5FU8A

Pseudomonas aeruginosa rmla in complex with allosteric inhibitor
Total Genus 99
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
99
sequence length
301
structure length
297
Chain Sequence
HHHHMKRKGIILAGGSGTRLHPATLAISKQLLPVYDKPMIYYPLSTLMLAGIREILIISTPQDTPRFQQLLGDGSNWGLDLQYAVQPSPDGLAQAFLIGESFIGNDLSALVLGDNLYYGHDFHELLGSASQRQTGASVFAYHVLDPERYGVVEFDQGGKAISLEEKPLEPKSNYAVTGLYFYDQQVVDIARDLKPSPRGELEITDVNRAYLERGQLSVEIMGRGYAWLDTGTHDSLLEAGQFIATLENRQGLKVACPEEIAYRQKWIDAAQLEKLAAPLAKNGYGQYLKRLLTETVY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords GLUCOSE-1-PHOSPHATE THYMIDYLYLTRANSFERASE
publication title Allosteric Competitive Inhibitors of the Glucose-1-Phosphate Thymidylyltransferase (Rmla) from Pseudomonas Aeruginosa.
rcsb
source organism Pseudomonas aeruginosa
total genus 99
structure length 297
sequence length 301
chains with identical sequence B, C, D
ec nomenclature ec 2.7.7.24: Glucose-1-phosphate thymidylyltransferase.
pdb deposition date 2016-01-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00483 NTP_transferase Nucleotidyl transferase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.550.10 Alpha Beta Alpha-Beta Complex Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A 5fu8A00
2D7IA 5CMGX 4KC2A 2OI6A 1G93A 1ZJOA 3CKOA 2AM5A 1O23B 2YCMA 4EE5A 4M28A 3OC9A 4M4KA 2O1GA 3T7MA 1FG5N 1W55A 3U2TA 3F1CA 3R2WA 4FRQA 4HCQA 4B5BA 3JUJA 4B42A 2FFVA 1H5TB 2BO6A 1R82A 1YP3A 2I5EA 3CU0A 3USRA 4NAIA 4AYLA 2YESA 1ZDFA 1SS9A 3TQDA 1VPAA 1R81A 1WT0A 4JD0A 2VXLA 4HO4A 1WT3A 2ICYA 4Y7UA 5FYEA 3V0MA 3IOJA 3RSBA 2OI5A 2AGDA 3IOHA 4KC4A 2UX8A 3DJ4A 3V0PA 1VICA 1H5SC 5L6SA 1PZTA 4M2BA 1ZCYA 1G97A 4XWIA 4FCEA 5C48A 1R7XA 1MP3A 1FZWA 2VD4A 4K6RA 1FR8A 1WSZA 3LW6A 4G3QA 1PZYB 4IRQA 1E5KA 4KPZA 2FYBA 4HO3A 4FRLA 2Y4MA 3O3PA 2YQCA 1LL0A 1ZIZA 5HS2A 3Q4SA 2OEGA 1QGQA 3SXAA 1YP4A 5C4BA 1O7QA 3DK5A 5IDSA 1XZ6A 3N9WA 4B4BA 2P6WA 5EIYA 2RJ6A 2WVKA 1WT2A 1LL2A 5DDTA 4HO8A 4Y7FA 1H5RA 1FXOA 2PX7A 3CKQA 1MP4A 3V90A 4Y9XA 4KXOA 3I0DA 3EE5A 2V0KA 1NMMB 1YROB 2VS5A 3TZTA 1MP5A 2V0JA 1ZJ0A 1JYKA 1FO9A 5FU0A 1JV3A 4Y63A 4FCUA 3SX8A 1HM0A 1QWJA 3I0HA 3CGXA 2WE9A 1NWGB 3I0CA 2E8BA 3SPTA 1KWSA 1ZCVA 1S4NA 1LL3A 3Q7UA 1G2VA 2RJ0A 4D0ZA 4MNDA 1GA8A 2WEEA 4HO9A 4B2XA 4NALA 4G3PA 2X5SA 5FU8A 3T7NA 4NAKA 2WVLA 5CMIA 2YQJA 1ZI4A 2YC3A 3SXEA 3I0LA 1H7GA 3K8EA 3V8YA 3V91A 2VSIA 3POLA 5C3BA 1VH1A 1H3MA 4IRPA 4JISA 3SXBA 1H7FA 5C4FA 2BO8A 4UEGA 1HJLA 3ZF8A 3F1YA 1NQIB 1JV1A 1V84A 2P73A 1JVGA 3PKPA 3QVBA 2BO7A 5C8RA 1OMZA 1ZDGA 4FROA 3OGZA 3I0EA 3DUVA 4L41C 4CJ8A 3RMVA 1G95A 3I0IX 1VGTA 5FTSA 5EJZA 2VSHA 4EEMA 4KT7A 3SXDA 4Y64A 3I0FA 2Y7AA 3I0GA 3JTJA 2YC5A 2QH5A 2I5KA 1HV9A 4ECMA 2JCJA 2FYAA 3V0NA 2FFUA 2RJ9A 3CKNA 3GUEA 4DDZA 1FWYA 2Y4KA 2FY7A 1O0RA 1HM8A 4KC1A 4EE3A 4ASJA 1G23A 4G3SA 3USQA 1TW1A 1ZI3A 1G0RA 1ZJPA 2WVMA 5CMJA 1VGUA 5CMFX 1LVWA 2A8WA 2VFZA 2Y6PA 1R80A 1INIA 1INJA 2O1FA 2VS3A 3ZLKA 5IDTA 4B4GA 1GWWA 4D11C 2DPWA 4HG6A 1EYRA 3NGWA 3BCVA 1S4PA 4LW6A 2VXMA 1ON6A 1R7UA 2Z86A 5C3AA 4GBPA 2JCKA 3Q80A 2AM4A 4ZDQA 5IFYA 3V8ZA 2Q4JA 5C3DA 3V0LA 4FQWA 2RJ1A 4AAWA 3OKRA 4FRHA 2D0JA 4Y6NA 3OH3A 4DE7A 2JCLA 4HO2A 1GX0A 2APCA 1NKHB 1NF5B 4CJBA 1I52A 3U2XA 2X65A 1GQCA 1H7LA 4EVWA 1OQMB 1VZTA 3U2VA 4FRBA 3D98A 4B3UA 3JUKA 3PNNA 5J49A 1H5SA 3T7OA 1V82A 1H5RB 2AECA 2ZU7A 1R7TA 4G87A 2OEFA 2E3DA 4E1KA 2A8UA 3OH4A 1LZJA 1G8OA 1VZXA 2FYCB 3I0JA 1FR9A 3SX5A 5JQQA 1ZHJA 2V0LA 1IIMA 4C2SA 1QGSA 1H5SD 2MZBA 3OH1A 4ARWA 4BMAA 3V0QA 1JVDA 1ZI1A 3OAMA 2RIYA 1S4OA 4FRAA 1R7YA 1VM8A 5C49A 5CMHA 3BRKX 5C1GA 1FOAA 4FRPA 1OMXA 1IINA 2QGIA 2I7BA 2PGYA 1QG8A 2X60A 1H5TA 1VH3A 4AC3A 1GQ9A 2XWMA 5C4EA 2RJ7A 2Z87A 3SX7A 4FRMA 4EEOA 2D7RA 3SX3A 1ZCUA 3R3IA 2AE7A 3FOQA 3RMWA 4P00A 2ZU9A 4Y7TA 4YS8A 1R7VA 5AJNA 1NHEB 2W0WA 4EEAA 4Y6UA 4D48A 1HM9A 5CQOA 4HO0A 2ICXA 2RJ5A 1ZCTA 1H7EA 2Y4LA 1G3LA 1YP2A 3IOIA 1MC3A 3K8DA 2GGOA 4B2WA 1TW5A 2XWNA 2PA4A 2WGZA 2AM3A 3E26A 2AH9A 1HJJA 1O7OA 1LZIA 2O1HA 3D5NA 3OH2A 1H7QA 2Y4JA 3HL3A 2WAWA 2XMHA 3KIAA 4HO6A 4KRVA 1H7TA 3E25A 5BXCA 1G1LA 1ZI5A 2RIXA 5I1FA 1XHBA 3SXCA 1G9RA 4J18A 1Z90A 2P72A 2RITA 2XMEA 1H4EA 5AJPA 3ZGFA 3ST8A 4M2AA 4FREA 4CJCA 5CQLX 2XWLA 4P02A 1W57A 1TZFA 1V83A 1WVCA 4CVHA 5C47A 5FV9A 1ZJ2A 2PGVA 4KNXA 1FGGA 4D0TA 2GGQA 5AJOA 2NXVA 2RIZA 4Y7GA 1ZJ3A 5C36A 5CQMX 4KPXA 2V0HA 4KNRA 3OH0A 4KQLA 1GWVA 2YQSA 5FUHA 5C1LA 4EE4A 1VGZA 4MYBA 3U0XA 2FYDB 1ZJ1A 5DDVA 5C1HA 3V0OA 2AESA 1JYLA 5C38A 2OI7A 1TVYA 1FO8A 1FGXA 3U0YA 2JCOA 4FRDA 4LW3A 1H4DA 2W0VA 4NANA 1EZIA 2RJ4A 4EEGA 1H4CA 4BQHA 2QKXA 4Y62A 2RJ8A 3I0KA 1VGWA 4D11A 1FRWA 2VS4A 2X5ZA 4HOCA 1H5SB 5CQPA 2CU2A 5EJ1A 1LZ0A 4ASYA 4DECA 1GX4A 2BO4A 5FTVA 3U2WA 1VZUA 3U2UA 3ZLLA 3ZGGA 1W77A 5L6VA 4AYJA 3FWWA 1FXJA 1H7HA 3SXGA 4Y7VA 1K4VA 1ON8A 4HO5A 5CQNX 2V0IA 3D8VA 5C4CA 4R7PA 4B4MA 2YQHA 1WT1A 3CKJA 3CKVA 3PKQA 2ZU8A 5C4DA 1LZ7A
chains in the Genus database with same CATH superfamily
2D7IA 5CMGX 4KC2A 2OI6A 1G93A 1ZJOA 3CKOA 2AM5A 1O23B 2YCMA 4EE5A 4M28A 3OC9A 4M4KA 2O1GA 3T7MA 1FG5N 1W55A 3U2TA 3F1CA 3R2WA 4FRQA 4HCQA 4B5BA 3JUJA 4B42A 2FFVA 1H5TB 2BO6A 1R82A 1YP3A 2I5EA 3CU0A 3USRA 4NAIA 4AYLA 2YESA 1ZDFA 1SS9A 3TQDA 1VPAA 1R81A 1WT0A 2J0AA 4JD0A 2VXLA 4HO4A 1WT3A 2ICYA 4Y7UA 5FYEA 3V0MA 3IOJA 3RSBA 2OI5A 2AGDA 3IOHA 4KC4A 2UX8A 3DJ4A 3V0PA 1VICA 1H5SC 5L6SA 1PZTA 4M2BA 1ZCYA 1G97A 4XWIA 4FCEA 5C48A 1R7XA 1MP3A 1FZWA 2VD4A 4K6RA 1FR8A 1WSZA 3LW6A 4G3QA 1PZYB 4IRQA 1E5KA 4KPZA 2FYBA 4HO3A 4FRLA 2Y4MA 3O3PA 2YQCA 1LL0A 1ZIZA 5HS2A 3Q4SA 2OEGA 1QGQA 3SXAA 1YP4A 5C4BA 1O7QA 3DK5A 5IDSA 1XZ6A 3N9WA 4B4BA 2P6WA 5EIYA 2RJ6A 2WVKA 1WT2A 1LL2A 5DDTA 4HO8A 4Y7FA 1H5RA 1FXOA 2PX7A 3CKQA 1MP4A 3V90A 4Y9XA 4KXOA 3I0DA 3EE5A 2V0KA 1NMMB 1YROB 2VS5A 3TZTA 1MP5A 2V0JA 1ZJ0A 1JYKA 1FO9A 4FIXA 5FU0A 1JV3A 4Y63A 4FCUA 3SX8A 1HM0A 4O6NA 1QWJA 3I0HA 3CGXA 2WE9A 1NWGB 3I0CA 2E8BA 3SPTA 1KWSA 1ZCVA 1S4NA 1LL3A 3Q7UA 1G2VA 2RJ0A 4D0ZA 4MNDA 1GA8A 2WEEA 4HO9A 4B2XA 4NALA 4G3PA 2X5SA 5FU8A 3T7NA 4NAKA 2WVLA 5CMIA 2YQJA 1ZI4A 2YC3A 2C0NA 3SXEA 3I0LA 1H7GA 3K8EA 3V8YA 3V91A 2VSIA 3POLA 5C3BA 1VH1A 1H3MA 4IRPA 4JISA 3SXBA 1H7FA 5C4FA 2BO8A 4UEGA 1HJLA 3ZF8A 3F1YA 1NQIB 1JV1A 1V84A 2P73A 1JVGA 3PKPA 3QVBA 2BO7A 5C8RA 1OMZA 1ZDGA 4FROA 3OGZA 3I0EA 3DUVA 4L41C 4CJ8A 3RMVA 1G95A 3I0IX 1VGTA 5FTSA 5EJZA 2VSHA 4EEMA 4KT7A 3SXDA 4Y64A 3I0FA 2Y7AA 3I0GA 3JTJA 2YC5A 2QH5A 2I5KA 1HV9A 4ECMA 2JCJA 2FYAA 3V0NA 2FFUA 2RJ9A 3CKNA 3GUEA 4DDZA 1FWYA 2Y4KA 2FY7A 1O0RA 1HM8A 4KC1A 4EE3A 4ASJA 1G23A 4G3SA 3USQA 1TW1A 1ZI3A 1G0RA 1ZJPA 2WVMA 5CMJA 1VGUA 5CMFX 1LVWA 2A8WA 2VFZA 2Y6PA 1R80A 1INIA 1INJA 2O1FA 2VS3A 3ZLKA 5IDTA 4B4GA 1GWWA 4D11C 2DPWA 4HG6A 1EYRA 3NGWA 3BCVA 1S4PA 4LW6A 2VXMA 1ON6A 1R7UA 2Z86A 5C3AA 4GBPA 2JCKA 3Q80A 2AM4A 4ZDQA 5IFYA 3V8ZA 2Q4JA 5C3DA 3V0LA 4FQWA 2RJ1A 4AAWA 3OKRA 4FRHA 2D0JA 4Y6NA 3OH3A 4DE7A 2JCLA 4HO2A 1GX0A 2APCA 1NKHB 1NF5B 4CJBA 1I52A 3U2XA 2X65A 1GQCA 1H7LA 4EVWA 1OQMB 1VZTA 3U2VA 4FRBA 3D98A 4B3UA 3JUKA 3PNNA 5J49A 1H5SA 4FIYA 3T7OA 1V82A 1H5RB 2AECA 2ZU7A 1R7TA 4G87A 2OEFA 2E3DA 4E1KA 2A8UA 3OH4A 1LZJA 1G8OA 1VZXA 2FYCB 3I0JA 1FR9A 5D92A 3SX5A 5JQQA 1ZHJA 2V0LA 1IIMA 4C2SA 1QGSA 1H5SD 2MZBA 5D91A 3OH1A 4ARWA 2VK9A 4BMAA 3V0QA 1JVDA 1ZI1A 3OAMA 2RIYA 1S4OA 4FRAA 1R7YA 1VM8A 5C49A 5CMHA 3BRKX 5C1GA 1FOAA 4FRPA 1OMXA 1IINA 2QGIA 2I7BA 2PGYA 1QG8A 2X60A 1H5TA 1VH3A 4AC3A 1GQ9A 2XWMA 5C4EA 2RJ7A 2Z87A 3SX7A 4FRMA 4EEOA 2D7RA 3SX3A 1ZCUA 3R3IA 2AE7A 3FOQA 3RMWA 4P00A 2ZU9A 4Y7TA 4YS8A 1R7VA 5AJNA 1NHEB 2W0WA 4EEAA 4Y6UA 4D48A 1HM9A 5CQOA 4HO0A 2ICXA 4O6MA 2RJ5A 1ZCTA 1H7EA 2Y4LA 1G3LA 1YP2A 4MIXA 3IOIA 1MC3A 3K8DA 2GGOA 4B2WA 1TW5A 2XWNA 2PA4A 2WGZA 2AM3A 3E26A 2AH9A 1HJJA 1O7OA 1LZIA 2O1HA 3D5NA 3OH2A 1H7QA 4Q7CA 2Y4JA 3HL3A 2WAWA 2XMHA 3KIAA 4HO6A 4KRVA 1H7TA 3E25A 5BXCA 1G1LA 1ZI5A 2RIXA 5I1FA 1XHBA 3SXCA 1G9RA 4J18A 1Z90A 2P72A 2RITA 2XMEA 1H4EA 5AJPA 3ZGFA 3ST8A 4M2AA 4FREA 4CJCA 5CQLX 2XWLA 4P02A 1W57A 1TZFA 1V83A 1WVCA 4CVHA 5C47A 5FV9A 1ZJ2A 2PGVA 4KNXA 1FGGA 4D0TA 2GGQA 5AJOA 2NXVA 2RIZA 4Y7GA 1ZJ3A 5C36A 5CQMX 4KPXA 2V0HA 4KNRA 3OH0A 4KQLA 1GWVA 2YQSA 5FUHA 5C1LA 4EE4A 1VGZA 4MYBA 3U0XA 2FYDB 1ZJ1A 5DDVA 5C1HA 3V0OA 2AESA 1JYLA 5C38A 2OI7A 1TVYA 1FO8A 1FGXA 3U0YA 2JCOA 4FRDA 4LW3A 1H4DA 2W0VA 4NANA 1EZIA 2RJ4A 4EEGA 1H4CA 4BQHA 2QKXA 4Y62A 2RJ8A 3I0KA 1VGWA 4D11A 1FRWA 2VS4A 2X5ZA 4HOCA 1H5SB 5CQPA 2CU2A 5EJ1A 1LZ0A 4ASYA 4DECA 1GX4A 2BO4A 5FTVA 3U2WA 1VZUA 3U2UA 3ZLLA 3ZGGA 1W77A 5L6VA 2J0BA 4AYJA 3FWWA 1FXJA 1H7HA 3SXGA 4Y7VA 1K4VA 1ON8A 4HO5A 5CQNX 2V0IA 3D8VA 5C4CA 4R7PA 4B4MA 2YQHA 1WT1A 3CKJA 3CKVA 3PKQA 2ZU8A 5C4DA 1LZ7A
chains in the Genus database with same CATH topology
2D7IA 5CMGX 4KC2A 2OI6A 1G93A 1ZJOA 3CKOA 2AM5A 1O23B 2YCMA 4EE5A 4M28A 3OC9A 4M4KA 2O1GA 3T7MA 1FG5N 1W55A 3U2TA 3F1CA 3R2WA 4FRQA 4HCQA 4B5BA 3JUJA 4B42A 2FFVA 1H5TB 2BO6A 1R82A 1YP3A 2I5EA 3CU0A 3USRA 4NAIA 4AYLA 2YESA 1ZDFA 1SS9A 3TQDA 1VPAA 1R81A 1WT0A 2J0AA 4JD0A 2VXLA 4HO4A 1WT3A 2ICYA 4Y7UA 5FYEA 3V0MA 3IOJA 3RSBA 2OI5A 2AGDA 3IOHA 4KC4A 2UX8A 3DJ4A 3V0PA 1VICA 1H5SC 5L6SA 1PZTA 4M2BA 1ZCYA 1G97A 4XWIA 4FCEA 5C48A 1R7XA 1MP3A 1FZWA 2VD4A 4K6RA 1FR8A 1WSZA 3LW6A 4G3QA 1PZYB 4IRQA 1E5KA 4KPZA 2FYBA 4HO3A 4FRLA 2Y4MA 3O3PA 2YQCA 1LL0A 1ZIZA 5HS2A 3Q4SA 2OEGA 1QGQA 3SXAA 1YP4A 5C4BA 1O7QA 3DK5A 5IDSA 1XZ6A 3N9WA 4B4BA 2P6WA 5EIYA 2RJ6A 2WVKA 1WT2A 1LL2A 5DDTA 4HO8A 4Y7FA 1H5RA 1FXOA 2PX7A 3CKQA 1MP4A 3V90A 4Y9XA 4KXOA 3I0DA 3EE5A 2V0KA 1NMMB 1YROB 2VS5A 3TZTA 1MP5A 2V0JA 1ZJ0A 1JYKA 1FO9A 4FIXA 5FU0A 1JV3A 4Y63A 4FCUA 3SX8A 1HM0A 4O6NA 1QWJA 3I0HA 3CGXA 2WE9A 1NWGB 3I0CA 2E8BA 3SPTA 1KWSA 1ZCVA 1S4NA 1LL3A 3Q7UA 1G2VA 2RJ0A 4D0ZA 4MNDA 1GA8A 2WEEA 4HO9A 4B2XA 4NALA 4G3PA 2X5SA 5FU8A 3T7NA 4NAKA 2WVLA 5CMIA 2YQJA 1ZI4A 2YC3A 2C0NA 3SXEA 3I0LA 1H7GA 3K8EA 3V8YA 3V91A 2VSIA 3POLA 5C3BA 1VH1A 1H3MA 4IRPA 4JISA 3SXBA 1H7FA 5C4FA 2BO8A 4UEGA 1HJLA 3ZF8A 3F1YA 1NQIB 1JV1A 1V84A 2P73A 1JVGA 3PKPA 3QVBA 2BO7A 5C8RA 1OMZA 1ZDGA 4FROA 3OGZA 3I0EA 3DUVA 4L41C 4CJ8A 3RMVA 1G95A 3I0IX 1VGTA 5FTSA 5EJZA 2VSHA 4EEMA 4KT7A 3SXDA 4Y64A 3I0FA 2Y7AA 3I0GA 3JTJA 2YC5A 2QH5A 2I5KA 1HV9A 4ECMA 2JCJA 2FYAA 3V0NA 2FFUA 2RJ9A 3CKNA 3GUEA 4DDZA 1FWYA 2Y4KA 2FY7A 1O0RA 1HM8A 4KC1A 4EE3A 4ASJA 1G23A 4G3SA 3USQA 1TW1A 1ZI3A 1G0RA 1ZJPA 2WVMA 5CMJA 1VGUA 5CMFX 1LVWA 2A8WA 2VFZA 2Y6PA 1R80A 1INIA 1INJA 2O1FA 2VS3A 3ZLKA 5IDTA 4B4GA 1GWWA 4D11C 2DPWA 4HG6A 1EYRA 3NGWA 3BCVA 1S4PA 4LW6A 2VXMA 1ON6A 1R7UA 2Z86A 5C3AA 4GBPA 2JCKA 3Q80A 2AM4A 4ZDQA 5IFYA 3V8ZA 2Q4JA 5C3DA 3V0LA 4FQWA 2RJ1A 4AAWA 3OKRA 4FRHA 2D0JA 4Y6NA 3OH3A 4DE7A 2JCLA 4HO2A 1GX0A 2APCA 1NKHB 1NF5B 4CJBA 1I52A 3U2XA 2X65A 1GQCA 1H7LA 4EVWA 1OQMB 1VZTA 3U2VA 4FRBA 3D98A 4B3UA 3JUKA 3PNNA 5J49A 1H5SA 4FIYA 3T7OA 1V82A 1H5RB 2AECA 2ZU7A 1R7TA 4G87A 2OEFA 2E3DA 4E1KA 2A8UA 3OH4A 1LZJA 1G8OA 1VZXA 2FYCB 3I0JA 1FR9A 5D92A 3SX5A 5JQQA 1ZHJA 2V0LA 1IIMA 4C2SA 1QGSA 1H5SD 2MZBA 5D91A 3OH1A 4ARWA 2VK9A 4BMAA 3V0QA 1JVDA 1ZI1A 3OAMA 2RIYA 1S4OA 4FRAA 1R7YA 1VM8A 5C49A 5CMHA 3BRKX 5C1GA 1FOAA 4FRPA 1OMXA 1IINA 2QGIA 2I7BA 2PGYA 1QG8A 2X60A 1H5TA 1VH3A 4AC3A 1GQ9A 2XWMA 5C4EA 2RJ7A 2Z87A 3SX7A 4FRMA 4EEOA 2D7RA 3SX3A 1ZCUA 3R3IA 2AE7A 3FOQA 3RMWA 4P00A 2ZU9A 4Y7TA 4YS8A 1R7VA 5AJNA 1NHEB 2W0WA 4EEAA 4Y6UA 4D48A 1HM9A 5CQOA 4HO0A 2ICXA 4O6MA 2RJ5A 1ZCTA 1H7EA 2Y4LA 1G3LA 1YP2A 4MIXA 3IOIA 1MC3A 3K8DA 2GGOA 4B2WA 1TW5A 2XWNA 2PA4A 2WGZA 2AM3A 3E26A 2AH9A 1HJJA 1O7OA 1LZIA 2O1HA 3D5NA 3OH2A 1H7QA 4Q7CA 2Y4JA 3HL3A 2WAWA 2XMHA 3KIAA 4HO6A 4KRVA 1H7TA 3E25A 5BXCA 1G1LA 1ZI5A 2RIXA 5I1FA 1XHBA 3SXCA 1G9RA 4J18A 1Z90A 2P72A 2RITA 2XMEA 1H4EA 5AJPA 3ZGFA 3ST8A 4M2AA 4FREA 4CJCA 5CQLX 2XWLA 4P02A 1W57A 1TZFA 1V83A 1WVCA 4CVHA 5C47A 5FV9A 1ZJ2A 2PGVA 4KNXA 1FGGA 4D0TA 2GGQA 5AJOA 2NXVA 2RIZA 4Y7GA 1ZJ3A 5C36A 5CQMX 4KPXA 2V0HA 4KNRA 3OH0A 4KQLA 1GWVA 2YQSA 5FUHA 5C1LA 4EE4A 1VGZA 4MYBA 3U0XA 2FYDB 1ZJ1A 5DDVA 5C1HA 3V0OA 2AESA 1JYLA 5C38A 2OI7A 1TVYA 1FO8A 1FGXA 3U0YA 2JCOA 4FRDA 4LW3A 1H4DA 2W0VA 4NANA 1EZIA 2RJ4A 4EEGA 1H4CA 4BQHA 2QKXA 4Y62A 2RJ8A 3I0KA 1VGWA 4D11A 1FRWA 2VS4A 2X5ZA 4HOCA 1H5SB 5CQPA 2CU2A 5EJ1A 1LZ0A 4ASYA 4DECA 1GX4A 2BO4A 5FTVA 3U2WA 1VZUA 3U2UA 3ZLLA 3ZGGA 1W77A 5L6VA 2J0BA 4AYJA 3FWWA 1FXJA 1H7HA 3SXGA 4Y7VA 1K4VA 1ON8A 4HO5A 5CQNX 2V0IA 3D8VA 5C4CA 4R7PA 4B4MA 2YQHA 1WT1A 3CKJA 3CKVA 3PKQA 2ZU8A 5C4DA 1LZ7A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2D7I A;  5CMG X;  4KC2 A;  2OI6 A;  1G93 A;  1ZJO A;  3CKO A;  2AM5 A;  1O23 B;  2YCM A;  4EE5 A;  4M28 A;  3OC9 A;  4M4K A;  2O1G A;  3T7M A;  1FG5 N;  1W55 A;  3U2T A;  3F1C A;  3R2W A;  4FRQ A;  4HCQ A;  4B5B A;  3JUJ A;  4B42 A;  2FFV A;  1H5T B;  2BO6 A;  1R82 A;  1YP3 A;  2I5E A;  3CU0 A;  3USR A;  4NAI A;  4AYL A;  2YES A;  1ZDF A;  1SS9 A;  3TQD A;  1VPA A;  1R81 A;  1WT0 A;  4JD0 A;  2VXL A;  4HO4 A;  1WT3 A;  2ICY A;  4Y7U A;  5FYE A;  3V0M A;  3IOJ A;  3RSB A;  2OI5 A;  2AGD A;  3IOH A;  4KC4 A;  2UX8 A;  3DJ4 A;  3V0P A;  1VIC A;  1H5S C;  5L6S A;  1PZT A;  4M2B A;  1ZCY A;  1G97 A;  4XWI A;  4FCE A;  5C48 A;  1R7X A;  1MP3 A;  1FZW A;  2VD4 A;  4K6R A;  1FR8 A;  1WSZ A;  3LW6 A;  4G3Q A;  1PZY B;  4IRQ A;  1E5K A;  4KPZ A;  2FYB A;  4HO3 A;  4FRL A;  2Y4M A;  3O3P A;  2YQC A;  1LL0 A;  1ZIZ A;  5HS2 A;  3Q4S A;  2OEG A;  1QGQ A;  3SXA A;  1YP4 A;  5C4B A;  1O7Q A;  3DK5 A;  5IDS A;  1XZ6 A;  3N9W A;  4B4B A;  2P6W A;  5EIY A;  2RJ6 A;  2WVK A;  1WT2 A;  1LL2 A;  5DDT A;  4HO8 A;  4Y7F A;  1H5R A;  1FXO A;  2PX7 A;  3CKQ A;  1MP4 A;  3V90 A;  4Y9X A;  4KXO A;  3I0D A;  3EE5 A;  2V0K A;  1NMM B;  1YRO B;  2VS5 A;  3TZT A;  1MP5 A;  2V0J A;  1ZJ0 A;  1JYK A;  1FO9 A;  5FU0 A;  1JV3 A;  4Y63 A;  4FCU A;  3SX8 A;  1HM0 A;  1QWJ A;  3I0H A;  3CGX A;  2WE9 A;  1NWG B;  3I0C A;  2E8B A;  3SPT A;  1KWS A;  1ZCV A;  1S4N A;  1LL3 A;  3Q7U A;  1G2V A;  2RJ0 A;  4D0Z A;  4MND A;  1GA8 A;  2WEE A;  4HO9 A;  4B2X A;  4NAL A;  4G3P A;  2X5S A;  5FU8 A;  3T7N A;  4NAK A;  2WVL A;  5CMI A;  2YQJ A;  1ZI4 A;  2YC3 A;  3SXE A;  3I0L A;  1H7G A;  3K8E A;  3V8Y A;  3V91 A;  2VSI A;  3POL A;  5C3B A;  1VH1 A;  1H3M A;  4IRP A;  4JIS A;  3SXB A;  1H7F A;  5C4F A;  2BO8 A;  4UEG A;  1HJL A;  3ZF8 A;  3F1Y A;  1NQI B;  1JV1 A;  1V84 A;  2P73 A;  1JVG A;  3PKP A;  3QVB A;  2BO7 A;  5C8R A;  1OMZ A;  1ZDG A;  4FRO A;  3OGZ A;  3I0E A;  3DUV A;  4L41 C;  4CJ8 A;  3RMV A;  1G95 A;  3I0I X;  1VGT A;  5FTS A;  5EJZ A;  2VSH A;  4EEM A;  4KT7 A;  3SXD A;  4Y64 A;  3I0F A;  2Y7A A;  3I0G A;  3JTJ A;  2YC5 A;  2QH5 A;  2I5K A;  1HV9 A;  4ECM A;  2JCJ A;  2FYA A;  3V0N A;  2FFU A;  2RJ9 A;  3CKN A;  3GUE A;  4DDZ A;  1FWY A;  2Y4K A;  2FY7 A;  1O0R A;  1HM8 A;  4KC1 A;  4EE3 A;  4ASJ A;  1G23 A;  4G3S A;  3USQ A;  1TW1 A;  1ZI3 A;  1G0R A;  1ZJP A;  2WVM A;  5CMJ A;  1VGU A;  5CMF X;  1LVW A;  2A8W A;  2VFZ A;  2Y6P A;  1R80 A;  1INI A;  1INJ A;  2O1F A;  2VS3 A;  3ZLK A;  5IDT A;  4B4G A;  1GWW A;  4D11 C;  2DPW A;  4HG6 A;  1EYR A;  3NGW A;  3BCV A;  1S4P A;  4LW6 A;  2VXM A;  1ON6 A;  1R7U A;  2Z86 A;  5C3A A;  4GBP A;  2JCK A;  3Q80 A;  2AM4 A;  4ZDQ A;  5IFY A;  3V8Z A;  2Q4J A;  5C3D A;  3V0L A;  4FQW A;  2RJ1 A;  4AAW A;  3OKR A;  4FRH A;  2D0J A;  4Y6N A;  3OH3 A;  4DE7 A;  2JCL A;  4HO2 A;  1GX0 A;  2APC A;  1NKH B;  1NF5 B;  4CJB A;  1I52 A;  3U2X A;  2X65 A;  1GQC A;  1H7L A;  4EVW A;  1OQM B;  1VZT A;  3U2V A;  4FRB A;  3D98 A;  4B3U A;  3JUK A;  3PNN A;  5J49 A;  1H5S A;  3T7O A;  1V82 A;  1H5R B;  2AEC A;  2ZU7 A;  1R7T A;  4G87 A;  2OEF A;  2E3D A;  4E1K A;  2A8U A;  3OH4 A;  1LZJ A;  1G8O A;  1VZX A;  2FYC B;  3I0J A;  1FR9 A;  3SX5 A;  5JQQ A;  1ZHJ A;  2V0L A;  1IIM A;  4C2S A;  1QGS A;  1H5S D;  2MZB A;  3OH1 A;  4ARW A;  4BMA A;  3V0Q A;  1JVD A;  1ZI1 A;  3OAM A;  2RIY A;  1S4O A;  4FRA A;  1R7Y A;  1VM8 A;  5C49 A;  5CMH A;  3BRK X;  5C1G A;  1FOA A;  4FRP A;  1OMX A;  1IIN A;  2QGI A;  2I7B A;  2PGY A;  1QG8 A;  2X60 A;  1H5T A;  1VH3 A;  4AC3 A;  1GQ9 A;  2XWM A;  5C4E A;  2RJ7 A;  2Z87 A;  3SX7 A;  4FRM A;  4EEO A;  2D7R A;  3SX3 A;  1ZCU A;  3R3I A;  2AE7 A;  3FOQ A;  3RMW A;  4P00 A;  2ZU9 A;  4Y7T A;  4YS8 A;  1R7V A;  5AJN A;  1NHE B;  2W0W A;  4EEA A;  4Y6U A;  4D48 A;  1HM9 A;  5CQO A;  4HO0 A;  2ICX A;  2RJ5 A;  1ZCT A;  1H7E A;  2Y4L A;  1G3L A;  1YP2 A;  3IOI A;  1MC3 A;  3K8D A;  2GGO A;  4B2W A;  1TW5 A;  2XWN A;  2PA4 A;  2WGZ A;  2AM3 A;  3E26 A;  2AH9 A;  1HJJ A;  1O7O A;  1LZI A;  2O1H A;  3D5N A;  3OH2 A;  1H7Q A;  2Y4J A;  3HL3 A;  2WAW A;  2XMH A;  3KIA A;  4HO6 A;  4KRV A;  1H7T A;  3E25 A;  5BXC A;  1G1L A;  1ZI5 A;  2RIX A;  5I1F A;  1XHB A;  3SXC A;  1G9R A;  4J18 A;  1Z90 A;  2P72 A;  2RIT A;  2XME A;  1H4E A;  5AJP A;  3ZGF A;  3ST8 A;  4M2A A;  4FRE A;  4CJC A;  5CQL X;  2XWL A;  4P02 A;  1W57 A;  1TZF A;  1V83 A;  1WVC A;  4CVH A;  5C47 A;  5FV9 A;  1ZJ2 A;  2PGV A;  4KNX A;  1FGG A;  4D0T A;  2GGQ A;  5AJO A;  2NXV A;  2RIZ A;  4Y7G A;  1ZJ3 A;  5C36 A;  5CQM X;  4KPX A;  2V0H A;  4KNR A;  3OH0 A;  4KQL A;  1GWV A;  2YQS A;  5FUH A;  5C1L A;  4EE4 A;  1VGZ A;  4MYB A;  3U0X A;  2FYD B;  1ZJ1 A;  5DDV A;  5C1H A;  3V0O A;  2AES A;  1JYL A;  5C38 A;  2OI7 A;  1TVY A;  1FO8 A;  1FGX A;  3U0Y A;  2JCO A;  4FRD A;  4LW3 A;  1H4D A;  2W0V A;  4NAN A;  1EZI A;  2RJ4 A;  4EEG A;  1H4C A;  4BQH A;  2QKX A;  4Y62 A;  2RJ8 A;  3I0K A;  1VGW A;  4D11 A;  1FRW A;  2VS4 A;  2X5Z A;  4HOC A;  1H5S B;  5CQP A;  2CU2 A;  5EJ1 A;  1LZ0 A;  4ASY A;  4DEC A;  1GX4 A;  2BO4 A;  5FTV A;  3U2W A;  1VZU A;  3U2U A;  3ZLL A;  3ZGG A;  1W77 A;  5L6V A;  4AYJ A;  3FWW A;  1FXJ A;  1H7H A;  3SXG A;  4Y7V A;  1K4V A;  1ON8 A;  4HO5 A;  5CQN X;  2V0I A;  3D8V A;  5C4C A;  4R7P A;  4B4M A;  2YQH A;  1WT1 A;  3CKJ A;  3CKV A;  3PKQ A;  2ZU8 A;  5C4D A;  1LZ7 A; 
#chains in the Genus database with same CATH topology
 2D7I A;  5CMG X;  4KC2 A;  2OI6 A;  1G93 A;  1ZJO A;  3CKO A;  2AM5 A;  1O23 B;  2YCM A;  4EE5 A;  4M28 A;  3OC9 A;  4M4K A;  2O1G A;  3T7M A;  1FG5 N;  1W55 A;  3U2T A;  3F1C A;  3R2W A;  4FRQ A;  4HCQ A;  4B5B A;  3JUJ A;  4B42 A;  2FFV A;  1H5T B;  2BO6 A;  1R82 A;  1YP3 A;  2I5E A;  3CU0 A;  3USR A;  4NAI A;  4AYL A;  2YES A;  1ZDF A;  1SS9 A;  3TQD A;  1VPA A;  1R81 A;  1WT0 A;  2J0A A;  4JD0 A;  2VXL A;  4HO4 A;  1WT3 A;  2ICY A;  4Y7U A;  5FYE A;  3V0M A;  3IOJ A;  3RSB A;  2OI5 A;  2AGD A;  3IOH A;  4KC4 A;  2UX8 A;  3DJ4 A;  3V0P A;  1VIC A;  1H5S C;  5L6S A;  1PZT A;  4M2B A;  1ZCY A;  1G97 A;  4XWI A;  4FCE A;  5C48 A;  1R7X A;  1MP3 A;  1FZW A;  2VD4 A;  4K6R A;  1FR8 A;  1WSZ A;  3LW6 A;  4G3Q A;  1PZY B;  4IRQ A;  1E5K A;  4KPZ A;  2FYB A;  4HO3 A;  4FRL A;  2Y4M A;  3O3P A;  2YQC A;  1LL0 A;  1ZIZ A;  5HS2 A;  3Q4S A;  2OEG A;  1QGQ A;  3SXA A;  1YP4 A;  5C4B A;  1O7Q A;  3DK5 A;  5IDS A;  1XZ6 A;  3N9W A;  4B4B A;  2P6W A;  5EIY A;  2RJ6 A;  2WVK A;  1WT2 A;  1LL2 A;  5DDT A;  4HO8 A;  4Y7F A;  1H5R A;  1FXO A;  2PX7 A;  3CKQ A;  1MP4 A;  3V90 A;  4Y9X A;  4KXO A;  3I0D A;  3EE5 A;  2V0K A;  1NMM B;  1YRO B;  2VS5 A;  3TZT A;  1MP5 A;  2V0J A;  1ZJ0 A;  1JYK A;  1FO9 A;  4FIX A;  5FU0 A;  1JV3 A;  4Y63 A;  4FCU A;  3SX8 A;  1HM0 A;  4O6N A;  1QWJ A;  3I0H A;  3CGX A;  2WE9 A;  1NWG B;  3I0C A;  2E8B A;  3SPT A;  1KWS A;  1ZCV A;  1S4N A;  1LL3 A;  3Q7U A;  1G2V A;  2RJ0 A;  4D0Z A;  4MND A;  1GA8 A;  2WEE A;  4HO9 A;  4B2X A;  4NAL A;  4G3P A;  2X5S A;  5FU8 A;  3T7N A;  4NAK A;  2WVL A;  5CMI A;  2YQJ A;  1ZI4 A;  2YC3 A;  2C0N A;  3SXE A;  3I0L A;  1H7G A;  3K8E A;  3V8Y A;  3V91 A;  2VSI A;  3POL A;  5C3B A;  1VH1 A;  1H3M A;  4IRP A;  4JIS A;  3SXB A;  1H7F A;  5C4F A;  2BO8 A;  4UEG A;  1HJL A;  3ZF8 A;  3F1Y A;  1NQI B;  1JV1 A;  1V84 A;  2P73 A;  1JVG A;  3PKP A;  3QVB A;  2BO7 A;  5C8R A;  1OMZ A;  1ZDG A;  4FRO A;  3OGZ A;  3I0E A;  3DUV A;  4L41 C;  4CJ8 A;  3RMV A;  1G95 A;  3I0I X;  1VGT A;  5FTS A;  5EJZ A;  2VSH A;  4EEM A;  4KT7 A;  3SXD A;  4Y64 A;  3I0F A;  2Y7A A;  3I0G A;  3JTJ A;  2YC5 A;  2QH5 A;  2I5K A;  1HV9 A;  4ECM A;  2JCJ A;  2FYA A;  3V0N A;  2FFU A;  2RJ9 A;  3CKN A;  3GUE A;  4DDZ A;  1FWY A;  2Y4K A;  2FY7 A;  1O0R A;  1HM8 A;  4KC1 A;  4EE3 A;  4ASJ A;  1G23 A;  4G3S A;  3USQ A;  1TW1 A;  1ZI3 A;  1G0R A;  1ZJP A;  2WVM A;  5CMJ A;  1VGU A;  5CMF X;  1LVW A;  2A8W A;  2VFZ A;  2Y6P A;  1R80 A;  1INI A;  1INJ A;  2O1F A;  2VS3 A;  3ZLK A;  5IDT A;  4B4G A;  1GWW A;  4D11 C;  2DPW A;  4HG6 A;  1EYR A;  3NGW A;  3BCV A;  1S4P A;  4LW6 A;  2VXM A;  1ON6 A;  1R7U A;  2Z86 A;  5C3A A;  4GBP A;  2JCK A;  3Q80 A;  2AM4 A;  4ZDQ A;  5IFY A;  3V8Z A;  2Q4J A;  5C3D A;  3V0L A;  4FQW A;  2RJ1 A;  4AAW A;  3OKR A;  4FRH A;  2D0J A;  4Y6N A;  3OH3 A;  4DE7 A;  2JCL A;  4HO2 A;  1GX0 A;  2APC A;  1NKH B;  1NF5 B;  4CJB A;  1I52 A;  3U2X A;  2X65 A;  1GQC A;  1H7L A;  4EVW A;  1OQM B;  1VZT A;  3U2V A;  4FRB A;  3D98 A;  4B3U A;  3JUK A;  3PNN A;  5J49 A;  1H5S A;  4FIY A;  3T7O A;  1V82 A;  1H5R B;  2AEC A;  2ZU7 A;  1R7T A;  4G87 A;  2OEF A;  2E3D A;  4E1K A;  2A8U A;  3OH4 A;  1LZJ A;  1G8O A;  1VZX A;  2FYC B;  3I0J A;  1FR9 A;  5D92 A;  3SX5 A;  5JQQ A;  1ZHJ A;  2V0L A;  1IIM A;  4C2S A;  1QGS A;  1H5S D;  2MZB A;  5D91 A;  3OH1 A;  4ARW A;  2VK9 A;  4BMA A;  3V0Q A;  1JVD A;  1ZI1 A;  3OAM A;  2RIY A;  1S4O A;  4FRA A;  1R7Y A;  1VM8 A;  5C49 A;  5CMH A;  3BRK X;  5C1G A;  1FOA A;  4FRP A;  1OMX A;  1IIN A;  2QGI A;  2I7B A;  2PGY A;  1QG8 A;  2X60 A;  1H5T A;  1VH3 A;  4AC3 A;  1GQ9 A;  2XWM A;  5C4E A;  2RJ7 A;  2Z87 A;  3SX7 A;  4FRM A;  4EEO A;  2D7R A;  3SX3 A;  1ZCU A;  3R3I A;  2AE7 A;  3FOQ A;  3RMW A;  4P00 A;  2ZU9 A;  4Y7T A;  4YS8 A;  1R7V A;  5AJN A;  1NHE B;  2W0W A;  4EEA A;  4Y6U A;  4D48 A;  1HM9 A;  5CQO A;  4HO0 A;  2ICX A;  4O6M A;  2RJ5 A;  1ZCT A;  1H7E A;  2Y4L A;  1G3L A;  1YP2 A;  4MIX A;  3IOI A;  1MC3 A;  3K8D A;  2GGO A;  4B2W A;  1TW5 A;  2XWN A;  2PA4 A;  2WGZ A;  2AM3 A;  3E26 A;  2AH9 A;  1HJJ A;  1O7O A;  1LZI A;  2O1H A;  3D5N A;  3OH2 A;  1H7Q A;  4Q7C A;  2Y4J A;  3HL3 A;  2WAW A;  2XMH A;  3KIA A;  4HO6 A;  4KRV A;  1H7T A;  3E25 A;  5BXC A;  1G1L A;  1ZI5 A;  2RIX A;  5I1F A;  1XHB A;  3SXC A;  1G9R A;  4J18 A;  1Z90 A;  2P72 A;  2RIT A;  2XME A;  1H4E A;  5AJP A;  3ZGF A;  3ST8 A;  4M2A A;  4FRE A;  4CJC A;  5CQL X;  2XWL A;  4P02 A;  1W57 A;  1TZF A;  1V83 A;  1WVC A;  4CVH A;  5C47 A;  5FV9 A;  1ZJ2 A;  2PGV A;  4KNX A;  1FGG A;  4D0T A;  2GGQ A;  5AJO A;  2NXV A;  2RIZ A;  4Y7G A;  1ZJ3 A;  5C36 A;  5CQM X;  4KPX A;  2V0H A;  4KNR A;  3OH0 A;  4KQL A;  1GWV A;  2YQS A;  5FUH A;  5C1L A;  4EE4 A;  1VGZ A;  4MYB A;  3U0X A;  2FYD B;  1ZJ1 A;  5DDV A;  5C1H A;  3V0O A;  2AES A;  1JYL A;  5C38 A;  2OI7 A;  1TVY A;  1FO8 A;  1FGX A;  3U0Y A;  2JCO A;  4FRD A;  4LW3 A;  1H4D A;  2W0V A;  4NAN A;  1EZI A;  2RJ4 A;  4EEG A;  1H4C A;  4BQH A;  2QKX A;  4Y62 A;  2RJ8 A;  3I0K A;  1VGW A;  4D11 A;  1FRW A;  2VS4 A;  2X5Z A;  4HOC A;  1H5S B;  5CQP A;  2CU2 A;  5EJ1 A;  1LZ0 A;  4ASY A;  4DEC A;  1GX4 A;  2BO4 A;  5FTV A;  3U2W A;  1VZU A;  3U2U A;  3ZLL A;  3ZGG A;  1W77 A;  5L6V A;  2J0B A;  4AYJ A;  3FWW A;  1FXJ A;  1H7H A;  3SXG A;  4Y7V A;  1K4V A;  1ON8 A;  4HO5 A;  5CQN X;  2V0I A;  3D8V A;  5C4C A;  4R7P A;  4B4M A;  2YQH A;  1WT1 A;  3CKJ A;  3CKV A;  3PKQ A;  2ZU8 A;  5C4D A;  1LZ7 A; 
#chains in the Genus database with same CATH homology
 2D7I A;  5CMG X;  4KC2 A;  2OI6 A;  1G93 A;  1ZJO A;  3CKO A;  2AM5 A;  1O23 B;  2YCM A;  4EE5 A;  4M28 A;  3OC9 A;  4M4K A;  2O1G A;  3T7M A;  1FG5 N;  1W55 A;  3U2T A;  3F1C A;  3R2W A;  4FRQ A;  4HCQ A;  4B5B A;  3JUJ A;  4B42 A;  2FFV A;  1H5T B;  2BO6 A;  1R82 A;  1YP3 A;  2I5E A;  3CU0 A;  3USR A;  4NAI A;  4AYL A;  2YES A;  1ZDF A;  1SS9 A;  3TQD A;  1VPA A;  1R81 A;  1WT0 A;  2J0A A;  4JD0 A;  2VXL A;  4HO4 A;  1WT3 A;  2ICY A;  4Y7U A;  5FYE A;  3V0M A;  3IOJ A;  3RSB A;  2OI5 A;  2AGD A;  3IOH A;  4KC4 A;  2UX8 A;  3DJ4 A;  3V0P A;  1VIC A;  1H5S C;  5L6S A;  1PZT A;  4M2B A;  1ZCY A;  1G97 A;  4XWI A;  4FCE A;  5C48 A;  1R7X A;  1MP3 A;  1FZW A;  2VD4 A;  4K6R A;  1FR8 A;  1WSZ A;  3LW6 A;  4G3Q A;  1PZY B;  4IRQ A;  1E5K A;  4KPZ A;  2FYB A;  4HO3 A;  4FRL A;  2Y4M A;  3O3P A;  2YQC A;  1LL0 A;  1ZIZ A;  5HS2 A;  3Q4S A;  2OEG A;  1QGQ A;  3SXA A;  1YP4 A;  5C4B A;  1O7Q A;  3DK5 A;  5IDS A;  1XZ6 A;  3N9W A;  4B4B A;  2P6W A;  5EIY A;  2RJ6 A;  2WVK A;  1WT2 A;  1LL2 A;  5DDT A;  4HO8 A;  4Y7F A;  1H5R A;  1FXO A;  2PX7 A;  3CKQ A;  1MP4 A;  3V90 A;  4Y9X A;  4KXO A;  3I0D A;  3EE5 A;  2V0K A;  1NMM B;  1YRO B;  2VS5 A;  3TZT A;  1MP5 A;  2V0J A;  1ZJ0 A;  1JYK A;  1FO9 A;  4FIX A;  5FU0 A;  1JV3 A;  4Y63 A;  4FCU A;  3SX8 A;  1HM0 A;  4O6N A;  1QWJ A;  3I0H A;  3CGX A;  2WE9 A;  1NWG B;  3I0C A;  2E8B A;  3SPT A;  1KWS A;  1ZCV A;  1S4N A;  1LL3 A;  3Q7U A;  1G2V A;  2RJ0 A;  4D0Z A;  4MND A;  1GA8 A;  2WEE A;  4HO9 A;  4B2X A;  4NAL A;  4G3P A;  2X5S A;  5FU8 A;  3T7N A;  4NAK A;  2WVL A;  5CMI A;  2YQJ A;  1ZI4 A;  2YC3 A;  2C0N A;  3SXE A;  3I0L A;  1H7G A;  3K8E A;  3V8Y A;  3V91 A;  2VSI A;  3POL A;  5C3B A;  1VH1 A;  1H3M A;  4IRP A;  4JIS A;  3SXB A;  1H7F A;  5C4F A;  2BO8 A;  4UEG A;  1HJL A;  3ZF8 A;  3F1Y A;  1NQI B;  1JV1 A;  1V84 A;  2P73 A;  1JVG A;  3PKP A;  3QVB A;  2BO7 A;  5C8R A;  1OMZ A;  1ZDG A;  4FRO A;  3OGZ A;  3I0E A;  3DUV A;  4L41 C;  4CJ8 A;  3RMV A;  1G95 A;  3I0I X;  1VGT A;  5FTS A;  5EJZ A;  2VSH A;  4EEM A;  4KT7 A;  3SXD A;  4Y64 A;  3I0F A;  2Y7A A;  3I0G A;  3JTJ A;  2YC5 A;  2QH5 A;  2I5K A;  1HV9 A;  4ECM A;  2JCJ A;  2FYA A;  3V0N A;  2FFU A;  2RJ9 A;  3CKN A;  3GUE A;  4DDZ A;  1FWY A;  2Y4K A;  2FY7 A;  1O0R A;  1HM8 A;  4KC1 A;  4EE3 A;  4ASJ A;  1G23 A;  4G3S A;  3USQ A;  1TW1 A;  1ZI3 A;  1G0R A;  1ZJP A;  2WVM A;  5CMJ A;  1VGU A;  5CMF X;  1LVW A;  2A8W A;  2VFZ A;  2Y6P A;  1R80 A;  1INI A;  1INJ A;  2O1F A;  2VS3 A;  3ZLK A;  5IDT A;  4B4G A;  1GWW A;  4D11 C;  2DPW A;  4HG6 A;  1EYR A;  3NGW A;  3BCV A;  1S4P A;  4LW6 A;  2VXM A;  1ON6 A;  1R7U A;  2Z86 A;  5C3A A;  4GBP A;  2JCK A;  3Q80 A;  2AM4 A;  4ZDQ A;  5IFY A;  3V8Z A;  2Q4J A;  5C3D A;  3V0L A;  4FQW A;  2RJ1 A;  4AAW A;  3OKR A;  4FRH A;  2D0J A;  4Y6N A;  3OH3 A;  4DE7 A;  2JCL A;  4HO2 A;  1GX0 A;  2APC A;  1NKH B;  1NF5 B;  4CJB A;  1I52 A;  3U2X A;  2X65 A;  1GQC A;  1H7L A;  4EVW A;  1OQM B;  1VZT A;  3U2V A;  4FRB A;  3D98 A;  4B3U A;  3JUK A;  3PNN A;  5J49 A;  1H5S A;  4FIY A;  3T7O A;  1V82 A;  1H5R B;  2AEC A;  2ZU7 A;  1R7T A;  4G87 A;  2OEF A;  2E3D A;  4E1K A;  2A8U A;  3OH4 A;  1LZJ A;  1G8O A;  1VZX A;  2FYC B;  3I0J A;  1FR9 A;  5D92 A;  3SX5 A;  5JQQ A;  1ZHJ A;  2V0L A;  1IIM A;  4C2S A;  1QGS A;  1H5S D;  2MZB A;  5D91 A;  3OH1 A;  4ARW A;  2VK9 A;  4BMA A;  3V0Q A;  1JVD A;  1ZI1 A;  3OAM A;  2RIY A;  1S4O A;  4FRA A;  1R7Y A;  1VM8 A;  5C49 A;  5CMH A;  3BRK X;  5C1G A;  1FOA A;  4FRP A;  1OMX A;  1IIN A;  2QGI A;  2I7B A;  2PGY A;  1QG8 A;  2X60 A;  1H5T A;  1VH3 A;  4AC3 A;  1GQ9 A;  2XWM A;  5C4E A;  2RJ7 A;  2Z87 A;  3SX7 A;  4FRM A;  4EEO A;  2D7R A;  3SX3 A;  1ZCU A;  3R3I A;  2AE7 A;  3FOQ A;  3RMW A;  4P00 A;  2ZU9 A;  4Y7T A;  4YS8 A;  1R7V A;  5AJN A;  1NHE B;  2W0W A;  4EEA A;  4Y6U A;  4D48 A;  1HM9 A;  5CQO A;  4HO0 A;  2ICX A;  4O6M A;  2RJ5 A;  1ZCT A;  1H7E A;  2Y4L A;  1G3L A;  1YP2 A;  4MIX A;  3IOI A;  1MC3 A;  3K8D A;  2GGO A;  4B2W A;  1TW5 A;  2XWN A;  2PA4 A;  2WGZ A;  2AM3 A;  3E26 A;  2AH9 A;  1HJJ A;  1O7O A;  1LZI A;  2O1H A;  3D5N A;  3OH2 A;  1H7Q A;  4Q7C A;  2Y4J A;  3HL3 A;  2WAW A;  2XMH A;  3KIA A;  4HO6 A;  4KRV A;  1H7T A;  3E25 A;  5BXC A;  1G1L A;  1ZI5 A;  2RIX A;  5I1F A;  1XHB A;  3SXC A;  1G9R A;  4J18 A;  1Z90 A;  2P72 A;  2RIT A;  2XME A;  1H4E A;  5AJP A;  3ZGF A;  3ST8 A;  4M2A A;  4FRE A;  4CJC A;  5CQL X;  2XWL A;  4P02 A;  1W57 A;  1TZF A;  1V83 A;  1WVC A;  4CVH A;  5C47 A;  5FV9 A;  1ZJ2 A;  2PGV A;  4KNX A;  1FGG A;  4D0T A;  2GGQ A;  5AJO A;  2NXV A;  2RIZ A;  4Y7G A;  1ZJ3 A;  5C36 A;  5CQM X;  4KPX A;  2V0H A;  4KNR A;  3OH0 A;  4KQL A;  1GWV A;  2YQS A;  5FUH A;  5C1L A;  4EE4 A;  1VGZ A;  4MYB A;  3U0X A;  2FYD B;  1ZJ1 A;  5DDV A;  5C1H A;  3V0O A;  2AES A;  1JYL A;  5C38 A;  2OI7 A;  1TVY A;  1FO8 A;  1FGX A;  3U0Y A;  2JCO A;  4FRD A;  4LW3 A;  1H4D A;  2W0V A;  4NAN A;  1EZI A;  2RJ4 A;  4EEG A;  1H4C A;  4BQH A;  2QKX A;  4Y62 A;  2RJ8 A;  3I0K A;  1VGW A;  4D11 A;  1FRW A;  2VS4 A;  2X5Z A;  4HOC A;  1H5S B;  5CQP A;  2CU2 A;  5EJ1 A;  1LZ0 A;  4ASY A;  4DEC A;  1GX4 A;  2BO4 A;  5FTV A;  3U2W A;  1VZU A;  3U2U A;  3ZLL A;  3ZGG A;  1W77 A;  5L6V A;  2J0B A;  4AYJ A;  3FWW A;  1FXJ A;  1H7H A;  3SXG A;  4Y7V A;  1K4V A;  1ON8 A;  4HO5 A;  5CQN X;  2V0I A;  3D8V A;  5C4C A;  4R7P A;  4B4M A;  2YQH A;  1WT1 A;  3CKJ A;  3CKV A;  3PKQ A;  2ZU8 A;  5C4D A;  1LZ7 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...