBA 1H3MA 1HM0A 5C4BA 1ZHJA 3V90A 1IINA 2RIYA 3BCVA 4FRPA 1O0RA 1NMMB 4ASYA 1O7QA 1ZI5A 1VZTA 3I0KA 2RJ6A 4Y7VA 1H5SD 5J49A 2RJ0A 3V0OA 1R7TA 4NANA 1NHEB 1O23B 3ZLLA 2A8WA 4KC1A 4JD0A 1INJA 3NGWA 1ZJPA 3OAMA 2WGZA 3I0JA 2X5ZA 5D92A 1VGZA 5AJOA 2I5EA 2V0JA 3SX3A 2OEGA 4Y9XA 3SXGA 5I1FA 4Q7CA 1JVGA 5EJ1A 3U2XA 2BO7A 2GGQA 2A8UA 1LL0A 3ZF8A 4FCUA 1HV9A 2D7RA 1LZ0A 2Z86A 2RJ4A 4EEAA 3PNNA 4XWIA 5FV9A 3EE5A 3I0EA 1HM8A 2UX8A 1JVDA 2D7IA 2FY7A 2C0NA 2ICYA 5BXCA 1H5TA 4AAWA 3IOJA 1JYKA 2JCKA 2P72A 4HOCA 2OI6A 4R7PA 5C38A 3V0MA 4KPZA 2Y4LA 5C3DA 3Q4SA 3E25A 5CMGX 3CGXA 5AJPA 4FCEA 1FXJA 4G3PA 4Y62A 3SXAA 3Q7UA 3SXCA 1YP4A 3D5NA 3V0LA 2VK9A 2YQHA 4LW3A 1FOAA 1TZFA 2YESA 5C3BA 1VZUA 4G3SA 5FU8A 4EEMA 4P00A 3SXBA 1H5RB 2RITA 4O6NA 2O1GA 2X60A 3V8YA 4KXOA 3OH4A 1TW5A 2VXLA 4M28A 5FUHA 4CVHA 1QWJA 1TVYA 2YCMA 1ON8A 1WT2A 1ZCVA 2WVKA 4KT7A 1WVCA 2YC3A 2I5KA 2I7BA 1INIA 4FRBA 1H5TB 1R81A 1V83A 2X65A 3ZLKA 1G23A 1EZIA 4B42A 4GBPA 1WSZA 2YQSA 2AESA 1WT3A 2VD4A 2VS3A 3TQDA 4KC4A 3KIAA 1VGTA 1E5KA 1H7GA 1FG5N 5C4CA 1YP3A 2RJ7A 4UEGA 2PGYA 3CKNA 1FO9A 3U2TA 2XWMA 4M2BA 3I0FA 5CQPA 1WT0A 3V8ZA 2V0KA 3QVBA 1ZI3A 1H5SA 1V84A 2OI7A 1H7EA 2FYDB 3I0CA 1VGUA 4Y64A 1LZIA 4EEOA 3Q80A 1R7VA 1S4NA 4B5BA 1GWVA 2E8BA 3V91A 2WAWA 4HO3A 4FRDA 5C1GA 2OI5A 3OH1A 4LW6A 4E1KA 3CKJA 3U0YA 2Y4KA 3I0LA 2Y4JA 5DDTA 2AECA 4AYJA 3PKPA 2VSIA 5CMIA 2E3DA 1LVWA 3K8DA 3DUVA 3ZGGA 3R3IA 4YS8A 1OMZA 1ZI1A 1ZJ1A 1VGWA 2GGOA
chains in the Genus database with same CATH topology
2ICXA 1S4OA 2WVMA 5C3AA 4ECMA 1QG8A 5CQLX 1G3LA 3USRA 2OEFA 4EEGA 1R82A 3POLA 2FYAA 4D0TA 1G1LA 1H5SB 3OH0A 1G97A 2AM3A 4Y7GA 2O1HA 3V0NA 4FRAA 2PGVA 1VPAA 1LZ7A 4L41C 1QGQA 4D0ZA 3F1CA 1V82A 1G93A 1GQCA 4FRMA 2APCA 4JISA 3OC9A 3T7MA 3JTJA 1Z90A 3U0XA 4B4BA 4FRHA 2YQJA 2P6WA 5IFYA 2FYBA 2WEEA 1O7OA 3DJ4A 1OMXA 4K6RA 4G87A 1VH3A 4O6MA 4IRQA 2XMEA 1W57A 4ASJA 3ST8A 4Y6NA 2O1FA 4P02A 5EJZA 5C1LA 1S4PA 3SXDA 5EIYA 5C4FA 3OH3A 4DDZA 1FWYA 5DDVA 4HO6A 4M2AA 1W77A 4FIXA 4MYBA 2V0HA 2VXMA 5JQQA 5L6VA 4CJ8A 1GWWA 1JV1A 1FXOA 2D0JA 1ZJ2A 1G0RA 1G2VA 3DK5A 5C47A 4KRVA 1GX0A 1EYRA 2AM5A 2W0WA 1VICA 2X5SA 2RJ9A 1ZJ3A 4M4KA 4FRLA 1LL3A 5FTSA 4D48A 4BMAA 3V0PA 1WT1A 2RIXA 2XWLA 2J0BA 3SX7A 4Y63A 1HM9A 5C4EA 2VS5A 2Y4MA 1H7FA 2WVLA 1I52A 2BO8A 1ZDFA 1YP2A 1VM8A 4MIXA 4KQLA 4B4GA 3U2WA 3R2WA 5AJNA 5HS2A 2RIZA 1G8OA 4HO8A 1H4DA 4NALA 2W0VA 4B2XA 2WE9A 4AC3A 2XWNA 1FR9A 1H7QA 1FR8A 2JCOA 4HG6A 4EVWA 4HO5A 1IIMA 1HJJA 1LZJA 2ZU8A 1ZCTA 1LL2A 1FRWA 5CMJA 1H7HA 3CKQA 3HL3A 2V0IA 3FWWA 2ZU9A 4HO4A 3T7OA 5CQMX 4FREA 4CJCA 4D11C 4DE7A 4MNDA 2BO6A 3U2UA 4DECA 4FRQA 3SX8A 2JCLA 1HJLA 5CMHA 4ZDQA 1MP4A 1MC3A 4EE4A 1PZYB 5CQOA 3LW6A 1MP3A 1KWSA 2QKXA 3CKOA 1SS9A 1ZCYA 1NF5B 5IDTA 2PX7A 4HO9A 2AM4A 2FYCB 5FYEA 3N9WA 2V0LA 3TZTA 4KNXA 1K4VA 2VS4A 1GA8A 1TW1A 4CJBA 1FGXA 4Y6UA 5D91A 3SX5A 1ZI4A 3T7NA 1QGSA 1XZ6A 3JUKA 4C2SA 4J18A 2NXVA 3I0GA 5FU0A 2CU2A 3RSBA 3BRKX 5C8RA 4ARWA 2YC5A 3CU0A 3D98A 3E26A 1G9RA 3JUJA 3RMVA 2Q4JA 4KNRA 1H5RA 2AH9A 3K8EA 3OH2A 2FFVA 3USQA 3IOIA 3FOQA 4Y7UA 2DPWA 2MZBA 4FROA 5CMFX 5L6SA 3D8VA 1YROB 5IDSA 5C1HA 4AYLA 3ZGFA 5FTVA 2YQCA 2XMHA 1H5SC 1MP5A 4G3QA 4NAKA 2Z87A 1R7XA 4B3UA 1R7UA 4FIYA 4HCQA 4D11A 2JCJA 1G95A 3PKQA 1NKHB 1ZCUA 4IRPA 4EE3A 1ZDGA 3CKVA 3I0IX 2VFZA 4KC2A 2Y7AA 4NAIA 2BO4A 2Y6PA 3SPTA 2RJ1A 1H7LA 1FO8A 3F1YA 4HO2A 3OKRA 3GUEA 2FFUA 3U2VA 4B2WA 1VH1A 3IOHA 4KPXA 1H7TA 5C49A 1GQ9A 4B4MA 1ZIZA 1R7YA 2AE7A 4EE5A 4HO0A 2QGIA 4Y7FA 3SXEA 3RMWA 2QH5A 1H4EA 1W55A 5C4DA 5C48A 3OGZA 1ON6A 2J0AA 2P73A 2PA4A 5C36A 1JYLA 1GX4A 1ZJOA 4Y7TA 1OQMB 1H4CA 1R80A 2RJ5A 1VZXA 1NQIB 3I0HA 3V0QA 4FQWA 1PZTA 2AGDA 1FGGA 1JV3A 1NWGB 1FZWA 2ZU7A 2VSHA 1ZJ0A 3O3PA 5CQNX 3I0DA 4BQHA 2RJ8A 1XHBA 1H3MA 1HM0A 5C4BA 1ZHJA 3V90A 1IINA 2RIYA 3BCVA 4FRPA 1O0RA 1NMMB 4ASYA 1O7QA 1ZI5A 1VZTA 3I0KA 2RJ6A 4Y7VA 1H5SD 5J49A 2RJ0A 3V0OA 1R7TA 4NANA 1NHEB 1O23B 3ZLLA 2A8WA 4KC1A 4JD0A 1INJA 3NGWA 1ZJPA 3OAMA 2WGZA 3I0JA 2X5ZA 5D92A 1VGZA 5AJOA 2I5EA 2V0JA 3SX3A 2OEGA 4Y9XA 3SXGA 5I1FA 4Q7CA 1JVGA 5EJ1A 3U2XA 2BO7A 2GGQA 2A8UA 1LL0A 3ZF8A 4FCUA 1HV9A 2D7RA 1LZ0A 2Z86A 2RJ4A 4EEAA 3PNNA 4XWIA 5FV9A 3EE5A 3I0EA 1HM8A 2UX8A 1JVDA 2D7IA 2FY7A 2C0NA 2ICYA 5BXCA 1H5TA 4AAWA 3IOJA 1JYKA 2JCKA 2P72A 4HOCA 2OI6A 4R7PA 5C38A 3V0MA 4KPZA 2Y4LA 5C3DA 3Q4SA 3E25A 5CMGX 3CGXA 5AJPA 4FCEA 1FXJA 4G3PA 4Y62A 3SXAA 3Q7UA 3SXCA 1YP4A 3D5NA 3V0LA 2VK9A 2YQHA 4LW3A 1FOAA 1TZFA 2YESA 5C3BA 1VZUA 4G3SA 5FU8A 4EEMA 4P00A 3SXBA 1H5RB 2RITA 4O6NA 2O1GA 2X60A 3V8YA 4KXOA 3OH4A 1TW5A 2VXLA 4M28A 5FUHA 4CVHA 1QWJA 1TVYA 2YCMA 1ON8A 1WT2A 1ZCVA 2WVKA 4KT7A 1WVCA 2YC3A 2I5KA 2I7BA 1INIA 4FRBA 1H5TB 1R81A 1V83A 2X65A 3ZLKA 1G23A 1EZIA 4B42A 4GBPA 1WSZA 2YQSA 2AESA 1WT3A 2VD4A 2VS3A 3TQDA 4KC4A 3KIAA 1VGTA 1E5KA 1H7GA 1FG5N 5C4CA 1YP3A 2RJ7A 4UEGA 2PGYA 3CKNA 1FO9A 3U2TA 2XWMA 4M2BA 3I0FA 5CQPA 1WT0A 3V8ZA 2V0KA 3QVBA 1ZI3A 1H5SA 1V84A 2OI7A 1H7EA 2FYDB 3I0CA 1VGUA 4Y64A 1LZIA 4EEOA 3Q80A 1R7VA 1S4NA 4B5BA 1GWVA 2E8BA 3V91A 2WAWA 4HO3A 4FRDA 5C1GA 2OI5A 3OH1A 4LW6A 4E1KA 3CKJA 3U0YA 2Y4KA 3I0LA 2Y4JA 5DDTA 2AECA 4AYJA 3PKPA 2VSIA 5CMIA 2E3DA 1LVWA 3K8DA 3DUVA 3ZGGA 3R3IA 4YS8A 1OMZA 1ZI1A 1ZJ1A 1VGWA 2GGOA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2ICX A;  1S4O A;  2WVM A;  5C3A A;  4ECM A;  1QG8 A;  5CQL X;  1G3L A;  3USR A;  2OEF A;  4EEG A;  1R82 A;  3POL A;  2FYA A;  4D0T A;  1G1L A;  1H5S B;  3OH0 A;  1G97 A;  2AM3 A;  4Y7G A;  2O1H A;  3V0N A;  4FRA A;  2PGV A;  1VPA A;  1LZ7 A;  4L41 C;  1QGQ A;  4D0Z A;  3F1C A;  1V82 A;  1G93 A;  1GQC A;  4FRM A;  2APC A;  4JIS A;  3OC9 A;  3T7M A;  3JTJ A;  1Z90 A;  3U0X A;  4B4B A;  4FRH A;  2YQJ A;  2P6W A;  5IFY A;  2FYB A;  2WEE A;  1O7O A;  3DJ4 A;  1OMX A;  4K6R A;  4G87 A;  1VH3 A;  4IRQ A;  2XME A;  1W57 A;  4ASJ A;  3ST8 A;  4Y6N A;  2O1F A;  4P02 A;  5EJZ A;  5C1L A;  1S4P A;  3SXD A;  5EIY A;  5C4F A;  3OH3 A;  4DDZ A;  1FWY A;  5DDV A;  4HO6 A;  4M2A A;  1W77 A;  4MYB A;  2V0H A;  2VXM A;  5JQQ A;  5L6V A;  4CJ8 A;  1GWW A;  1JV1 A;  1FXO A;  2D0J A;  1ZJ2 A;  1G0R A;  1G2V A;  3DK5 A;  5C47 A;  4KRV A;  1GX0 A;  1EYR A;  2AM5 A;  2W0W A;  1VIC A;  2X5S A;  2RJ9 A;  1ZJ3 A;  4M4K A;  4FRL A;  1LL3 A;  5FTS A;  4D48 A;  4BMA A;  3V0P A;  1WT1 A;  2RIX A;  2XWL A;  3SX7 A;  4Y63 A;  1HM9 A;  5C4E A;  2VS5 A;  2Y4M A;  1H7F A;  2WVL A;  1I52 A;  2BO8 A;  1ZDF A;  1YP2 A;  1VM8 A;  4KQL A;  4B4G A;  3U2W A;  3R2W A;  5AJN A;  5HS2 A;  2RIZ A;  1G8O A;  4HO8 A;  1H4D A;  4NAL A;  2W0V A;  4B2X A;  2WE9 A;  4AC3 A;  2XWN A;  1FR9 A;  1H7Q A;  1FR8 A;  2JCO A;  4HG6 A;  4EVW A;  4HO5 A;  1IIM A;  1HJJ A;  1LZJ A;  2ZU8 A;  1ZCT A;  1LL2 A;  1FRW A;  5CMJ A;  1H7H A;  3CKQ A;  3HL3 A;  2V0I A;  3FWW A;  2ZU9 A;  4HO4 A;  3T7O A;  5CQM X;  4FRE A;  4CJC A;  4D11 C;  4DE7 A;  4MND A;  2BO6 A;  3U2U A;  4DEC A;  4FRQ A;  3SX8 A;  2JCL A;  1HJL A;  5CMH A;  4ZDQ A;  1MP4 A;  1MC3 A;  4EE4 A;  1PZY B;  5CQO A;  3LW6 A;  1MP3 A;  1KWS A;  2QKX A;  3CKO A;  1SS9 A;  1ZCY A;  1NF5 B;  5IDT A;  2PX7 A;  4HO9 A;  2AM4 A;  2FYC B;  5FYE A;  3N9W A;  2V0L A;  3TZT A;  4KNX A;  1K4V A;  2VS4 A;  1GA8 A;  1TW1 A;  4CJB A;  1FGX A;  4Y6U A;  3SX5 A;  1ZI4 A;  3T7N A;  1QGS A;  1XZ6 A;  3JUK A;  4C2S A;  4J18 A;  2NXV A;  3I0G A;  5FU0 A;  2CU2 A;  3RSB A;  3BRK X;  5C8R A;  4ARW A;  2YC5 A;  3CU0 A;  3D98 A;  3E26 A;  1G9R A;  3JUJ A;  3RMV A;  2Q4J A;  4KNR A;  1H5R A;  2AH9 A;  3K8E A;  3OH2 A;  2FFV A;  3USQ A;  3IOI A;  3FOQ A;  4Y7U A;  2DPW A;  2MZB A;  4FRO A;  5CMF X;  5L6S A;  3D8V A;  1YRO B;  5IDS A;  5C1H A;  4AYL A;  3ZGF A;  5FTV A;  2YQC A;  2XMH A;  1H5S C;  1MP5 A;  4G3Q A;  4NAK A;  2Z87 A;  1R7X A;  4B3U A;  1R7U A;  4HCQ A;  4D11 A;  2JCJ A;  1G95 A;  3PKQ A;  1NKH B;  1ZCU A;  4IRP A;  4EE3 A;  1ZDG A;  3CKV A;  3I0I X;  2VFZ A;  4KC2 A;  2Y7A A;  4NAI A;  2BO4 A;  2Y6P A;  3SPT A;  2RJ1 A;  1H7L A;  1FO8 A;  3F1Y A;  4HO2 A;  3OKR A;  3GUE A;  2FFU A;  3U2V A;  4B2W A;  1VH1 A;  3IOH A;  4KPX A;  1H7T A;  5C49 A;  1GQ9 A;  4B4M A;  1ZIZ A;  1R7Y A;  2AE7 A;  4EE5 A;  4HO0 A;  2QGI A;  4Y7F A;  3SXE A;  3RMW A;  2QH5 A;  1H4E A;  1W55 A;  5C4D A;  5C48 A;  3OGZ A;  1ON6 A;  2P73 A;  2PA4 A;  5C36 A;  1JYL A;  1GX4 A;  1ZJO A;  4Y7T A;  1OQM B;  1H4C A;  1R80 A;  2RJ5 A;  1VZX A;  1NQI B;  3I0H A;  3V0Q A;  4FQW A;  1PZT A;  2AGD A;  1FGG A;  1JV3 A;  1NWG B;  1FZW A;  2ZU7 A;  2VSH A;  1ZJ0 A;  3O3P A;  5CQN X;  3I0D A;  4BQH A;  2RJ8 A;  1XHB A;  1H3M A;  1HM0 A;  5C4B A;  1ZHJ A;  3V90 A;  1IIN A;  2RIY A;  3BCV A;  4FRP A;  1O0R A;  1NMM B;  4ASY A;  1O7Q A;  1ZI5 A;  1VZT A;  3I0K A;  2RJ6 A;  4Y7V A;  1H5S D;  5J49 A;  2RJ0 A;  3V0O A;  1R7T A;  4NAN A;  1NHE B;  1O23 B;  3ZLL A;  2A8W A;  4KC1 A;  4JD0 A;  1INJ A;  3NGW A;  1ZJP A;  3OAM A;  2WGZ A;  3I0J A;  2X5Z A;  1VGZ A;  5AJO A;  2I5E A;  2V0J A;  3SX3 A;  2OEG A;  4Y9X A;  3SXG A;  5I1F A;  1JVG A;  5EJ1 A;  3U2X A;  2BO7 A;  2GGQ A;  2A8U A;  1LL0 A;  3ZF8 A;  4FCU A;  1HV9 A;  2D7R A;  1LZ0 A;  2Z86 A;  2RJ4 A;  4EEA A;  3PNN A;  4XWI A;  5FV9 A;  3EE5 A;  3I0E A;  1HM8 A;  2UX8 A;  1JVD A;  2D7I A;  2FY7 A;  2ICY A;  5BXC A;  1H5T A;  4AAW A;  3IOJ A;  1JYK A;  2JCK A;  2P72 A;  4HOC A;  2OI6 A;  4R7P A;  5C38 A;  3V0M A;  4KPZ A;  2Y4L A;  5C3D A;  3Q4S A;  3E25 A;  5CMG X;  3CGX A;  5AJP A;  4FCE A;  1FXJ A;  4G3P A;  4Y62 A;  3SXA A;  3Q7U A;  3SXC A;  1YP4 A;  3D5N A;  3V0L A;  2YQH A;  4LW3 A;  1FOA A;  1TZF A;  2YES A;  5C3B A;  1VZU A;  4G3S A;  5FU8 A;  4EEM A;  4P00 A;  3SXB A;  1H5R B;  2RIT A;  2O1G A;  2X60 A;  3V8Y A;  4KXO A;  3OH4 A;  1TW5 A;  2VXL A;  4M28 A;  5FUH A;  4CVH A;  1QWJ A;  1TVY A;  2YCM A;  1ON8 A;  1WT2 A;  1ZCV A;  2WVK A;  4KT7 A;  1WVC A;  2YC3 A;  2I5K A;  2I7B A;  1INI A;  4FRB A;  1H5T B;  1R81 A;  1V83 A;  2X65 A;  3ZLK A;  1G23 A;  1EZI A;  4B42 A;  4GBP A;  1WSZ A;  2YQS A;  2AES A;  1WT3 A;  2VD4 A;  2VS3 A;  3TQD A;  4KC4 A;  3KIA A;  1VGT A;  1E5K A;  1H7G A;  1FG5 N;  5C4C A;  1YP3 A;  2RJ7 A;  4UEG A;  2PGY A;  3CKN A;  1FO9 A;  3U2T A;  2XWM A;  4M2B A;  3I0F A;  5CQP A;  1WT0 A;  3V8Z A;  2V0K A;  3QVB A;  1ZI3 A;  1H5S A;  1V84 A;  2OI7 A;  1H7E A;  2FYD B;  3I0C A;  1VGU A;  4Y64 A;  1LZI A;  4EEO A;  3Q80 A;  1R7V A;  1S4N A;  4B5B A;  1GWV A;  2E8B A;  3V91 A;  2WAW A;  4HO3 A;  4FRD A;  5C1G A;  2OI5 A;  3OH1 A;  4LW6 A;  4E1K A;  3CKJ A;  3U0Y A;  2Y4K A;  3I0L A;  2Y4J A;  5DDT A;  2AEC A;  4AYJ A;  3PKP A;  2VSI A;  5CMI A;  2E3D A;  1LVW A;  3K8D A;  3DUV A;  3ZGG A;  3R3I A;  4YS8 A;  1OMZ A;  1ZI1 A;  1ZJ1 A;  1VGW A;  2GGO A; 
#chains in the Genus database with same CATH topology
 2ICX A;  1S4O A;  2WVM A;  5C3A A;  4ECM A;  1QG8 A;  5CQL X;  1G3L A;  3USR A;  2OEF A;  4EEG A;  1R82 A;  3POL A;  2FYA A;  4D0T A;  1G1L A;  1H5S B;  3OH0 A;  1G97 A;  2AM3 A;  4Y7G A;  2O1H A;  3V0N A;  4FRA A;  2PGV A;  1VPA A;  1LZ7 A;  4L41 C;  1QGQ A;  4D0Z A;  3F1C A;  1V82 A;  1G93 A;  1GQC A;  4FRM A;  2APC A;  4JIS A;  3OC9 A;  3T7M A;  3JTJ A;  1Z90 A;  3U0X A;  4B4B A;  4FRH A;  2YQJ A;  2P6W A;  5IFY A;  2FYB A;  2WEE A;  1O7O A;  3DJ4 A;  1OMX A;  4K6R A;  4G87 A;  1VH3 A;  4O6M A;  4IRQ A;  2XME A;  1W57 A;  4ASJ A;  3ST8 A;  4Y6N A;  2O1F A;  4P02 A;  5EJZ A;  5C1L A;  1S4P A;  3SXD A;  5EIY A;  5C4F A;  3OH3 A;  4DDZ A;  1FWY A;  5DDV A;  4HO6 A;  4M2A A;  1W77 A;  4FIX A;  4MYB A;  2V0H A;  2VXM A;  5JQQ A;  5L6V A;  4CJ8 A;  1GWW A;  1JV1 A;  1FXO A;  2D0J A;  1ZJ2 A;  1G0R A;  1G2V A;  3DK5 A;  5C47 A;  4KRV A;  1GX0 A;  1EYR A;  2AM5 A;  2W0W A;  1VIC A;  2X5S A;  2RJ9 A;  1ZJ3 A;  4M4K A;  4FRL A;  1LL3 A;  5FTS A;  4D48 A;  4BMA A;  3V0P A;  1WT1 A;  2RIX A;  2XWL A;  2J0B A;  3SX7 A;  4Y63 A;  1HM9 A;  5C4E A;  2VS5 A;  2Y4M A;  1H7F A;  2WVL A;  1I52 A;  2BO8 A;  1ZDF A;  1YP2 A;  1VM8 A;  4MIX A;  4KQL A;  4B4G A;  3U2W A;  3R2W A;  5AJN A;  5HS2 A;  2RIZ A;  1G8O A;  4HO8 A;  1H4D A;  4NAL A;  2W0V A;  4B2X A;  2WE9 A;  4AC3 A;  2XWN A;  1FR9 A;  1H7Q A;  1FR8 A;  2JCO A;  4HG6 A;  4EVW A;  4HO5 A;  1IIM A;  1HJJ A;  1LZJ A;  2ZU8 A;  1ZCT A;  1LL2 A;  1FRW A;  5CMJ A;  1H7H A;  3CKQ A;  3HL3 A;  2V0I A;  3FWW A;  2ZU9 A;  4HO4 A;  3T7O A;  5CQM X;  4FRE A;  4CJC A;  4D11 C;  4DE7 A;  4MND A;  2BO6 A;  3U2U A;  4DEC A;  4FRQ A;  3SX8 A;  2JCL A;  1HJL A;  5CMH A;  4ZDQ A;  1MP4 A;  1MC3 A;  4EE4 A;  1PZY B;  5CQO A;  3LW6 A;  1MP3 A;  1KWS A;  2QKX A;  3CKO A;  1SS9 A;  1ZCY A;  1NF5 B;  5IDT A;  2PX7 A;  4HO9 A;  2AM4 A;  2FYC B;  5FYE A;  3N9W A;  2V0L A;  3TZT A;  4KNX A;  1K4V A;  2VS4 A;  1GA8 A;  1TW1 A;  4CJB A;  1FGX A;  4Y6U A;  5D91 A;  3SX5 A;  1ZI4 A;  3T7N A;  1QGS A;  1XZ6 A;  3JUK A;  4C2S A;  4J18 A;  2NXV A;  3I0G A;  5FU0 A;  2CU2 A;  3RSB A;  3BRK X;  5C8R A;  4ARW A;  2YC5 A;  3CU0 A;  3D98 A;  3E26 A;  1G9R A;  3JUJ A;  3RMV A;  2Q4J A;  4KNR A;  1H5R A;  2AH9 A;  3K8E A;  3OH2 A;  2FFV A;  3USQ A;  3IOI A;  3FOQ A;  4Y7U A;  2DPW A;  2MZB A;  4FRO A;  5CMF X;  5L6S A;  3D8V A;  1YRO B;  5IDS A;  5C1H A;  4AYL A;  3ZGF A;  5FTV A;  2YQC A;  2XMH A;  1H5S C;  1MP5 A;  4G3Q A;  4NAK A;  2Z87 A;  1R7X A;  4B3U A;  1R7U A;  4FIY A;  4HCQ A;  4D11 A;  2JCJ A;  1G95 A;  3PKQ A;  1NKH B;  1ZCU A;  4IRP A;  4EE3 A;  1ZDG A;  3CKV A;  3I0I X;  2VFZ A;  4KC2 A;  2Y7A A;  4NAI A;  2BO4 A;  2Y6P A;  3SPT A;  2RJ1 A;  1H7L A;  1FO8 A;  3F1Y A;  4HO2 A;  3OKR A;  3GUE A;  2FFU A;  3U2V A;  4B2W A;  1VH1 A;  3IOH A;  4KPX A;  1H7T A;  5C49 A;  1GQ9 A;  4B4M A;  1ZIZ A;  1R7Y A;  2AE7 A;  4EE5 A;  4HO0 A;  2QGI A;  4Y7F A;  3SXE A;  3RMW A;  2QH5 A;  1H4E A;  1W55 A;  5C4D A;  5C48 A;  3OGZ A;  1ON6 A;  2J0A A;  2P73 A;  2PA4 A;  5C36 A;  1JYL A;  1GX4 A;  1ZJO A;  4Y7T A;  1OQM B;  1H4C A;  1R80 A;  2RJ5 A;  1VZX A;  1NQI B;  3I0H A;  3V0Q A;  4FQW A;  1PZT A;  2AGD A;  1FGG A;  1JV3 A;  1NWG B;  1FZW A;  2ZU7 A;  2VSH A;  1ZJ0 A;  3O3P A;  5CQN X;  3I0D A;  4BQH A;  2RJ8 A;  1XHB A;  1H3M A;  1HM0 A;  5C4B A;  1ZHJ A;  3V90 A;  1IIN A;  2RIY A;  3BCV A;  4FRP A;  1O0R A;  1NMM B;  4ASY A;  1O7Q A;  1ZI5 A;  1VZT A;  3I0K A;  2RJ6 A;  4Y7V A;  1H5S D;  5J49 A;  2RJ0 A;  3V0O A;  1R7T A;  4NAN A;  1NHE B;  1O23 B;  3ZLL A;  2A8W A;  4KC1 A;  4JD0 A;  1INJ A;  3NGW A;  1ZJP A;  3OAM A;  2WGZ A;  3I0J A;  2X5Z A;  5D92 A;  1VGZ A;  5AJO A;  2I5E A;  2V0J A;  3SX3 A;  2OEG A;  4Y9X A;  3SXG A;  5I1F A;  4Q7C A;  1JVG A;  5EJ1 A;  3U2X A;  2BO7 A;  2GGQ A;  2A8U A;  1LL0 A;  3ZF8 A;  4FCU A;  1HV9 A;  2D7R A;  1LZ0 A;  2Z86 A;  2RJ4 A;  4EEA A;  3PNN A;  4XWI A;  5FV9 A;  3EE5 A;  3I0E A;  1HM8 A;  2UX8 A;  1JVD A;  2D7I A;  2FY7 A;  2C0N A;  2ICY A;  5BXC A;  1H5T A;  4AAW A;  3IOJ A;  1JYK A;  2JCK A;  2P72 A;  4HOC A;  2OI6 A;  4R7P A;  5C38 A;  3V0M A;  4KPZ A;  2Y4L A;  5C3D A;  3Q4S A;  3E25 A;  5CMG X;  3CGX A;  5AJP A;  4FCE A;  1FXJ A;  4G3P A;  4Y62 A;  3SXA A;  3Q7U A;  3SXC A;  1YP4 A;  3D5N A;  3V0L A;  2VK9 A;  2YQH A;  4LW3 A;  1FOA A;  1TZF A;  2YES A;  5C3B A;  1VZU A;  4G3S A;  5FU8 A;  4EEM A;  4P00 A;  3SXB A;  1H5R B;  2RIT A;  4O6N A;  2O1G A;  2X60 A;  3V8Y A;  4KXO A;  3OH4 A;  1TW5 A;  2VXL A;  4M28 A;  5FUH A;  4CVH A;  1QWJ A;  1TVY A;  2YCM A;  1ON8 A;  1WT2 A;  1ZCV A;  2WVK A;  4KT7 A;  1WVC A;  2YC3 A;  2I5K A;  2I7B A;  1INI A;  4FRB A;  1H5T B;  1R81 A;  1V83 A;  2X65 A;  3ZLK A;  1G23 A;  1EZI A;  4B42 A;  4GBP A;  1WSZ A;  2YQS A;  2AES A;  1WT3 A;  2VD4 A;  2VS3 A;  3TQD A;  4KC4 A;  3KIA A;  1VGT A;  1E5K A;  1H7G A;  1FG5 N;  5C4C A;  1YP3 A;  2RJ7 A;  4UEG A;  2PGY A;  3CKN A;  1FO9 A;  3U2T A;  2XWM A;  4M2B A;  3I0F A;  5CQP A;  1WT0 A;  3V8Z A;  2V0K A;  3QVB A;  1ZI3 A;  1H5S A;  1V84 A;  2OI7 A;  1H7E A;  2FYD B;  3I0C A;  1VGU A;  4Y64 A;  1LZI A;  4EEO A;  3Q80 A;  1R7V A;  1S4N A;  4B5B A;  1GWV A;  2E8B A;  3V91 A;  2WAW A;  4HO3 A;  4FRD A;  5C1G A;  2OI5 A;  3OH1 A;  4LW6 A;  4E1K A;  3CKJ A;  3U0Y A;  2Y4K A;  3I0L A;  2Y4J A;  5DDT A;  2AEC A;  4AYJ A;  3PKP A;  2VSI A;  5CMI A;  2E3D A;  1LVW A;  3K8D A;  3DUV A;  3ZGG A;  3R3I A;  4YS8 A;  1OMZ A;  1ZI1 A;  1ZJ1 A;  1VGW A;  2GGO A; 
#chains in the Genus database with same CATH homology
 2ICX A;  1S4O A;  2WVM A;  5C3A A;  4ECM A;  1QG8 A;  5CQL X;  1G3L A;  3USR A;  2OEF A;  4EEG A;  1R82 A;  3POL A;  2FYA A;  4D0T A;  1G1L A;  1H5S B;  3OH0 A;  1G97 A;  2AM3 A;  4Y7G A;  2O1H A;  3V0N A;  4FRA A;  2PGV A;  1VPA A;  1LZ7 A;  4L41 C;  1QGQ A;  4D0Z A;  3F1C A;  1V82 A;  1G93 A;  1GQC A;  4FRM A;  2APC A;  4JIS A;  3OC9 A;  3T7M A;  3JTJ A;  1Z90 A;  3U0X A;  4B4B A;  4FRH A;  2YQJ A;  2P6W A;  5IFY A;  2FYB A;  2WEE A;  1O7O A;  3DJ4 A;  1OMX A;  4K6R A;  4G87 A;  1VH3 A;  4O6M A;  4IRQ A;  2XME A;  1W57 A;  4ASJ A;  3ST8 A;  4Y6N A;  2O1F A;  4P02 A;  5EJZ A;  5C1L A;  1S4P A;  3SXD A;  5EIY A;  5C4F A;  3OH3 A;  4DDZ A;  1FWY A;  5DDV A;  4HO6 A;  4M2A A;  1W77 A;  4FIX A;  4MYB A;  2V0H A;  2VXM A;  5JQQ A;  5L6V A;  4CJ8 A;  1GWW A;  1JV1 A;  1FXO A;  2D0J A;  1ZJ2 A;  1G0R A;  1G2V A;  3DK5 A;  5C47 A;  4KRV A;  1GX0 A;  1EYR A;  2AM5 A;  2W0W A;  1VIC A;  2X5S A;  2RJ9 A;  1ZJ3 A;  4M4K A;  4FRL A;  1LL3 A;  5FTS A;  4D48 A;  4BMA A;  3V0P A;  1WT1 A;  2RIX A;  2XWL A;  2J0B A;  3SX7 A;  4Y63 A;  1HM9 A;  5C4E A;  2VS5 A;  2Y4M A;  1H7F A;  2WVL A;  1I52 A;  2BO8 A;  1ZDF A;  1YP2 A;  1VM8 A;  4MIX A;  4KQL A;  4B4G A;  3U2W A;  3R2W A;  5AJN A;  5HS2 A;  2RIZ A;  1G8O A;  4HO8 A;  1H4D A;  4NAL A;  2W0V A;  4B2X A;  2WE9 A;  4AC3 A;  2XWN A;  1FR9 A;  1H7Q A;  1FR8 A;  2JCO A;  4HG6 A;  4EVW A;  4HO5 A;  1IIM A;  1HJJ A;  1LZJ A;  2ZU8 A;  1ZCT A;  1LL2 A;  1FRW A;  5CMJ A;  1H7H A;  3CKQ A;  3HL3 A;  2V0I A;  3FWW A;  2ZU9 A;  4HO4 A;  3T7O A;  5CQM X;  4FRE A;  4CJC A;  4D11 C;  4DE7 A;  4MND A;  2BO6 A;  3U2U A;  4DEC A;  4FRQ A;  3SX8 A;  2JCL A;  1HJL A;  5CMH A;  4ZDQ A;  1MP4 A;  1MC3 A;  4EE4 A;  1PZY B;  5CQO A;  3LW6 A;  1MP3 A;  1KWS A;  2QKX A;  3CKO A;  1SS9 A;  1ZCY A;  1NF5 B;  5IDT A;  2PX7 A;  4HO9 A;  2AM4 A;  2FYC B;  5FYE A;  3N9W A;  2V0L A;  3TZT A;  4KNX A;  1K4V A;  2VS4 A;  1GA8 A;  1TW1 A;  4CJB A;  1FGX A;  4Y6U A;  5D91 A;  3SX5 A;  1ZI4 A;  3T7N A;  1QGS A;  1XZ6 A;  3JUK A;  4C2S A;  4J18 A;  2NXV A;  3I0G A;  5FU0 A;  2CU2 A;  3RSB A;  3BRK X;  5C8R A;  4ARW A;  2YC5 A;  3CU0 A;  3D98 A;  3E26 A;  1G9R A;  3JUJ A;  3RMV A;  2Q4J A;  4KNR A;  1H5R A;  2AH9 A;  3K8E A;  3OH2 A;  2FFV A;  3USQ A;  3IOI A;  3FOQ A;  4Y7U A;  2DPW A;  2MZB A;  4FRO A;  5CMF X;  5L6S A;  3D8V A;  1YRO B;  5IDS A;  5C1H A;  4AYL A;  3ZGF A;  5FTV A;  2YQC A;  2XMH A;  1H5S C;  1MP5 A;  4G3Q A;  4NAK A;  2Z87 A;  1R7X A;  4B3U A;  1R7U A;  4FIY A;  4HCQ A;  4D11 A;  2JCJ A;  1G95 A;  3PKQ A;  1NKH B;  1ZCU A;  4IRP A;  4EE3 A;  1ZDG A;  3CKV A;  3I0I X;  2VFZ A;  4KC2 A;  2Y7A A;  4NAI A;  2BO4 A;  2Y6P A;  3SPT A;  2RJ1 A;  1H7L A;  1FO8 A;  3F1Y A;  4HO2 A;  3OKR A;  3GUE A;  2FFU A;  3U2V A;  4B2W A;  1VH1 A;  3IOH A;  4KPX A;  1H7T A;  5C49 A;  1GQ9 A;  4B4M A;  1ZIZ A;  1R7Y A;  2AE7 A;  4EE5 A;  4HO0 A;  2QGI A;  4Y7F A;  3SXE A;  3RMW A;  2QH5 A;  1H4E A;  1W55 A;  5C4D A;  5C48 A;  3OGZ A;  1ON6 A;  2J0A A;  2P73 A;  2PA4 A;  5C36 A;  1JYL A;  1GX4 A;  1ZJO A;  4Y7T A;  1OQM B;  1H4C A;  1R80 A;  2RJ5 A;  1VZX A;  1NQI B;  3I0H A;  3V0Q A;  4FQW A;  1PZT A;  2AGD A;  1FGG A;  1JV3 A;  1NWG B;  1FZW A;  2ZU7 A;  2VSH A;  1ZJ0 A;  3O3P A;  5CQN X;  3I0D A;  4BQH A;  2RJ8 A;  1XHB A;  1H3M A;  1HM0 A;  5C4B A;  1ZHJ A;  3V90 A;  1IIN A;  2RIY A;  3BCV A;  4FRP A;  1O0R A;  1NMM B;  4ASY A;  1O7Q A;  1ZI5 A;  1VZT A;  3I0K A;  2RJ6 A;  4Y7V A;  1H5S D;  5J49 A;  2RJ0 A;  3V0O A;  1R7T A;  4NAN A;  1NHE B;  1O23 B;  3ZLL A;  2A8W A;  4KC1 A;  4JD0 A;  1INJ A;  3NGW A;  1ZJP A;  3OAM A;  2WGZ A;  3I0J A;  2X5Z A;  5D92 A;  1VGZ A;  5AJO A;  2I5E A;  2V0J A;  3SX3 A;  2OEG A;  4Y9X A;  3SXG A;  5I1F A;  4Q7C A;  1JVG A;  5EJ1 A;  3U2X A;  2BO7 A;  2GGQ A;  2A8U A;  1LL0 A;  3ZF8 A;  4FCU A;  1HV9 A;  2D7R A;  1LZ0 A;  2Z86 A;  2RJ4 A;  4EEA A;  3PNN A;  4XWI A;  5FV9 A;  3EE5 A;  3I0E A;  1HM8 A;  2UX8 A;  1JVD A;  2D7I A;  2FY7 A;  2C0N A;  2ICY A;  5BXC A;  1H5T A;  4AAW A;  3IOJ A;  1JYK A;  2JCK A;  2P72 A;  4HOC A;  2OI6 A;  4R7P A;  5C38 A;  3V0M A;  4KPZ A;  2Y4L A;  5C3D A;  3Q4S A;  3E25 A;  5CMG X;  3CGX A;  5AJP A;  4FCE A;  1FXJ A;  4G3P A;  4Y62 A;  3SXA A;  3Q7U A;  3SXC A;  1YP4 A;  3D5N A;  3V0L A;  2VK9 A;  2YQH A;  4LW3 A;  1FOA A;  1TZF A;  2YES A;  5C3B A;  1VZU A;  4G3S A;  5FU8 A;  4EEM A;  4P00 A;  3SXB A;  1H5R B;  2RIT A;  4O6N A;  2O1G A;  2X60 A;  3V8Y A;  4KXO A;  3OH4 A;  1TW5 A;  2VXL A;  4M28 A;  5FUH A;  4CVH A;  1QWJ A;  1TVY A;  2YCM A;  1ON8 A;  1WT2 A;  1ZCV A;  2WVK A;  4KT7 A;  1WVC A;  2YC3 A;  2I5K A;  2I7B A;  1INI A;  4FRB A;  1H5T B;  1R81 A;  1V83 A;  2X65 A;  3ZLK A;  1G23 A;  1EZI A;  4B42 A;  4GBP A;  1WSZ A;  2YQS A;  2AES A;  1WT3 A;  2VD4 A;  2VS3 A;  3TQD A;  4KC4 A;  3KIA A;  1VGT A;  1E5K A;  1H7G A;  1FG5 N;  5C4C A;  1YP3 A;  2RJ7 A;  4UEG A;  2PGY A;  3CKN A;  1FO9 A;  3U2T A;  2XWM A;  4M2B A;  3I0F A;  5CQP A;  1WT0 A;  3V8Z A;  2V0K A;  3QVB A;  1ZI3 A;  1H5S A;  1V84 A;  2OI7 A;  1H7E A;  2FYD B;  3I0C A;  1VGU A;  4Y64 A;  1LZI A;  4EEO A;  3Q80 A;  1R7V A;  1S4N A;  4B5B A;  1GWV A;  2E8B A;  3V91 A;  2WAW A;  4HO3 A;  4FRD A;  5C1G A;  2OI5 A;  3OH1 A;  4LW6 A;  4E1K A;  3CKJ A;  3U0Y A;  2Y4K A;  3I0L A;  2Y4J A;  5DDT A;  2AEC A;  4AYJ A;  3PKP A;  2VSI A;  5CMI A;  2E3D A;  1LVW A;  3K8D A;  3DUV A;  3ZGG A;  3R3I A;  4YS8 A;  1OMZ A;  1ZI1 A;  1ZJ1 A;  1VGW A;  2GGO A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...