5C3DA

Crystal structure of abbb + udp-c-gal (short soak) + di
Total Genus 88
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
88
sequence length
284
structure length
278
Chain Sequence
FMVSLPRMVYPQPKVLTPCRKDVLVVTPWLAPIVWEGTFNIDILNEQFRLQNTTIGLTVFAIKKYVAFLKLFLETAEKHFMVGHRVHYYVFTDQPAAVPRVTLGTGRQLSVLEVRAYSMRRMEMISDFCERRFLSEVDYLVCVDVDMEFRDHVGVEILTPLFGTLHPSFYGSSREAFTYERRPQSQAYIPKDEGDFYYMGAFFGGSVQEVQRLTRACHQAMMVDQANGIEAVWHDESHLNKYLLRHKPTKVLSPEYLWDQQLLGWPAVLRKLRFTAVP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords Histo-blood group ABO system transferase
publication title High Resolution Structures of the Human ABO(H) Blood Group Enzymes in Complex with Donor Analogs Reveal That the Enzymes Utilize Multiple Donor Conformations to Bind Substrates in a Stepwise Manner.
pubmed doi rcsb
source organism Homo sapiens
total genus 88
structure length 278
sequence length 284
ec nomenclature ec 2.4.1.37: Fucosylgalactoside 3-alpha-galactosyltransferase.
pdb deposition date 2015-06-17
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.550.10 Alpha Beta Alpha-Beta Complex Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A 5c3dA00
4XWIA 2Y4KA 1GQ9A 4GBPA 3CKQA 4BMAA 1VICA 2AGDA 2JCOA 1OMZA 2WAWA 4G3SA 1YP4A 3HL3A 3SX5A 2I5EA 1G8OA 5AJOA 5FTSA 3SXCA 1INJA 1FR9A 1R82A 2AM4A 4AYJA 4ECMA 4B4GA 4EE4A 4Y64A 2P73A 1R7TA 4Y62A 2RJ6A 4Y9XA 2APCA 1NKHB 1VM8A 2JCJA 3T7MA 3V0LA 3D8VA 1ZI5A 2OEFA 1EZIA 5C1LA 1H7TA 4KPZA 4J18A 4R7PA 3CKOA 1FXJA 2X65A 1XHBA 2RJ1A 4Y63A 3T7NA 3ZLLA 1FXOA 1H5SB 1R81A 1G2VA 1LVWA 1ZDGA 4ZDQA 4Y6UA 1YP3A 1PZTA 2QH5A 2Y4MA 2ZU8A 5AJNA 1FRWA 1MC3A 4FRBA 5IFYA 1TVYA 3CKNA 2PGVA 2Z87A 3R3IA 2BO7A 2YC3A 3I0IX 4G87A 3EE5A 1H5RA 4Y7TA 2D0JA 1FGGA 4CJBA 1LZJA 1I52A 2WVKA 2QKXA 2XWLA 1SS9A 2RIYA 3SXEA 2WEEA 4FRPA 1G93A 2YQHA 5C49A 1S4NA 4FRDA 1G9RA 1XZ6A 3USRA 4Y6NA 4L41C 2RJ7A 4DE7A 3V8ZA 3E25A 3V91A 1GA8A 3CKVA 2ICYA 2PA4A 1H5SC 3OH1A 5C3BA 4IRQA 2A8WA 2AM3A 4M28A 4LW3A 3SPTA 3I0LA 1TW5A 1QGSA 3RSBA 1FR8A 3NGWA 3Q4SA 1VGUA 4KC4A 1LL3A 1R7UA 2ZU9A 4KNXA 2FYBA 1ZJOA 2FFUA 3BCVA 1H3MA 3U0YA 2YQCA 4D11A 2OI7A 4HOCA 1H5SD 3V0MA 1FWYA 4NAIA 3ZGGA 5IDSA 4HO6A 5FYEA 3OKRA 3SXGA 2RJ8A 3TZTA 1FO8A 2PGYA 5L6VA 1O7OA 2RIZA 2V0KA 3D5NA 2O1GA 2FY7A 2OI5A 4HCQA 1R7YA 1R80A 2DPWA 1MP4A 2RJ0A 2I5KA 3SX3A 1INIA 4Y7VA 2PX7A 1WT2A 2YESA 3Q7UA 1G97A 3O3PA 2A8UA 4AYLA 1W57A 4C2SA 1HM9A 3FWWA 3I0FA 3IOJA 4EVWA 4HO0A 3JTJA 5C3DA 4EEGA 2AE7A 2VD4A 1OMXA 3N9WA 2NXVA 4G3QA 1GWVA 2RITA 1Z90A 3PKQA 1ZCVA 1H7LA 1NHEB 4JISA 3USQA 4FREA 1V82A 1R7VA 1K4VA 1FZWA 4B2XA 1VZUA 3T7OA 2JCKA 5CQOA 2Q4JA 2YC5A 3DK5A 3V0PA 5EIYA 5FU0A 3PKPA 3R2WA 4D0ZA 2CU2A 4HO4A 1TZFA 2V0LA 4JD0A 3I0KA 4KC2A 1H7HA 1NQIB 5FUHA 2W0VA 3I0DA 2X5ZA 2RJ4A 3TQDA 3POLA 4YS8A 1MP3A 2W0WA 2WVLA 4K6RA 3V0NA 3U0XA 3JUJA 1NF5B 1O0RA 4ARWA 2WGZA 5C38A 1GWWA 3OC9A 1ON8A 1QWJA 2E8BA 3FOQA 1H5TA 1G95A 2VXLA 2AH9A 2O1HA 3OH3A 4EEAA 1HM0A 5C36A 4KC1A 2E3DA 1WVCA 4HO3A 2Y4LA 2BO6A 3K8DA 1GX0A 4B4BA 4KXOA 4G3PA 5CQMX 2V0JA 1VZXA 2ZU7A 1ZJ0A 1QG8A 4FROA 1G3LA 1R7XA 1V83A 5C4DA 4ASYA 3IOIA 1YROB 3IOHA 1H7EA 5CMJA 1H7QA 2FYAA 4KT7A 4D11C 1ZI4A 2XMEA 3CU0A 1ZCYA 5C4FA 3KIAA 2GGOA 4FRHA 3U2VA 3V0OA 1GQCA 5CMIA 3I0GA 5CQPA 4FRQA 1ZJ3A 4HO8A 1H4EA 1QGQA 1HM8A 3K8EA 3OAMA 2OEGA 1G23A 5C8RA 1LZ7A 3SXDA 3U2UA 1H5RB 4EEOA 1ZI1A 2AESA 2D7RA 1MP5A 3OH2A 2XWNA 4M2BA 5FTVA 3SX7A 5L6SA 1ZDFA 4ASJA 1HV9A 2AECA 1H5SA 1NMMB 1FGXA 3CGXA 4IRPA 4CJCA 3LW6A 4KQLA 3BRKX 3OGZA 3DJ4A 4BQHA 5C1HA 1FO9A 2WVMA 3V0QA 2FYDB 4B5BA 1ON6A 3ZLKA 5C48A 1E5KA 3SXBA 5C4EA 2RJ9A 3OH4A 1VZTA 1V84A 3CKJA 4UEGA 1FG5N 4B42A 2WE9A 1O23B 4M2AA 4MYBA 1W77A 4MNDA 4NALA 4FCUA 3ST8A 3I0HA 2AM5A 4B3UA 2OI6A 4B2WA 1WSZA 1LZIA 5C3AA 4HO5A 4KPXA 3OH0A 3U2XA 4HG6A 3E26A 4D48A 1WT3A 2ICXA 2YQJA 4M4KA 2BO8A 2UX8A 1H4DA 1VH1A 4DECA 4KNRA 5I1FA 1JVGA 3GUEA 3F1YA 5BXCA 2XWMA 3Q80A 3DUVA 2D7IA 2YQSA 3ZF8A 1ZJ2A 4P02A 4B4MA 2VXMA 1WT0A 1H7FA 1VH3A 5CMGX 4FRAA 1IINA 5DDVA 5FV9A 5C4CA 2Y7AA 1EYRA 5J49A 1NWGB 1VGTA 4LW6A 1ZCUA 2Y4JA 3D98A 3SX8A 1ZHJA 1JYKA 4FCEA 1VGZA 5EJ1A 4Y7FA 4EE3A 2VS3A 1WT1A 2Y6PA 4FRLA 1ZI3A 1PZYB 2VS4A 4NAKA 1JYLA 5C4BA 3PNNA 3U2TA 3JUKA 1S4OA 1O7QA 1LL0A 2P6WA 4Y7UA 4AC3A 2VSIA 3ZGFA 1JV1A 5EJZA 5CQNX 2RJ5A 2I7BA 1YP2A 1FOAA 1TW1A 1ZCTA 3I0CA 3V8YA 5CMFX 1KWSA 4D0TA 5C1GA 5JQQA 4HO2A 5AJPA 4EE5A 2O1FA 1LZ0A 1GX4A 1G1LA 2XMHA 3RMVA 1H4CA 4FQWA 5IDTA 1S4PA 1OQMB 1H7GA 2VS5A 4CJ8A 2MZBA 4CVHA 1HJJA 1ZIZA 3RMWA 3U2WA 2BO4A 5CMHA 1HJLA 4Y7GA 3SXAA 2Z86A 2FFVA 2JCLA 3I0EA 2GGQA 2V0IA 2VSHA 3QVBA 4NANA 3V90A 4AAWA 5CQLX 1IIMA 4EEMA 1H5TB 1VPAA 2X60A 5FU8A 1JVDA 3I0JA 1ZJ1A 4KRVA 4FRMA 2V0HA 5C47A 4HO9A 2FYCB 2X5SA 4P00A 1ZJPA 5DDTA 1LL2A 2YCMA 4DDZA 2VFZA 5HS2A 4E1KA 1G0RA 3F1CA 1W55A 1VGWA 2P72A 2QGIA 1JV3A 2RIXA
chains in the Genus database with same CATH superfamily
4XWIA 2Y4KA 1GQ9A 4GBPA 3CKQA 4BMAA 1VICA 2AGDA 2JCOA 1OMZA 2WAWA 4G3SA 1YP4A 3HL3A 3SX5A 2I5EA 1G8OA 4MIXA 5AJOA 5FTSA 3SXCA 1INJA 1FR9A 1R82A 2AM4A 4AYJA 4ECMA 4B4GA 4EE4A 4Y64A 2P73A 1R7TA 4Y62A 2RJ6A 4Y9XA 2APCA 1NKHB 1VM8A 2JCJA 3T7MA 3V0LA 5D91A 3D8VA 1ZI5A 2OEFA 1EZIA 5C1LA 1H7TA 4KPZA 4J18A 4R7PA 3CKOA 1FXJA 2X65A 1XHBA 2RJ1A 4FIYA 4Y63A 4O6MA 3T7NA 3ZLLA 1FXOA 1H5SB 1R81A 1G2VA 1LVWA 1ZDGA 4ZDQA 4Y6UA 4FIXA 1YP3A 1PZTA 2QH5A 2Y4MA 2ZU8A 5AJNA 1FRWA 1MC3A 4FRBA 5IFYA 1TVYA 3CKNA 2PGVA 2Z87A 3R3IA 2BO7A 2YC3A 3I0IX 4G87A 3EE5A 1H5RA 4Y7TA 2D0JA 1FGGA 4CJBA 1LZJA 1I52A 2WVKA 2QKXA 2XWLA 1SS9A 2RIYA 3SXEA 2WEEA 4FRPA 1G93A 2YQHA 5C49A 1S4NA 4FRDA 1G9RA 1XZ6A 3USRA 4Y6NA 4L41C 2RJ7A 4DE7A 3V8ZA 3E25A 3V91A 1GA8A 3CKVA 2ICYA 2J0BA 2PA4A 1H5SC 3OH1A 5C3BA 4IRQA 2A8WA 2AM3A 4M28A 4LW3A 3SPTA 3I0LA 1TW5A 1QGSA 3RSBA 1FR8A 3NGWA 3Q4SA 1VGUA 4KC4A 1LL3A 1R7UA 2ZU9A 4KNXA 2FYBA 1ZJOA 2FFUA 3BCVA 1H3MA 3U0YA 2YQCA 4D11A 2OI7A 4HOCA 1H5SD 3V0MA 1FWYA 4NAIA 3ZGGA 5IDSA 4HO6A 5FYEA 3OKRA 3SXGA 2RJ8A 3TZTA 1FO8A 2PGYA 5L6VA 1O7OA 2RIZA 2V0KA 3D5NA 2O1GA 2FY7A 2OI5A 4HCQA 1R7YA 1R80A 2DPWA 1MP4A 2RJ0A 2I5KA 3SX3A 1INIA 4Y7VA 2PX7A 1WT2A 2YESA 3Q7UA 1G97A 3O3PA 2A8UA 4AYLA 1W57A 4C2SA 1HM9A 3FWWA 3I0FA 3IOJA 4EVWA 4HO0A 3JTJA 5C3DA 4EEGA 2AE7A 2VD4A 1OMXA 3N9WA 2NXVA 4G3QA 1GWVA 2RITA 1Z90A 3PKQA 1ZCVA 1H7LA 1NHEB 4JISA 3USQA 4FREA 1V82A 1R7VA 1K4VA 1FZWA 4B2XA 1VZUA 3T7OA 2JCKA 5CQOA 2Q4JA 2YC5A 3DK5A 3V0PA 5EIYA 5FU0A 3PKPA 3R2WA 4D0ZA 2CU2A 4HO4A 1TZFA 2V0LA 4JD0A 3I0KA 4KC2A 1H7HA 1NQIB 5FUHA 2W0VA 3I0DA 2X5ZA 2RJ4A 3TQDA 3POLA 4YS8A 1MP3A 2W0WA 2WVLA 4K6RA 3V0NA 3U0XA 3JUJA 1NF5B 1O0RA 4ARWA 2WGZA 5C38A 1GWWA 3OC9A 1ON8A 1QWJA 2E8BA 3FOQA 1H5TA 1G95A 2VXLA 2AH9A 2O1HA 3OH3A 4EEAA 1HM0A 5C36A 4KC1A 2E3DA 1WVCA 4HO3A 2Y4LA 2BO6A 3K8DA 1GX0A 4B4BA 4KXOA 4G3PA 5CQMX 2V0JA 1VZXA 2ZU7A 1ZJ0A 1QG8A 4FROA 1G3LA 1R7XA 1V83A 5C4DA 4ASYA 3IOIA 1YROB 3IOHA 1H7EA 5CMJA 1H7QA 2FYAA 4KT7A 4D11C 1ZI4A 2XMEA 3CU0A 1ZCYA 5C4FA 3KIAA 2GGOA 4FRHA 3U2VA 3V0OA 1GQCA 5CMIA 3I0GA 5CQPA 4FRQA 1ZJ3A 4HO8A 1H4EA 1QGQA 1HM8A 3K8EA 2VK9A 3OAMA 2OEGA 1G23A 5C8RA 1LZ7A 3SXDA 3U2UA 1H5RB 4EEOA 1ZI1A 2AESA 2D7RA 1MP5A 3OH2A 2XWNA 4M2BA 5FTVA 3SX7A 5L6SA 1ZDFA 4ASJA 1HV9A 2AECA 1H5SA 1NMMB 1FGXA 3CGXA 4IRPA 4CJCA 3LW6A 4KQLA 3BRKX 3OGZA 3DJ4A 4BQHA 5C1HA 1FO9A 2WVMA 3V0QA 2FYDB 5D92A 4B5BA 1ON6A 3ZLKA 5C48A 1E5KA 3SXBA 5C4EA 2RJ9A 3OH4A 1VZTA 1V84A 3CKJA 4UEGA 1FG5N 4B42A 2WE9A 1O23B 4M2AA 4MYBA 1W77A 4MNDA 4NALA 4FCUA 3ST8A 3I0HA 2AM5A 4B3UA 2OI6A 4B2WA 1WSZA 1LZIA 5C3AA 4HO5A 4KPXA 3OH0A 3U2XA 4HG6A 3E26A 2J0AA 4D48A 1WT3A 2ICXA 2YQJA 4M4KA 2BO8A 2UX8A 1H4DA 1VH1A 4DECA 4KNRA 5I1FA 1JVGA 3GUEA 3F1YA 5BXCA 2XWMA 3Q80A 3DUVA 2D7IA 2YQSA 3ZF8A 1ZJ2A 4P02A 4B4MA 2VXMA 1WT0A 1H7FA 1VH3A 5CMGX 4FRAA 1IINA 5DDVA 5FV9A 5C4CA 2Y7AA 1EYRA 5J49A 1NWGB 1VGTA 4O6NA 4LW6A 1ZCUA 2Y4JA 3D98A 3SX8A 1ZHJA 1JYKA 4FCEA 1VGZA 2C0NA 5EJ1A 4Y7FA 4EE3A 2VS3A 1WT1A 2Y6PA 4FRLA 1ZI3A 1PZYB 2VS4A 4NAKA 1JYLA 5C4BA 3PNNA 3U2TA 3JUKA 1S4OA 1O7QA 1LL0A 2P6WA 4Y7UA 4AC3A 2VSIA 3ZGFA 1JV1A 5EJZA 5CQNX 2RJ5A 2I7BA 1YP2A 1FOAA 1TW1A 1ZCTA 3I0CA 3V8YA 5CMFX 1KWSA 4D0TA 5C1GA 5JQQA 4HO2A 5AJPA 4EE5A 2O1FA 1LZ0A 1GX4A 1G1LA 2XMHA 3RMVA 1H4CA 4FQWA 5IDTA 1S4PA 1OQMB 1H7GA 2VS5A 4CJ8A 2MZBA 4CVHA 1HJJA 1ZIZA 3RMWA 3U2WA 2BO4A 5CMHA 1HJLA 4Y7GA 3SXAA 2Z86A 2FFVA 2JCLA 3I0EA 2GGQA 2V0IA 2VSHA 3QVBA 4NANA 3V90A 4AAWA 5CQLX 1IIMA 4Q7CA 4EEMA 1H5TB 1VPAA 2X60A 5FU8A 1JVDA 3I0JA 1ZJ1A 4KRVA 4FRMA 2V0HA 5C47A 4HO9A 2FYCB 2X5SA 4P00A 1ZJPA 5DDTA 1LL2A 2YCMA 4DDZA 2VFZA 5HS2A 4E1KA 1G0RA 3F1CA 1W55A 1VGWA 2P72A 2QGIA 1JV3A 2RIXA
chains in the Genus database with same CATH topology
4XWIA 2Y4KA 1GQ9A 4GBPA 3CKQA 4BMAA 1VICA 2AGDA 2JCOA 1OMZA 2WAWA 4G3SA 1YP4A 3HL3A 3SX5A 2I5EA 1G8OA 4MIXA 5AJOA 5FTSA 3SXCA 1INJA 1FR9A 1R82A 2AM4A 4AYJA 4ECMA 4B4GA 4EE4A 4Y64A 2P73A 1R7TA 4Y62A 2RJ6A 4Y9XA 2APCA 1NKHB 1VM8A 2JCJA 3T7MA 3V0LA 5D91A 3D8VA 1ZI5A 2OEFA 1EZIA 5C1LA 1H7TA 4KPZA 4J18A 4R7PA 3CKOA 1FXJA 2X65A 1XHBA 2RJ1A 4FIYA 4Y63A 4O6MA 3T7NA 3ZLLA 1FXOA 1H5SB 1R81A 1G2VA 1LVWA 1ZDGA 4ZDQA 4Y6UA 4FIXA 1YP3A 1PZTA 2QH5A 2Y4MA 2ZU8A 5AJNA 1FRWA 1MC3A 4FRBA 5IFYA 1TVYA 3CKNA 2PGVA 2Z87A 3R3IA 2BO7A 2YC3A 3I0IX 4G87A 3EE5A 1H5RA 4Y7TA 2D0JA 1FGGA 4CJBA 1LZJA 1I52A 2WVKA 2QKXA 2XWLA 1SS9A 2RIYA 3SXEA 2WEEA 4FRPA 1G93A 2YQHA 5C49A 1S4NA 4FRDA 1G9RA 1XZ6A 3USRA 4Y6NA 4L41C 2RJ7A 4DE7A 3V8ZA 3E25A 3V91A 1GA8A 3CKVA 2ICYA 2J0BA 2PA4A 1H5SC 3OH1A 5C3BA 4IRQA 2A8WA 2AM3A 4M28A 4LW3A 3SPTA 3I0LA 1TW5A 1QGSA 3RSBA 1FR8A 3NGWA 3Q4SA 1VGUA 4KC4A 1LL3A 1R7UA 2ZU9A 4KNXA 2FYBA 1ZJOA 2FFUA 3BCVA 1H3MA 3U0YA 2YQCA 4D11A 2OI7A 4HOCA 1H5SD 3V0MA 1FWYA 4NAIA 3ZGGA 5IDSA 4HO6A 5FYEA 3OKRA 3SXGA 2RJ8A 3TZTA 1FO8A 2PGYA 5L6VA 1O7OA 2RIZA 2V0KA 3D5NA 2O1GA 2FY7A 2OI5A 4HCQA 1R7YA 1R80A 2DPWA 1MP4A 2RJ0A 2I5KA 3SX3A 1INIA 4Y7VA 2PX7A 1WT2A 2YESA 3Q7UA 1G97A 3O3PA 2A8UA 4AYLA 1W57A 4C2SA 1HM9A 3FWWA 3I0FA 3IOJA 4EVWA 4HO0A 3JTJA 5C3DA 4EEGA 2AE7A 2VD4A 1OMXA 3N9WA 2NXVA 4G3QA 1GWVA 2RITA 1Z90A 3PKQA 1ZCVA 1H7LA 1NHEB 4JISA 3USQA 4FREA 1V82A 1R7VA 1K4VA 1FZWA 4B2XA 1VZUA 3T7OA 2JCKA 5CQOA 2Q4JA 2YC5A 3DK5A 3V0PA 5EIYA 5FU0A 3PKPA 3R2WA 4D0ZA 2CU2A 4HO4A 1TZFA 2V0LA 4JD0A 3I0KA 4KC2A 1H7HA 1NQIB 5FUHA 2W0VA 3I0DA 2X5ZA 2RJ4A 3TQDA 3POLA 4YS8A 1MP3A 2W0WA 2WVLA 4K6RA 3V0NA 3U0XA 3JUJA 1NF5B 1O0RA 4ARWA 2WGZA 5C38A 1GWWA 3OC9A 1ON8A 1QWJA 2E8BA 3FOQA 1H5TA 1G95A 2VXLA 2AH9A 2O1HA 3OH3A 4EEAA 1HM0A 5C36A 4KC1A 2E3DA 1WVCA 4HO3A 2Y4LA 2BO6A 3K8DA 1GX0A 4B4BA 4KXOA 4G3PA 5CQMX 2V0JA 1VZXA 2ZU7A 1ZJ0A 1QG8A 4FROA 1G3LA 1R7XA 1V83A 5C4DA 4ASYA 3IOIA 1YROB 3IOHA 1H7EA 5CMJA 1H7QA 2FYAA 4KT7A 4D11C 1ZI4A 2XMEA 3CU0A 1ZCYA 5C4FA 3KIAA 2GGOA 4FRHA 3U2VA 3V0OA 1GQCA 5CMIA 3I0GA 5CQPA 4FRQA 1ZJ3A 4HO8A 1H4EA 1QGQA 1HM8A 3K8EA 2VK9A 3OAMA 2OEGA 1G23A 5C8RA 1LZ7A 3SXDA 3U2UA 1H5RB 4EEOA 1ZI1A 2AESA 2D7RA 1MP5A 3OH2A 2XWNA 4M2BA 5FTVA 3SX7A 5L6SA 1ZDFA 4ASJA 1HV9A 2AECA 1H5SA 1NMMB 1FGXA 3CGXA 4IRPA 4CJCA 3LW6A 4KQLA 3BRKX 3OGZA 3DJ4A 4BQHA 5C1HA 1FO9A 2WVMA 3V0QA 2FYDB 5D92A 4B5BA 1ON6A 3ZLKA 5C48A 1E5KA 3SXBA 5C4EA 2RJ9A 3OH4A 1VZTA 1V84A 3CKJA 4UEGA 1FG5N 4B42A 2WE9A 1O23B 4M2AA 4MYBA 1W77A 4MNDA 4NALA 4FCUA 3ST8A 3I0HA 2AM5A 4B3UA 2OI6A 4B2WA 1WSZA 1LZIA 5C3AA 4HO5A 4KPXA 3OH0A 3U2XA 4HG6A 3E26A 2J0AA 4D48A 1WT3A 2ICXA 2YQJA 4M4KA 2BO8A 2UX8A 1H4DA 1VH1A 4DECA 4KNRA 5I1FA 1JVGA 3GUEA 3F1YA 5BXCA 2XWMA 3Q80A 3DUVA 2D7IA 2YQSA 3ZF8A 1ZJ2A 4P02A 4B4MA 2VXMA 1WT0A 1H7FA 1VH3A 5CMGX 4FRAA 1IINA 5DDVA 5FV9A 5C4CA 2Y7AA 1EYRA 5J49A 1NWGB 1VGTA 4O6NA 4LW6A 1ZCUA 2Y4JA 3D98A 3SX8A 1ZHJA 1JYKA 4FCEA 1VGZA 2C0NA 5EJ1A 4Y7FA 4EE3A 2VS3A 1WT1A 2Y6PA 4FRLA 1ZI3A 1PZYB 2VS4A 4NAKA 1JYLA 5C4BA 3PNNA 3U2TA 3JUKA 1S4OA 1O7QA 1LL0A 2P6WA 4Y7UA 4AC3A 2VSIA 3ZGFA 1JV1A 5EJZA 5CQNX 2RJ5A 2I7BA 1YP2A 1FOAA 1TW1A 1ZCTA 3I0CA 3V8YA 5CMFX 1KWSA 4D0TA 5C1GA 5JQQA 4HO2A 5AJPA 4EE5A 2O1FA 1LZ0A 1GX4A 1G1LA 2XMHA 3RMVA 1H4CA 4FQWA 5IDTA 1S4PA 1OQMB 1H7GA 2VS5A 4CJ8A 2MZBA 4CVHA 1HJJA 1ZIZA 3RMWA 3U2WA 2BO4A 5CMHA 1HJLA 4Y7GA 3SXAA 2Z86A 2FFVA 2JCLA 3I0EA 2GGQA 2V0IA 2VSHA 3QVBA 4NANA 3V90A 4AAWA 5CQLX 1IIMA 4Q7CA 4EEMA 1H5TB 1VPAA 2X60A 5FU8A 1JVDA 3I0JA 1ZJ1A 4KRVA 4FRMA 2V0HA 5C47A 4HO9A 2FYCB 2X5SA 4P00A 1ZJPA 5DDTA 1LL2A 2YCMA 4DDZA 2VFZA 5HS2A 4E1KA 1G0RA 3F1CA 1W55A 1VGWA 2P72A 2QGIA 1JV3A 2RIXA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4XWI A;  2Y4K A;  1GQ9 A;  4GBP A;  3CKQ A;  4BMA A;  1VIC A;  2AGD A;  2JCO A;  1OMZ A;  2WAW A;  4G3S A;  1YP4 A;  3HL3 A;  3SX5 A;  2I5E A;  1G8O A;  5AJO A;  5FTS A;  3SXC A;  1INJ A;  1FR9 A;  1R82 A;  2AM4 A;  4AYJ A;  4ECM A;  4B4G A;  4EE4 A;  4Y64 A;  2P73 A;  1R7T A;  4Y62 A;  2RJ6 A;  4Y9X A;  2APC A;  1NKH B;  1VM8 A;  2JCJ A;  3T7M A;  3V0L A;  3D8V A;  1ZI5 A;  2OEF A;  1EZI A;  5C1L A;  1H7T A;  4KPZ A;  4J18 A;  4R7P A;  3CKO A;  1FXJ A;  2X65 A;  1XHB A;  2RJ1 A;  4Y63 A;  3T7N A;  3ZLL A;  1FXO A;  1H5S B;  1R81 A;  1G2V A;  1LVW A;  1ZDG A;  4ZDQ A;  4Y6U A;  1YP3 A;  1PZT A;  2QH5 A;  2Y4M A;  2ZU8 A;  5AJN A;  1FRW A;  1MC3 A;  4FRB A;  5IFY A;  1TVY A;  3CKN A;  2PGV A;  2Z87 A;  3R3I A;  2BO7 A;  2YC3 A;  3I0I X;  4G87 A;  3EE5 A;  1H5R A;  4Y7T A;  2D0J A;  1FGG A;  4CJB A;  1LZJ A;  1I52 A;  2WVK A;  2QKX A;  2XWL A;  1SS9 A;  2RIY A;  3SXE A;  2WEE A;  4FRP A;  1G93 A;  2YQH A;  5C49 A;  1S4N A;  4FRD A;  1G9R A;  1XZ6 A;  3USR A;  4Y6N A;  4L41 C;  2RJ7 A;  4DE7 A;  3V8Z A;  3E25 A;  3V91 A;  1GA8 A;  3CKV A;  2ICY A;  2PA4 A;  1H5S C;  3OH1 A;  5C3B A;  4IRQ A;  2A8W A;  2AM3 A;  4M28 A;  4LW3 A;  3SPT A;  3I0L A;  1TW5 A;  1QGS A;  3RSB A;  1FR8 A;  3NGW A;  3Q4S A;  1VGU A;  4KC4 A;  1LL3 A;  1R7U A;  2ZU9 A;  4KNX A;  2FYB A;  1ZJO A;  2FFU A;  3BCV A;  1H3M A;  3U0Y A;  2YQC A;  4D11 A;  2OI7 A;  4HOC A;  1H5S D;  3V0M A;  1FWY A;  4NAI A;  3ZGG A;  5IDS A;  4HO6 A;  5FYE A;  3OKR A;  3SXG A;  2RJ8 A;  3TZT A;  1FO8 A;  2PGY A;  5L6V A;  1O7O A;  2RIZ A;  2V0K A;  3D5N A;  2O1G A;  2FY7 A;  2OI5 A;  4HCQ A;  1R7Y A;  1R80 A;  2DPW A;  1MP4 A;  2RJ0 A;  2I5K A;  3SX3 A;  1INI A;  4Y7V A;  2PX7 A;  1WT2 A;  2YES A;  3Q7U A;  1G97 A;  3O3P A;  2A8U A;  4AYL A;  1W57 A;  4C2S A;  1HM9 A;  3FWW A;  3I0F A;  3IOJ A;  4EVW A;  4HO0 A;  3JTJ A;  5C3D A;  4EEG A;  2AE7 A;  2VD4 A;  1OMX A;  3N9W A;  2NXV A;  4G3Q A;  1GWV A;  2RIT A;  1Z90 A;  3PKQ A;  1ZCV A;  1H7L A;  1NHE B;  4JIS A;  3USQ A;  4FRE A;  1V82 A;  1R7V A;  1K4V A;  1FZW A;  4B2X A;  1VZU A;  3T7O A;  2JCK A;  5CQO A;  2Q4J A;  2YC5 A;  3DK5 A;  3V0P A;  5EIY A;  5FU0 A;  3PKP A;  3R2W A;  4D0Z A;  2CU2 A;  4HO4 A;  1TZF A;  2V0L A;  4JD0 A;  3I0K A;  4KC2 A;  1H7H A;  1NQI B;  5FUH A;  2W0V A;  3I0D A;  2X5Z A;  2RJ4 A;  3TQD A;  3POL A;  4YS8 A;  1MP3 A;  2W0W A;  2WVL A;  4K6R A;  3V0N A;  3U0X A;  3JUJ A;  1NF5 B;  1O0R A;  4ARW A;  2WGZ A;  5C38 A;  1GWW A;  3OC9 A;  1ON8 A;  1QWJ A;  2E8B A;  3FOQ A;  1H5T A;  1G95 A;  2VXL A;  2AH9 A;  2O1H A;  3OH3 A;  4EEA A;  1HM0 A;  5C36 A;  4KC1 A;  2E3D A;  1WVC A;  4HO3 A;  2Y4L A;  2BO6 A;  3K8D A;  1GX0 A;  4B4B A;  4KXO A;  4G3P A;  5CQM X;  2V0J A;  1VZX A;  2ZU7 A;  1ZJ0 A;  1QG8 A;  4FRO A;  1G3L A;  1R7X A;  1V83 A;  5C4D A;  4ASY A;  3IOI A;  1YRO B;  3IOH A;  1H7E A;  5CMJ A;  1H7Q A;  2FYA A;  4KT7 A;  4D11 C;  1ZI4 A;  2XME A;  3CU0 A;  1ZCY A;  5C4F A;  3KIA A;  2GGO A;  4FRH A;  3U2V A;  3V0O A;  1GQC A;  5CMI A;  3I0G A;  5CQP A;  4FRQ A;  1ZJ3 A;  4HO8 A;  1H4E A;  1QGQ A;  1HM8 A;  3K8E A;  3OAM A;  2OEG A;  1G23 A;  5C8R A;  1LZ7 A;  3SXD A;  3U2U A;  1H5R B;  4EEO A;  1ZI1 A;  2AES A;  2D7R A;  1MP5 A;  3OH2 A;  2XWN A;  4M2B A;  5FTV A;  3SX7 A;  5L6S A;  1ZDF A;  4ASJ A;  1HV9 A;  2AEC A;  1H5S A;  1NMM B;  1FGX A;  3CGX A;  4IRP A;  4CJC A;  3LW6 A;  4KQL A;  3BRK X;  3OGZ A;  3DJ4 A;  4BQH A;  5C1H A;  1FO9 A;  2WVM A;  3V0Q A;  2FYD B;  4B5B A;  1ON6 A;  3ZLK A;  5C48 A;  1E5K A;  3SXB A;  5C4E A;  2RJ9 A;  3OH4 A;  1VZT A;  1V84 A;  3CKJ A;  4UEG A;  1FG5 N;  4B42 A;  2WE9 A;  1O23 B;  4M2A A;  4MYB A;  1W77 A;  4MND A;  4NAL A;  4FCU A;  3ST8 A;  3I0H A;  2AM5 A;  4B3U A;  2OI6 A;  4B2W A;  1WSZ A;  1LZI A;  5C3A A;  4HO5 A;  4KPX A;  3OH0 A;  3U2X A;  4HG6 A;  3E26 A;  4D48 A;  1WT3 A;  2ICX A;  2YQJ A;  4M4K A;  2BO8 A;  2UX8 A;  1H4D A;  1VH1 A;  4DEC A;  4KNR A;  5I1F A;  1JVG A;  3GUE A;  3F1Y A;  5BXC A;  2XWM A;  3Q80 A;  3DUV A;  2D7I A;  2YQS A;  3ZF8 A;  1ZJ2 A;  4P02 A;  4B4M A;  2VXM A;  1WT0 A;  1H7F A;  1VH3 A;  5CMG X;  4FRA A;  1IIN A;  5DDV A;  5FV9 A;  5C4C A;  2Y7A A;  1EYR A;  5J49 A;  1NWG B;  1VGT A;  4LW6 A;  1ZCU A;  2Y4J A;  3D98 A;  3SX8 A;  1ZHJ A;  1JYK A;  4FCE A;  1VGZ A;  5EJ1 A;  4Y7F A;  4EE3 A;  2VS3 A;  1WT1 A;  2Y6P A;  4FRL A;  1ZI3 A;  1PZY B;  2VS4 A;  4NAK A;  1JYL A;  5C4B A;  3PNN A;  3U2T A;  3JUK A;  1S4O A;  1O7Q A;  1LL0 A;  2P6W A;  4Y7U A;  4AC3 A;  2VSI A;  3ZGF A;  1JV1 A;  5EJZ A;  5CQN X;  2RJ5 A;  2I7B A;  1YP2 A;  1FOA A;  1TW1 A;  1ZCT A;  3I0C A;  3V8Y A;  5CMF X;  1KWS A;  4D0T A;  5C1G A;  5JQQ A;  4HO2 A;  5AJP A;  4EE5 A;  2O1F A;  1LZ0 A;  1GX4 A;  1G1L A;  2XMH A;  3RMV A;  1H4C A;  4FQW A;  5IDT A;  1S4P A;  1OQM B;  1H7G A;  2VS5 A;  4CJ8 A;  2MZB A;  4CVH A;  1HJJ A;  1ZIZ A;  3RMW A;  3U2W A;  2BO4 A;  5CMH A;  1HJL A;  4Y7G A;  3SXA A;  2Z86 A;  2FFV A;  2JCL A;  3I0E A;  2GGQ A;  2V0I A;  2VSH A;  3QVB A;  4NAN A;  3V90 A;  4AAW A;  5CQL X;  1IIM A;  4EEM A;  1H5T B;  1VPA A;  2X60 A;  5FU8 A;  1JVD A;  3I0J A;  1ZJ1 A;  4KRV A;  4FRM A;  2V0H A;  5C47 A;  4HO9 A;  2FYC B;  2X5S A;  4P00 A;  1ZJP A;  5DDT A;  1LL2 A;  2YCM A;  4DDZ A;  2VFZ A;  5HS2 A;  4E1K A;  1G0R A;  3F1C A;  1W55 A;  1VGW A;  2P72 A;  2QGI A;  1JV3 A;  2RIX A; 
#chains in the Genus database with same CATH topology
 4XWI A;  2Y4K A;  1GQ9 A;  4GBP A;  3CKQ A;  4BMA A;  1VIC A;  2AGD A;  2JCO A;  1OMZ A;  2WAW A;  4G3S A;  1YP4 A;  3HL3 A;  3SX5 A;  2I5E A;  1G8O A;  4MIX A;  5AJO A;  5FTS A;  3SXC A;  1INJ A;  1FR9 A;  1R82 A;  2AM4 A;  4AYJ A;  4ECM A;  4B4G A;  4EE4 A;  4Y64 A;  2P73 A;  1R7T A;  4Y62 A;  2RJ6 A;  4Y9X A;  2APC A;  1NKH B;  1VM8 A;  2JCJ A;  3T7M A;  3V0L A;  5D91 A;  3D8V A;  1ZI5 A;  2OEF A;  1EZI A;  5C1L A;  1H7T A;  4KPZ A;  4J18 A;  4R7P A;  3CKO A;  1FXJ A;  2X65 A;  1XHB A;  2RJ1 A;  4FIY A;  4Y63 A;  4O6M A;  3T7N A;  3ZLL A;  1FXO A;  1H5S B;  1R81 A;  1G2V A;  1LVW A;  1ZDG A;  4ZDQ A;  4Y6U A;  4FIX A;  1YP3 A;  1PZT A;  2QH5 A;  2Y4M A;  2ZU8 A;  5AJN A;  1FRW A;  1MC3 A;  4FRB A;  5IFY A;  1TVY A;  3CKN A;  2PGV A;  2Z87 A;  3R3I A;  2BO7 A;  2YC3 A;  3I0I X;  4G87 A;  3EE5 A;  1H5R A;  4Y7T A;  2D0J A;  1FGG A;  4CJB A;  1LZJ A;  1I52 A;  2WVK A;  2QKX A;  2XWL A;  1SS9 A;  2RIY A;  3SXE A;  2WEE A;  4FRP A;  1G93 A;  2YQH A;  5C49 A;  1S4N A;  4FRD A;  1G9R A;  1XZ6 A;  3USR A;  4Y6N A;  4L41 C;  2RJ7 A;  4DE7 A;  3V8Z A;  3E25 A;  3V91 A;  1GA8 A;  3CKV A;  2ICY A;  2J0B A;  2PA4 A;  1H5S C;  3OH1 A;  5C3B A;  4IRQ A;  2A8W A;  2AM3 A;  4M28 A;  4LW3 A;  3SPT A;  3I0L A;  1TW5 A;  1QGS A;  3RSB A;  1FR8 A;  3NGW A;  3Q4S A;  1VGU A;  4KC4 A;  1LL3 A;  1R7U A;  2ZU9 A;  4KNX A;  2FYB A;  1ZJO A;  2FFU A;  3BCV A;  1H3M A;  3U0Y A;  2YQC A;  4D11 A;  2OI7 A;  4HOC A;  1H5S D;  3V0M A;  1FWY A;  4NAI A;  3ZGG A;  5IDS A;  4HO6 A;  5FYE A;  3OKR A;  3SXG A;  2RJ8 A;  3TZT A;  1FO8 A;  2PGY A;  5L6V A;  1O7O A;  2RIZ A;  2V0K A;  3D5N A;  2O1G A;  2FY7 A;  2OI5 A;  4HCQ A;  1R7Y A;  1R80 A;  2DPW A;  1MP4 A;  2RJ0 A;  2I5K A;  3SX3 A;  1INI A;  4Y7V A;  2PX7 A;  1WT2 A;  2YES A;  3Q7U A;  1G97 A;  3O3P A;  2A8U A;  4AYL A;  1W57 A;  4C2S A;  1HM9 A;  3FWW A;  3I0F A;  3IOJ A;  4EVW A;  4HO0 A;  3JTJ A;  5C3D A;  4EEG A;  2AE7 A;  2VD4 A;  1OMX A;  3N9W A;  2NXV A;  4G3Q A;  1GWV A;  2RIT A;  1Z90 A;  3PKQ A;  1ZCV A;  1H7L A;  1NHE B;  4JIS A;  3USQ A;  4FRE A;  1V82 A;  1R7V A;  1K4V A;  1FZW A;  4B2X A;  1VZU A;  3T7O A;  2JCK A;  5CQO A;  2Q4J A;  2YC5 A;  3DK5 A;  3V0P A;  5EIY A;  5FU0 A;  3PKP A;  3R2W A;  4D0Z A;  2CU2 A;  4HO4 A;  1TZF A;  2V0L A;  4JD0 A;  3I0K A;  4KC2 A;  1H7H A;  1NQI B;  5FUH A;  2W0V A;  3I0D A;  2X5Z A;  2RJ4 A;  3TQD A;  3POL A;  4YS8 A;  1MP3 A;  2W0W A;  2WVL A;  4K6R A;  3V0N A;  3U0X A;  3JUJ A;  1NF5 B;  1O0R A;  4ARW A;  2WGZ A;  5C38 A;  1GWW A;  3OC9 A;  1ON8 A;  1QWJ A;  2E8B A;  3FOQ A;  1H5T A;  1G95 A;  2VXL A;  2AH9 A;  2O1H A;  3OH3 A;  4EEA A;  1HM0 A;  5C36 A;  4KC1 A;  2E3D A;  1WVC A;  4HO3 A;  2Y4L A;  2BO6 A;  3K8D A;  1GX0 A;  4B4B A;  4KXO A;  4G3P A;  5CQM X;  2V0J A;  1VZX A;  2ZU7 A;  1ZJ0 A;  1QG8 A;  4FRO A;  1G3L A;  1R7X A;  1V83 A;  5C4D A;  4ASY A;  3IOI A;  1YRO B;  3IOH A;  1H7E A;  5CMJ A;  1H7Q A;  2FYA A;  4KT7 A;  4D11 C;  1ZI4 A;  2XME A;  3CU0 A;  1ZCY A;  5C4F A;  3KIA A;  2GGO A;  4FRH A;  3U2V A;  3V0O A;  1GQC A;  5CMI A;  3I0G A;  5CQP A;  4FRQ A;  1ZJ3 A;  4HO8 A;  1H4E A;  1QGQ A;  1HM8 A;  3K8E A;  2VK9 A;  3OAM A;  2OEG A;  1G23 A;  5C8R A;  1LZ7 A;  3SXD A;  3U2U A;  1H5R B;  4EEO A;  1ZI1 A;  2AES A;  2D7R A;  1MP5 A;  3OH2 A;  2XWN A;  4M2B A;  5FTV A;  3SX7 A;  5L6S A;  1ZDF A;  4ASJ A;  1HV9 A;  2AEC A;  1H5S A;  1NMM B;  1FGX A;  3CGX A;  4IRP A;  4CJC A;  3LW6 A;  4KQL A;  3BRK X;  3OGZ A;  3DJ4 A;  4BQH A;  5C1H A;  1FO9 A;  2WVM A;  3V0Q A;  2FYD B;  5D92 A;  4B5B A;  1ON6 A;  3ZLK A;  5C48 A;  1E5K A;  3SXB A;  5C4E A;  2RJ9 A;  3OH4 A;  1VZT A;  1V84 A;  3CKJ A;  4UEG A;  1FG5 N;  4B42 A;  2WE9 A;  1O23 B;  4M2A A;  4MYB A;  1W77 A;  4MND A;  4NAL A;  4FCU A;  3ST8 A;  3I0H A;  2AM5 A;  4B3U A;  2OI6 A;  4B2W A;  1WSZ A;  1LZI A;  5C3A A;  4HO5 A;  4KPX A;  3OH0 A;  3U2X A;  4HG6 A;  3E26 A;  2J0A A;  4D48 A;  1WT3 A;  2ICX A;  2YQJ A;  4M4K A;  2BO8 A;  2UX8 A;  1H4D A;  1VH1 A;  4DEC A;  4KNR A;  5I1F A;  1JVG A;  3GUE A;  3F1Y A;  5BXC A;  2XWM A;  3Q80 A;  3DUV A;  2D7I A;  2YQS A;  3ZF8 A;  1ZJ2 A;  4P02 A;  4B4M A;  2VXM A;  1WT0 A;  1H7F A;  1VH3 A;  5CMG X;  4FRA A;  1IIN A;  5DDV A;  5FV9 A;  5C4C A;  2Y7A A;  1EYR A;  5J49 A;  1NWG B;  1VGT A;  4O6N A;  4LW6 A;  1ZCU A;  2Y4J A;  3D98 A;  3SX8 A;  1ZHJ A;  1JYK A;  4FCE A;  1VGZ A;  2C0N A;  5EJ1 A;  4Y7F A;  4EE3 A;  2VS3 A;  1WT1 A;  2Y6P A;  4FRL A;  1ZI3 A;  1PZY B;  2VS4 A;  4NAK A;  1JYL A;  5C4B A;  3PNN A;  3U2T A;  3JUK A;  1S4O A;  1O7Q A;  1LL0 A;  2P6W A;  4Y7U A;  4AC3 A;  2VSI A;  3ZGF A;  1JV1 A;  5EJZ A;  5CQN X;  2RJ5 A;  2I7B A;  1YP2 A;  1FOA A;  1TW1 A;  1ZCT A;  3I0C A;  3V8Y A;  5CMF X;  1KWS A;  4D0T A;  5C1G A;  5JQQ A;  4HO2 A;  5AJP A;  4EE5 A;  2O1F A;  1LZ0 A;  1GX4 A;  1G1L A;  2XMH A;  3RMV A;  1H4C A;  4FQW A;  5IDT A;  1S4P A;  1OQM B;  1H7G A;  2VS5 A;  4CJ8 A;  2MZB A;  4CVH A;  1HJJ A;  1ZIZ A;  3RMW A;  3U2W A;  2BO4 A;  5CMH A;  1HJL A;  4Y7G A;  3SXA A;  2Z86 A;  2FFV A;  2JCL A;  3I0E A;  2GGQ A;  2V0I A;  2VSH A;  3QVB A;  4NAN A;  3V90 A;  4AAW A;  5CQL X;  1IIM A;  4Q7C A;  4EEM A;  1H5T B;  1VPA A;  2X60 A;  5FU8 A;  1JVD A;  3I0J A;  1ZJ1 A;  4KRV A;  4FRM A;  2V0H A;  5C47 A;  4HO9 A;  2FYC B;  2X5S A;  4P00 A;  1ZJP A;  5DDT A;  1LL2 A;  2YCM A;  4DDZ A;  2VFZ A;  5HS2 A;  4E1K A;  1G0R A;  3F1C A;  1W55 A;  1VGW A;  2P72 A;  2QGI A;  1JV3 A;  2RIX A; 
#chains in the Genus database with same CATH homology
 4XWI A;  2Y4K A;  1GQ9 A;  4GBP A;  3CKQ A;  4BMA A;  1VIC A;  2AGD A;  2JCO A;  1OMZ A;  2WAW A;  4G3S A;  1YP4 A;  3HL3 A;  3SX5 A;  2I5E A;  1G8O A;  4MIX A;  5AJO A;  5FTS A;  3SXC A;  1INJ A;  1FR9 A;  1R82 A;  2AM4 A;  4AYJ A;  4ECM A;  4B4G A;  4EE4 A;  4Y64 A;  2P73 A;  1R7T A;  4Y62 A;  2RJ6 A;  4Y9X A;  2APC A;  1NKH B;  1VM8 A;  2JCJ A;  3T7M A;  3V0L A;  5D91 A;  3D8V A;  1ZI5 A;  2OEF A;  1EZI A;  5C1L A;  1H7T A;  4KPZ A;  4J18 A;  4R7P A;  3CKO A;  1FXJ A;  2X65 A;  1XHB A;  2RJ1 A;  4FIY A;  4Y63 A;  4O6M A;  3T7N A;  3ZLL A;  1FXO A;  1H5S B;  1R81 A;  1G2V A;  1LVW A;  1ZDG A;  4ZDQ A;  4Y6U A;  4FIX A;  1YP3 A;  1PZT A;  2QH5 A;  2Y4M A;  2ZU8 A;  5AJN A;  1FRW A;  1MC3 A;  4FRB A;  5IFY A;  1TVY A;  3CKN A;  2PGV A;  2Z87 A;  3R3I A;  2BO7 A;  2YC3 A;  3I0I X;  4G87 A;  3EE5 A;  1H5R A;  4Y7T A;  2D0J A;  1FGG A;  4CJB A;  1LZJ A;  1I52 A;  2WVK A;  2QKX A;  2XWL A;  1SS9 A;  2RIY A;  3SXE A;  2WEE A;  4FRP A;  1G93 A;  2YQH A;  5C49 A;  1S4N A;  4FRD A;  1G9R A;  1XZ6 A;  3USR A;  4Y6N A;  4L41 C;  2RJ7 A;  4DE7 A;  3V8Z A;  3E25 A;  3V91 A;  1GA8 A;  3CKV A;  2ICY A;  2J0B A;  2PA4 A;  1H5S C;  3OH1 A;  5C3B A;  4IRQ A;  2A8W A;  2AM3 A;  4M28 A;  4LW3 A;  3SPT A;  3I0L A;  1TW5 A;  1QGS A;  3RSB A;  1FR8 A;  3NGW A;  3Q4S A;  1VGU A;  4KC4 A;  1LL3 A;  1R7U A;  2ZU9 A;  4KNX A;  2FYB A;  1ZJO A;  2FFU A;  3BCV A;  1H3M A;  3U0Y A;  2YQC A;  4D11 A;  2OI7 A;  4HOC A;  1H5S D;  3V0M A;  1FWY A;  4NAI A;  3ZGG A;  5IDS A;  4HO6 A;  5FYE A;  3OKR A;  3SXG A;  2RJ8 A;  3TZT A;  1FO8 A;  2PGY A;  5L6V A;  1O7O A;  2RIZ A;  2V0K A;  3D5N A;  2O1G A;  2FY7 A;  2OI5 A;  4HCQ A;  1R7Y A;  1R80 A;  2DPW A;  1MP4 A;  2RJ0 A;  2I5K A;  3SX3 A;  1INI A;  4Y7V A;  2PX7 A;  1WT2 A;  2YES A;  3Q7U A;  1G97 A;  3O3P A;  2A8U A;  4AYL A;  1W57 A;  4C2S A;  1HM9 A;  3FWW A;  3I0F A;  3IOJ A;  4EVW A;  4HO0 A;  3JTJ A;  5C3D A;  4EEG A;  2AE7 A;  2VD4 A;  1OMX A;  3N9W A;  2NXV A;  4G3Q A;  1GWV A;  2RIT A;  1Z90 A;  3PKQ A;  1ZCV A;  1H7L A;  1NHE B;  4JIS A;  3USQ A;  4FRE A;  1V82 A;  1R7V A;  1K4V A;  1FZW A;  4B2X A;  1VZU A;  3T7O A;  2JCK A;  5CQO A;  2Q4J A;  2YC5 A;  3DK5 A;  3V0P A;  5EIY A;  5FU0 A;  3PKP A;  3R2W A;  4D0Z A;  2CU2 A;  4HO4 A;  1TZF A;  2V0L A;  4JD0 A;  3I0K A;  4KC2 A;  1H7H A;  1NQI B;  5FUH A;  2W0V A;  3I0D A;  2X5Z A;  2RJ4 A;  3TQD A;  3POL A;  4YS8 A;  1MP3 A;  2W0W A;  2WVL A;  4K6R A;  3V0N A;  3U0X A;  3JUJ A;  1NF5 B;  1O0R A;  4ARW A;  2WGZ A;  5C38 A;  1GWW A;  3OC9 A;  1ON8 A;  1QWJ A;  2E8B A;  3FOQ A;  1H5T A;  1G95 A;  2VXL A;  2AH9 A;  2O1H A;  3OH3 A;  4EEA A;  1HM0 A;  5C36 A;  4KC1 A;  2E3D A;  1WVC A;  4HO3 A;  2Y4L A;  2BO6 A;  3K8D A;  1GX0 A;  4B4B A;  4KXO A;  4G3P A;  5CQM X;  2V0J A;  1VZX A;  2ZU7 A;  1ZJ0 A;  1QG8 A;  4FRO A;  1G3L A;  1R7X A;  1V83 A;  5C4D A;  4ASY A;  3IOI A;  1YRO B;  3IOH A;  1H7E A;  5CMJ A;  1H7Q A;  2FYA A;  4KT7 A;  4D11 C;  1ZI4 A;  2XME A;  3CU0 A;  1ZCY A;  5C4F A;  3KIA A;  2GGO A;  4FRH A;  3U2V A;  3V0O A;  1GQC A;  5CMI A;  3I0G A;  5CQP A;  4FRQ A;  1ZJ3 A;  4HO8 A;  1H4E A;  1QGQ A;  1HM8 A;  3K8E A;  2VK9 A;  3OAM A;  2OEG A;  1G23 A;  5C8R A;  1LZ7 A;  3SXD A;  3U2U A;  1H5R B;  4EEO A;  1ZI1 A;  2AES A;  2D7R A;  1MP5 A;  3OH2 A;  2XWN A;  4M2B A;  5FTV A;  3SX7 A;  5L6S A;  1ZDF A;  4ASJ A;  1HV9 A;  2AEC A;  1H5S A;  1NMM B;  1FGX A;  3CGX A;  4IRP A;  4CJC A;  3LW6 A;  4KQL A;  3BRK X;  3OGZ A;  3DJ4 A;  4BQH A;  5C1H A;  1FO9 A;  2WVM A;  3V0Q A;  2FYD B;  5D92 A;  4B5B A;  1ON6 A;  3ZLK A;  5C48 A;  1E5K A;  3SXB A;  5C4E A;  2RJ9 A;  3OH4 A;  1VZT A;  1V84 A;  3CKJ A;  4UEG A;  1FG5 N;  4B42 A;  2WE9 A;  1O23 B;  4M2A A;  4MYB A;  1W77 A;  4MND A;  4NAL A;  4FCU A;  3ST8 A;  3I0H A;  2AM5 A;  4B3U A;  2OI6 A;  4B2W A;  1WSZ A;  1LZI A;  5C3A A;  4HO5 A;  4KPX A;  3OH0 A;  3U2X A;  4HG6 A;  3E26 A;  2J0A A;  4D48 A;  1WT3 A;  2ICX A;  2YQJ A;  4M4K A;  2BO8 A;  2UX8 A;  1H4D A;  1VH1 A;  4DEC A;  4KNR A;  5I1F A;  1JVG A;  3GUE A;  3F1Y A;  5BXC A;  2XWM A;  3Q80 A;  3DUV A;  2D7I A;  2YQS A;  3ZF8 A;  1ZJ2 A;  4P02 A;  4B4M A;  2VXM A;  1WT0 A;  1H7F A;  1VH3 A;  5CMG X;  4FRA A;  1IIN A;  5DDV A;  5FV9 A;  5C4C A;  2Y7A A;  1EYR A;  5J49 A;  1NWG B;  1VGT A;  4O6N A;  4LW6 A;  1ZCU A;  2Y4J A;  3D98 A;  3SX8 A;  1ZHJ A;  1JYK A;  4FCE A;  1VGZ A;  2C0N A;  5EJ1 A;  4Y7F A;  4EE3 A;  2VS3 A;  1WT1 A;  2Y6P A;  4FRL A;  1ZI3 A;  1PZY B;  2VS4 A;  4NAK A;  1JYL A;  5C4B A;  3PNN A;  3U2T A;  3JUK A;  1S4O A;  1O7Q A;  1LL0 A;  2P6W A;  4Y7U A;  4AC3 A;  2VSI A;  3ZGF A;  1JV1 A;  5EJZ A;  5CQN X;  2RJ5 A;  2I7B A;  1YP2 A;  1FOA A;  1TW1 A;  1ZCT A;  3I0C A;  3V8Y A;  5CMF X;  1KWS A;  4D0T A;  5C1G A;  5JQQ A;  4HO2 A;  5AJP A;  4EE5 A;  2O1F A;  1LZ0 A;  1GX4 A;  1G1L A;  2XMH A;  3RMV A;  1H4C A;  4FQW A;  5IDT A;  1S4P A;  1OQM B;  1H7G A;  2VS5 A;  4CJ8 A;  2MZB A;  4CVH A;  1HJJ A;  1ZIZ A;  3RMW A;  3U2W A;  2BO4 A;  5CMH A;  1HJL A;  4Y7G A;  3SXA A;  2Z86 A;  2FFV A;  2JCL A;  3I0E A;  2GGQ A;  2V0I A;  2VSH A;  3QVB A;  4NAN A;  3V90 A;  4AAW A;  5CQL X;  1IIM A;  4Q7C A;  4EEM A;  1H5T B;  1VPA A;  2X60 A;  5FU8 A;  1JVD A;  3I0J A;  1ZJ1 A;  4KRV A;  4FRM A;  2V0H A;  5C47 A;  4HO9 A;  2FYC B;  2X5S A;  4P00 A;  1ZJP A;  5DDT A;  1LL2 A;  2YCM A;  4DDZ A;  2VFZ A;  5HS2 A;  4E1K A;  1G0R A;  3F1C A;  1W55 A;  1VGW A;  2P72 A;  2QGI A;  1JV3 A;  2RIX A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...