1QWJA

The crystal structure of murine cmp-5-n-acetylneuraminic acid synthetase
Total Genus 65
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
65
sequence length
228
structure length
228
Chain Sequence
PPHLAALVLARGGSKGIPLKNIKRLAGVPLIGWVLRAALDAGVFQSVWVSTDHDEIENVAKQFGAQVHRRSSETSKDSSTSLDAIVEFLNYHNEVDIVGNIQATSPCLHPTDLQKVAEMIREEGYDSVFSVVRRHQFRWSEIQKGVREVTEPLNLNPAKRPRRQDWDGELYENGSFYFAKRHLIEMGYLQGGKMAYYEMRAEHSVDIDVDIDWPIAEQRVLRFGYFGK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords cytidine monophospho-N-acetylneuraminic acid synthetase
publication title The Crystal Structure of Murine CMP-5-N-acetylneuraminic Acid Synthetase
pubmed doi rcsb
source organism Mus musculus
molecule tags Transferase
total genus 65
structure length 228
sequence length 228
chains with identical sequence B, C, D
ec nomenclature ec 2.7.7.43: N-acylneuraminate cytidylyltransferase.
pdb deposition date 2003-09-02
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.550.10 Alpha Beta Alpha-Beta Complex Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A 1qwjA00
4K6RA 4XWIA 3RSBA 5C3BA 3SXGA 2RJ5A 5AJNA 1OMXA 5CQPA 1O7QA 4JD0A 4FRQA 2BO6A 2FFUA 1EZIA 2RJ6A 3Q80A 5CMGX 1FWYA 2GGOA 2APCA 2D0JA 4E1KA 2YCMA 3DK5A 2A8UA 1HM0A 3ZF8A 4M2AA 4FRBA 1G8OA 3TQDA 2AGDA 3V90A 3V0QA 3CKQA 5AJOA 4B2WA 1KWSA 4JISA 1TZFA 1I52A 3SXEA 4DDZA 4FRPA 1ZCUA 4KXOA 1JVGA 4IRQA 5BXCA 2AM4A 3I0CA 2Y4JA 2RJ8A 2QGIA 2WEEA 2I5EA 2AH9A 4Y7GA 1MC3A 3N9WA 1R7VA 3OH4A 4ECMA 1G93A 1G9RA 4R7PA 4B4BA 1S4PA 1H5SD 1V82A 3OKRA 5JQQA 2X60A 2AESA 2Q4JA 3OH3A 4HO6A 3O3PA 4EVWA 1R82A 3SXBA 3I0GA 3V0LA 4AC3A 3SPTA 2AE7A 3FOQA 1H7HA 4MNDA 1TW5A 3RMVA 2Z87A 1XHBA 2WGZA 4FCUA 1LL2A 2V0JA 4NALA 3U2TA 1ZI1A 1EYRA 3FWWA 4D11A 4UEGA 1GX4A 1H7FA 1ZHJA 1ZJOA 2JCKA 1JYKA 3V8ZA 4ARWA 1ZJPA 4KRVA 3F1CA 1TW1A 1H5SA 5C3DA 2OI5A 4Y63A 5C1HA 3I0IX 1FO8A 1INIA 2RIZA 1LZ7A 1LZJA 4D48A 2X65A 2RJ1A 2AECA 3HL3A 2VFZA 4FRLA 3E26A 5IDTA 1QGSA 4Y6NA 4ASJA 4CJ8A 3K8DA 3JUJA 4EEGA 3V8YA 1ZJ2A 2PGYA 3CKNA 1NQIB 1G0RA 1H4DA 3CU0A 5C3AA 1Z90A 2ICXA 5EJ1A 2Y4LA 5C4FA 2NXVA 1H5RB 2BO8A 2RJ4A 3SXDA 5FU8A 2GGQA 3T7OA 3CKOA 2YQCA 1WSZA 1W77A 4Y7UA 4LW3A 3EE5A 2AM3A 2O1GA 5C48A 1ZI5A 1LVWA 4D11C 3SX7A 3TZTA 1H5TA 1PZYB 2RIYA 2RIXA 3CKVA 4NAKA 3BCVA 2OI7A 2I7BA 3I0JA 2DPWA 4DECA 4Y62A 3OH1A 5C4EA 3CGXA 2Y4KA 3I0FA 1WT1A 1WT2A 4FRAA 1JYLA 3SXCA 2FFVA 1VH1A 1O7OA 1VICA 1H7QA 4B3UA 4AAWA 2Z86A 3GUEA 1FXJA 2BO4A 2V0IA 2RJ7A 1S4NA 1JV1A 4G3QA 5EIYA 1TVYA 2VXLA 4EE5A 1GQCA 1H4CA 5L6VA 1HV9A 4HO0A 2RITA 2VSIA 1HJJA 3ZLLA 2ZU7A 4FRDA 3SX8A 1G23A 1WT0A 1QWJA 1ON6A 2WE9A 1WT3A 4ASYA 5HS2A 2OEFA 5DDVA 2E8BA 3KIAA 2RJ0A 5C1GA 2PGVA 3SX5A 3U0YA 5FTVA 1MP5A 2Y4MA 4EEAA 4FCEA 1H7TA 2FYDB 1R7XA 2PX7A 5FUHA 1VZUA 3BRKX 4J18A 5J49A 3OH0A 2VD4A 1V84A 1WVCA 1FR9A 5C4DA 5I1FA 4KC1A 2JCJA 3K8EA 2V0HA 3PKPA 4Y7FA 1VGTA 2X5SA 2UX8A 1ZCTA 1ZCVA 1MP3A 4FQWA 1O23B 2D7IA 2PA4A 2I5KA 4Y6UA 1VGUA 3I0DA 4EEOA 4BMAA 3ST8A 3F1YA 4HG6A 1GQ9A 1H5TB 2YQJA 5L6SA 2XWLA 3V0PA 5C47A 1LZIA 4YS8A 4M28A 2YQSA 5CMJA 1NMMB 2Y6PA 3I0HA 1VPAA 2RJ9A 2V0LA 1H7GA 1H3MA 1NHEB 2D7RA 4B4MA 1PZTA 1IINA 4EE3A 5C8RA 4G87A 2YC3A 1INJA 5CMHA 2WVKA 1V83A 3OGZA 1YP3A 4L41C 1ZDGA 1JV3A 1O0RA 2VS3A 3OAMA 5C1LA 5C49A 3IOIA 5CQNX 1R80A 2QKXA 3U0XA 1GWVA 1OQMB 3U2UA 1GX0A 1H5SC 1FG5N 3R2WA 3USQA 3V91A 4CJCA 3V0OA 1FXOA 2P6WA 3ZGGA 4KT7A 3ZGFA 3LW6A 3DJ4A 5CMFX 2FY7A 1G95A 2O1HA 1NKHB 4HO9A 4KQLA 3DUVA 5C38A 4M4KA 3V0MA 1YROB 1YP2A 2OI6A 2Y7AA 3D8VA 4CJBA 2FYAA 4EEMA 4G3SA 2XMEA 3I0EA 1LL3A 4DE7A 1LL0A 1MP4A 4FRHA 5FV9A 1FRWA 3T7MA 2YESA 1JVDA 4FREA 4B4GA 5C4CA 1H5RA 4D0ZA 1ZIZA 3NGWA 1E5KA 2FYCB 2VXMA 3IOHA 1SS9A 1W55A 3Q4SA 4P02A 3E25A 1YP4A 1H5SB 2OEGA 1HM9A 2BO7A 1OMZA 1ZDFA 4KC4A 3U2XA 4HO2A 2A8WA 2VSHA 4Y7VA 1VH3A 1G1LA 3U2VA 2V0KA 2FYBA 5C4BA 2XWNA 1ZI4A 1ZJ1A 4HOCA 2CU2A 4B2XA 1ON8A 4M2BA 3R3IA 4FROA 1FGXA 5EJZA 5IFYA 1S4OA 4Y64A 1VGZA 2E3DA 4AYLA 1K4VA 4B42A 5CMIA 3T7NA 3I0KA 3IOJA 3OC9A 4LW6A 2VS5A 5FU0A 1H7LA 2VS4A 3SXAA 4FRMA 2YC5A 2WVMA 1G97A 2WAWA 1R7TA 2QH5A 5AJPA 4KPZA 4ZDQA 1FOAA 4P00A 1NWGB 5FYEA 2P73A 4KNXA 1W57A 1ZJ3A 2ZU8A 3QVBA 4GBPA 2X5ZA 4IRPA 3ZLKA 1GWWA 4HO8A 1H4EA 3D5NA 3POLA 1FR8A 4Y9XA 1R81A 4NAIA 5CQLX 4EE4A 1QGQA 1ZJ0A 2W0VA 3OH2A 2O1FA 5DDTA 3U2WA 3USRA 1ZI3A 1G2VA 3RMWA 1FGGA 1QG8A 2XMHA 5C36A 4AYJA 1H7EA 2AM5A 4BQHA 3CKJA 4HO3A 5FTSA 2W0WA 3SX3A 3JTJA 3JUKA 5IDSA 1HM8A 4G3PA 3Q7UA 4NANA 4HO5A 1G3LA 1R7UA 5CQOA 3PNNA 1LZ0A 1ZCYA 4KC2A 1FO9A 2MZBA 1HJLA 4Y7TA 1VZXA 4KPXA 1NF5B 2YQHA 1GA8A 4HCQA 1VGWA 1XZ6A 2JCOA 2JCLA 4KNRA 4D0TA 4C2SA 4HO4A 1IIMA 2P72A 3I0LA 4MYBA 1R7YA 1VM8A 2ZU9A 3PKQA 3D98A 1FZWA 3V0NA 5CQMX 2WVLA 1VZTA 2XWMA 4CVHA 2ICYA 4B5BA
chains in the Genus database with same CATH superfamily
4K6RA 4XWIA 3RSBA 5C3BA 3SXGA 2RJ5A 5AJNA 1OMXA 5CQPA 1O7QA 4JD0A 4FRQA 2BO6A 2FFUA 1EZIA 2RJ6A 3Q80A 5CMGX 1FWYA 2GGOA 2APCA 2D0JA 4E1KA 2YCMA 3DK5A 2A8UA 1HM0A 3ZF8A 4M2AA 4FRBA 1G8OA 3TQDA 2AGDA 3V90A 3V0QA 3CKQA 5AJOA 4B2WA 1KWSA 4JISA 1TZFA 1I52A 3SXEA 4DDZA 4FRPA 1ZCUA 4KXOA 1JVGA 4IRQA 5D92A 5BXCA 2AM4A 3I0CA 4FIXA 2Y4JA 2RJ8A 2QGIA 2WEEA 2I5EA 2AH9A 4Y7GA 1MC3A 3N9WA 1R7VA 3OH4A 4ECMA 1G93A 1G9RA 4R7PA 4B4BA 1S4PA 1H5SD 1V82A 3OKRA 5JQQA 2X60A 2AESA 2Q4JA 3OH3A 4HO6A 3O3PA 4EVWA 1R82A 3SXBA 3I0GA 3V0LA 4AC3A 3SPTA 2AE7A 3FOQA 2J0BA 1H7HA 4MNDA 1TW5A 3RMVA 2Z87A 1XHBA 2WGZA 4FCUA 1LL2A 2V0JA 4NALA 3U2TA 1ZI1A 1EYRA 3FWWA 4D11A 4UEGA 1GX4A 1H7FA 1ZHJA 1ZJOA 2JCKA 1JYKA 3V8ZA 4ARWA 1ZJPA 4KRVA 3F1CA 1TW1A 1H5SA 5C3DA 2OI5A 4Y63A 4O6NA 5C1HA 3I0IX 1FO8A 1INIA 2RIZA 1LZ7A 1LZJA 4D48A 2X65A 2RJ1A 2AECA 3HL3A 2VFZA 4FRLA 3E26A 5IDTA 1QGSA 4Y6NA 4ASJA 4CJ8A 3K8DA 3JUJA 4EEGA 3V8YA 1ZJ2A 2PGYA 3CKNA 1NQIB 1G0RA 1H4DA 3CU0A 5C3AA 1Z90A 2ICXA 5EJ1A 2Y4LA 5C4FA 2NXVA 1H5RB 2BO8A 2RJ4A 3SXDA 5FU8A 2GGQA 3T7OA 3CKOA 2YQCA 1WSZA 1W77A 4Y7UA 4LW3A 3EE5A 2AM3A 2O1GA 5C48A 1ZI5A 1LVWA 4D11C 3SX7A 3TZTA 1H5TA 1PZYB 2RIYA 2RIXA 3CKVA 4NAKA 3BCVA 2OI7A 2I7BA 3I0JA 2DPWA 4DECA 4Y62A 3OH1A 5C4EA 3CGXA 2Y4KA 3I0FA 1WT1A 1WT2A 4FRAA 1JYLA 3SXCA 2FFVA 1VH1A 1O7OA 1VICA 1H7QA 4B3UA 4AAWA 2Z86A 3GUEA 1FXJA 2BO4A 2V0IA 2RJ7A 1S4NA 1JV1A 4G3QA 5EIYA 1TVYA 2VXLA 4EE5A 1GQCA 1H4CA 5L6VA 1HV9A 4HO0A 2RITA 2VSIA 1HJJA 3ZLLA 2ZU7A 4FRDA 3SX8A 1G23A 1WT0A 1QWJA 1ON6A 2WE9A 1WT3A 4ASYA 5HS2A 2OEFA 5DDVA 2E8BA 3KIAA 2RJ0A 5C1GA 2PGVA 3SX5A 3U0YA 5FTVA 1MP5A 2Y4MA 4EEAA 4FCEA 1H7TA 2FYDB 1R7XA 2PX7A 5FUHA 1VZUA 3BRKX 4J18A 5J49A 3OH0A 2VD4A 1V84A 1WVCA 1FR9A 5C4DA 5I1FA 4KC1A 2JCJA 3K8EA 2V0HA 3PKPA 4Y7FA 1VGTA 2X5SA 2UX8A 1ZCTA 1ZCVA 1MP3A 4FQWA 1O23B 2D7IA 2PA4A 2I5KA 4Y6UA 1VGUA 3I0DA 4EEOA 4BMAA 3ST8A 3F1YA 4HG6A 1GQ9A 1H5TB 2YQJA 5L6SA 2C0NA 2XWLA 2VK9A 3V0PA 5C47A 1LZIA 4YS8A 4M28A 2YQSA 5CMJA 1NMMB 2Y6PA 3I0HA 1VPAA 2RJ9A 2V0LA 1H7GA 1H3MA 1NHEB 2D7RA 4B4MA 1PZTA 1IINA 4EE3A 5C8RA 4G87A 2YC3A 1INJA 5CMHA 2WVKA 1V83A 3OGZA 1YP3A 4L41C 1ZDGA 1JV3A 1O0RA 2VS3A 3OAMA 5C1LA 5C49A 3IOIA 5CQNX 1R80A 2QKXA 3U0XA 1GWVA 1OQMB 3U2UA 1GX0A 1H5SC 1FG5N 3R2WA 3USQA 3V91A 4CJCA 3V0OA 1FXOA 2P6WA 3ZGGA 4KT7A 3ZGFA 3LW6A 3DJ4A 5CMFX 2FY7A 1G95A 2O1HA 1NKHB 4HO9A 4KQLA 3DUVA 5C38A 4M4KA 3V0MA 1YROB 2J0AA 1YP2A 2OI6A 2Y7AA 3D8VA 4CJBA 2FYAA 4EEMA 4G3SA 2XMEA 3I0EA 1LL3A 4DE7A 1LL0A 1MP4A 4FRHA 5FV9A 4MIXA 1FRWA 3T7MA 2YESA 1JVDA 4FREA 4B4GA 5C4CA 1H5RA 4D0ZA 1ZIZA 3NGWA 1E5KA 2FYCB 2VXMA 3IOHA 1SS9A 1W55A 3Q4SA 4P02A 3E25A 1YP4A 1H5SB 2OEGA 1HM9A 2BO7A 4Q7CA 1OMZA 1ZDFA 4KC4A 3U2XA 4HO2A 2A8WA 2VSHA 4Y7VA 1VH3A 1G1LA 3U2VA 2V0KA 4O6MA 2FYBA 5C4BA 2XWNA 1ZI4A 1ZJ1A 4HOCA 2CU2A 4B2XA 1ON8A 4M2BA 3R3IA 4FROA 1FGXA 5EJZA 5IFYA 1S4OA 4Y64A 1VGZA 2E3DA 4AYLA 1K4VA 4B42A 5CMIA 3T7NA 3I0KA 3IOJA 3OC9A 4LW6A 2VS5A 5FU0A 1H7LA 2VS4A 3SXAA 4FRMA 2YC5A 2WVMA 1G97A 2WAWA 1R7TA 5D91A 2QH5A 5AJPA 4KPZA 4ZDQA 1FOAA 4FIYA 4P00A 1NWGB 5FYEA 2P73A 4KNXA 1W57A 1ZJ3A 2ZU8A 3QVBA 4GBPA 2X5ZA 4IRPA 3ZLKA 1GWWA 4HO8A 1H4EA 3D5NA 3POLA 1FR8A 4Y9XA 1R81A 4NAIA 5CQLX 4EE4A 1QGQA 1ZJ0A 2W0VA 3OH2A 2O1FA 5DDTA 3U2WA 3USRA 1ZI3A 1G2VA 3RMWA 1FGGA 1QG8A 2XMHA 5C36A 4AYJA 1H7EA 2AM5A 4BQHA 3CKJA 4HO3A 5FTSA 2W0WA 3SX3A 3JTJA 3JUKA 5IDSA 1HM8A 4G3PA 3Q7UA 4NANA 4HO5A 1G3LA 1R7UA 5CQOA 3PNNA 1LZ0A 1ZCYA 4KC2A 1FO9A 2MZBA 1HJLA 4Y7TA 1VZXA 4KPXA 1NF5B 2YQHA 1GA8A 4HCQA 1VGWA 1XZ6A 2JCOA 2JCLA 4KNRA 4D0TA 4C2SA 4HO4A 1IIMA 2P72A 3I0LA 4MYBA 1R7YA 1VM8A 2ZU9A 3PKQA 3D98A 1FZWA 3V0NA 5CQMX 2WVLA 1VZTA 2XWMA 4CVHA 2ICYA 4B5BA
chains in the Genus database with same CATH topology
4K6RA 4XWIA 3RSBA 5C3BA 3SXGA 2RJ5A 5AJNA 1OMXA 5CQPA 1O7QA 4JD0A 4FRQA 2BO6A 2FFUA 1EZIA 2RJ6A 3Q80A 5CMGX 1FWYA 2GGOA 2APCA 2D0JA 4E1KA 2YCMA 3DK5A 2A8UA 1HM0A 3ZF8A 4M2AA 4FRBA 1G8OA 3TQDA 2AGDA 3V90A 3V0QA 3CKQA 5AJOA 4B2WA 1KWSA 4JISA 1TZFA 1I52A 3SXEA 4DDZA 4FRPA 1ZCUA 4KXOA 1JVGA 4IRQA 5D92A 5BXCA 2AM4A 3I0CA 4FIXA 2Y4JA 2RJ8A 2QGIA 2WEEA 2I5EA 2AH9A 4Y7GA 1MC3A 3N9WA 1R7VA 3OH4A 4ECMA 1G93A 1G9RA 4R7PA 4B4BA 1S4PA 1H5SD 1V82A 3OKRA 5JQQA 2X60A 2AESA 2Q4JA 3OH3A 4HO6A 3O3PA 4EVWA 1R82A 3SXBA 3I0GA 3V0LA 4AC3A 3SPTA 2AE7A 3FOQA 2J0BA 1H7HA 4MNDA 1TW5A 3RMVA 2Z87A 1XHBA 2WGZA 4FCUA 1LL2A 2V0JA 4NALA 3U2TA 1ZI1A 1EYRA 3FWWA 4D11A 4UEGA 1GX4A 1H7FA 1ZHJA 1ZJOA 2JCKA 1JYKA 3V8ZA 4ARWA 1ZJPA 4KRVA 3F1CA 1TW1A 1H5SA 5C3DA 2OI5A 4Y63A 4O6NA 5C1HA 3I0IX 1FO8A 1INIA 2RIZA 1LZ7A 1LZJA 4D48A 2X65A 2RJ1A 2AECA 3HL3A 2VFZA 4FRLA 3E26A 5IDTA 1QGSA 4Y6NA 4ASJA 4CJ8A 3K8DA 3JUJA 4EEGA 3V8YA 1ZJ2A 2PGYA 3CKNA 1NQIB 1G0RA 1H4DA 3CU0A 5C3AA 1Z90A 2ICXA 5EJ1A 2Y4LA 5C4FA 2NXVA 1H5RB 2BO8A 2RJ4A 3SXDA 5FU8A 2GGQA 3T7OA 3CKOA 2YQCA 1WSZA 1W77A 4Y7UA 4LW3A 3EE5A 2AM3A 2O1GA 5C48A 1ZI5A 1LVWA 4D11C 3SX7A 3TZTA 1H5TA 1PZYB 2RIYA 2RIXA 3CKVA 4NAKA 3BCVA 2OI7A 2I7BA 3I0JA 2DPWA 4DECA 4Y62A 3OH1A 5C4EA 3CGXA 2Y4KA 3I0FA 1WT1A 1WT2A 4FRAA 1JYLA 3SXCA 2FFVA 1VH1A 1O7OA 1VICA 1H7QA 4B3UA 4AAWA 2Z86A 3GUEA 1FXJA 2BO4A 2V0IA 2RJ7A 1S4NA 1JV1A 4G3QA 5EIYA 1TVYA 2VXLA 4EE5A 1GQCA 1H4CA 5L6VA 1HV9A 4HO0A 2RITA 2VSIA 1HJJA 3ZLLA 2ZU7A 4FRDA 3SX8A 1G23A 1WT0A 1QWJA 1ON6A 2WE9A 1WT3A 4ASYA 5HS2A 2OEFA 5DDVA 2E8BA 3KIAA 2RJ0A 5C1GA 2PGVA 3SX5A 3U0YA 5FTVA 1MP5A 2Y4MA 4EEAA 4FCEA 1H7TA 2FYDB 1R7XA 2PX7A 5FUHA 1VZUA 3BRKX 4J18A 5J49A 3OH0A 2VD4A 1V84A 1WVCA 1FR9A 5C4DA 5I1FA 4KC1A 2JCJA 3K8EA 2V0HA 3PKPA 4Y7FA 1VGTA 2X5SA 2UX8A 1ZCTA 1ZCVA 1MP3A 4FQWA 1O23B 2D7IA 2PA4A 2I5KA 4Y6UA 1VGUA 3I0DA 4EEOA 4BMAA 3ST8A 3F1YA 4HG6A 1GQ9A 1H5TB 2YQJA 5L6SA 2C0NA 2XWLA 2VK9A 3V0PA 5C47A 1LZIA 4YS8A 4M28A 2YQSA 5CMJA 1NMMB 2Y6PA 3I0HA 1VPAA 2RJ9A 2V0LA 1H7GA 1H3MA 1NHEB 2D7RA 4B4MA 1PZTA 1IINA 4EE3A 5C8RA 4G87A 2YC3A 1INJA 5CMHA 2WVKA 1V83A 3OGZA 1YP3A 4L41C 1ZDGA 1JV3A 1O0RA 2VS3A 3OAMA 5C1LA 5C49A 3IOIA 5CQNX 1R80A 2QKXA 3U0XA 1GWVA 1OQMB 3U2UA 1GX0A 1H5SC 1FG5N 3R2WA 3USQA 3V91A 4CJCA 3V0OA 1FXOA 2P6WA 3ZGGA 4KT7A 3ZGFA 3LW6A 3DJ4A 5CMFX 2FY7A 1G95A 2O1HA 1NKHB 4HO9A 4KQLA 3DUVA 5C38A 4M4KA 3V0MA 1YROB 2J0AA 1YP2A 2OI6A 2Y7AA 3D8VA 4CJBA 2FYAA 4EEMA 4G3SA 2XMEA 3I0EA 1LL3A 4DE7A 1LL0A 1MP4A 4FRHA 5FV9A 4MIXA 1FRWA 3T7MA 2YESA 1JVDA 4FREA 4B4GA 5C4CA 1H5RA 4D0ZA 1ZIZA 3NGWA 1E5KA 2FYCB 2VXMA 3IOHA 1SS9A 1W55A 3Q4SA 4P02A 3E25A 1YP4A 1H5SB 2OEGA 1HM9A 2BO7A 4Q7CA 1OMZA 1ZDFA 4KC4A 3U2XA 4HO2A 2A8WA 2VSHA 4Y7VA 1VH3A 1G1LA 3U2VA 2V0KA 4O6MA 2FYBA 5C4BA 2XWNA 1ZI4A 1ZJ1A 4HOCA 2CU2A 4B2XA 1ON8A 4M2BA 3R3IA 4FROA 1FGXA 5EJZA 5IFYA 1S4OA 4Y64A 1VGZA 2E3DA 4AYLA 1K4VA 4B42A 5CMIA 3T7NA 3I0KA 3IOJA 3OC9A 4LW6A 2VS5A 5FU0A 1H7LA 2VS4A 3SXAA 4FRMA 2YC5A 2WVMA 1G97A 2WAWA 1R7TA 5D91A 2QH5A 5AJPA 4KPZA 4ZDQA 1FOAA 4FIYA 4P00A 1NWGB 5FYEA 2P73A 4KNXA 1W57A 1ZJ3A 2ZU8A 3QVBA 4GBPA 2X5ZA 4IRPA 3ZLKA 1GWWA 4HO8A 1H4EA 3D5NA 3POLA 1FR8A 4Y9XA 1R81A 4NAIA 5CQLX 4EE4A 1QGQA 1ZJ0A 2W0VA 3OH2A 2O1FA 5DDTA 3U2WA 3USRA 1ZI3A 1G2VA 3RMWA 1FGGA 1QG8A 2XMHA 5C36A 4AYJA 1H7EA 2AM5A 4BQHA 3CKJA 4HO3A 5FTSA 2W0WA 3SX3A 3JTJA 3JUKA 5IDSA 1HM8A 4G3PA 3Q7UA 4NANA 4HO5A 1G3LA 1R7UA 5CQOA 3PNNA 1LZ0A 1ZCYA 4KC2A 1FO9A 2MZBA 1HJLA 4Y7TA 1VZXA 4KPXA 1NF5B 2YQHA 1GA8A 4HCQA 1VGWA 1XZ6A 2JCOA 2JCLA 4KNRA 4D0TA 4C2SA 4HO4A 1IIMA 2P72A 3I0LA 4MYBA 1R7YA 1VM8A 2ZU9A 3PKQA 3D98A 1FZWA 3V0NA 5CQMX 2WVLA 1VZTA 2XWMA 4CVHA 2ICYA 4B5BA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4K6R A;  4XWI A;  3RSB A;  5C3B A;  3SXG A;  2RJ5 A;  5AJN A;  1OMX A;  5CQP A;  1O7Q A;  4JD0 A;  4FRQ A;  2BO6 A;  2FFU A;  1EZI A;  2RJ6 A;  3Q80 A;  5CMG X;  1FWY A;  2GGO A;  2APC A;  2D0J A;  4E1K A;  2YCM A;  3DK5 A;  2A8U A;  1HM0 A;  3ZF8 A;  4M2A A;  4FRB A;  1G8O A;  3TQD A;  2AGD A;  3V90 A;  3V0Q A;  3CKQ A;  5AJO A;  4B2W A;  1KWS A;  4JIS A;  1TZF A;  1I52 A;  3SXE A;  4DDZ A;  4FRP A;  1ZCU A;  4KXO A;  1JVG A;  4IRQ A;  5BXC A;  2AM4 A;  3I0C A;  2Y4J A;  2RJ8 A;  2QGI A;  2WEE A;  2I5E A;  2AH9 A;  4Y7G A;  1MC3 A;  3N9W A;  1R7V A;  3OH4 A;  4ECM A;  1G93 A;  1G9R A;  4R7P A;  4B4B A;  1S4P A;  1H5S D;  1V82 A;  3OKR A;  5JQQ A;  2X60 A;  2AES A;  2Q4J A;  3OH3 A;  4HO6 A;  3O3P A;  4EVW A;  1R82 A;  3SXB A;  3I0G A;  3V0L A;  4AC3 A;  3SPT A;  2AE7 A;  3FOQ A;  1H7H A;  4MND A;  1TW5 A;  3RMV A;  2Z87 A;  1XHB A;  2WGZ A;  4FCU A;  1LL2 A;  2V0J A;  4NAL A;  3U2T A;  1ZI1 A;  1EYR A;  3FWW A;  4D11 A;  4UEG A;  1GX4 A;  1H7F A;  1ZHJ A;  1ZJO A;  2JCK A;  1JYK A;  3V8Z A;  4ARW A;  1ZJP A;  4KRV A;  3F1C A;  1TW1 A;  1H5S A;  5C3D A;  2OI5 A;  4Y63 A;  5C1H A;  3I0I X;  1FO8 A;  1INI A;  2RIZ A;  1LZ7 A;  1LZJ A;  4D48 A;  2X65 A;  2RJ1 A;  2AEC A;  3HL3 A;  2VFZ A;  4FRL A;  3E26 A;  5IDT A;  1QGS A;  4Y6N A;  4ASJ A;  4CJ8 A;  3K8D A;  3JUJ A;  4EEG A;  3V8Y A;  1ZJ2 A;  2PGY A;  3CKN A;  1NQI B;  1G0R A;  1H4D A;  3CU0 A;  5C3A A;  1Z90 A;  2ICX A;  5EJ1 A;  2Y4L A;  5C4F A;  2NXV A;  1H5R B;  2BO8 A;  2RJ4 A;  3SXD A;  5FU8 A;  2GGQ A;  3T7O A;  3CKO A;  2YQC A;  1WSZ A;  1W77 A;  4Y7U A;  4LW3 A;  3EE5 A;  2AM3 A;  2O1G A;  5C48 A;  1ZI5 A;  1LVW A;  4D11 C;  3SX7 A;  3TZT A;  1H5T A;  1PZY B;  2RIY A;  2RIX A;  3CKV A;  4NAK A;  3BCV A;  2OI7 A;  2I7B A;  3I0J A;  2DPW A;  4DEC A;  4Y62 A;  3OH1 A;  5C4E A;  3CGX A;  2Y4K A;  3I0F A;  1WT1 A;  1WT2 A;  4FRA A;  1JYL A;  3SXC A;  2FFV A;  1VH1 A;  1O7O A;  1VIC A;  1H7Q A;  4B3U A;  4AAW A;  2Z86 A;  3GUE A;  1FXJ A;  2BO4 A;  2V0I A;  2RJ7 A;  1S4N A;  1JV1 A;  4G3Q A;  5EIY A;  1TVY A;  2VXL A;  4EE5 A;  1GQC A;  1H4C A;  5L6V A;  1HV9 A;  4HO0 A;  2RIT A;  2VSI A;  1HJJ A;  3ZLL A;  2ZU7 A;  4FRD A;  3SX8 A;  1G23 A;  1WT0 A;  1QWJ A;  1ON6 A;  2WE9 A;  1WT3 A;  4ASY A;  5HS2 A;  2OEF A;  5DDV A;  2E8B A;  3KIA A;  2RJ0 A;  5C1G A;  2PGV A;  3SX5 A;  3U0Y A;  5FTV A;  1MP5 A;  2Y4M A;  4EEA A;  4FCE A;  1H7T A;  2FYD B;  1R7X A;  2PX7 A;  5FUH A;  1VZU A;  3BRK X;  4J18 A;  5J49 A;  3OH0 A;  2VD4 A;  1V84 A;  1WVC A;  1FR9 A;  5C4D A;  5I1F A;  4KC1 A;  2JCJ A;  3K8E A;  2V0H A;  3PKP A;  4Y7F A;  1VGT A;  2X5S A;  2UX8 A;  1ZCT A;  1ZCV A;  1MP3 A;  4FQW A;  1O23 B;  2D7I A;  2PA4 A;  2I5K A;  4Y6U A;  1VGU A;  3I0D A;  4EEO A;  4BMA A;  3ST8 A;  3F1Y A;  4HG6 A;  1GQ9 A;  1H5T B;  2YQJ A;  5L6S A;  2XWL A;  3V0P A;  5C47 A;  1LZI A;  4YS8 A;  4M28 A;  2YQS A;  5CMJ A;  1NMM B;  2Y6P A;  3I0H A;  1VPA A;  2RJ9 A;  2V0L A;  1H7G A;  1H3M A;  1NHE B;  2D7R A;  4B4M A;  1PZT A;  1IIN A;  4EE3 A;  5C8R A;  4G87 A;  2YC3 A;  1INJ A;  5CMH A;  2WVK A;  1V83 A;  3OGZ A;  1YP3 A;  4L41 C;  1ZDG A;  1JV3 A;  1O0R A;  2VS3 A;  3OAM A;  5C1L A;  5C49 A;  3IOI A;  5CQN X;  1R80 A;  2QKX A;  3U0X A;  1GWV A;  1OQM B;  3U2U A;  1GX0 A;  1H5S C;  1FG5 N;  3R2W A;  3USQ A;  3V91 A;  4CJC A;  3V0O A;  1FXO A;  2P6W A;  3ZGG A;  4KT7 A;  3ZGF A;  3LW6 A;  3DJ4 A;  5CMF X;  2FY7 A;  1G95 A;  2O1H A;  1NKH B;  4HO9 A;  4KQL A;  3DUV A;  5C38 A;  4M4K A;  3V0M A;  1YRO B;  1YP2 A;  2OI6 A;  2Y7A A;  3D8V A;  4CJB A;  2FYA A;  4EEM A;  4G3S A;  2XME A;  3I0E A;  1LL3 A;  4DE7 A;  1LL0 A;  1MP4 A;  4FRH A;  5FV9 A;  1FRW A;  3T7M A;  2YES A;  1JVD A;  4FRE A;  4B4G A;  5C4C A;  1H5R A;  4D0Z A;  1ZIZ A;  3NGW A;  1E5K A;  2FYC B;  2VXM A;  3IOH A;  1SS9 A;  1W55 A;  3Q4S A;  4P02 A;  3E25 A;  1YP4 A;  1H5S B;  2OEG A;  1HM9 A;  2BO7 A;  1OMZ A;  1ZDF A;  4KC4 A;  3U2X A;  4HO2 A;  2A8W A;  2VSH A;  4Y7V A;  1VH3 A;  1G1L A;  3U2V A;  2V0K A;  2FYB A;  5C4B A;  2XWN A;  1ZI4 A;  1ZJ1 A;  4HOC A;  2CU2 A;  4B2X A;  1ON8 A;  4M2B A;  3R3I A;  4FRO A;  1FGX A;  5EJZ A;  5IFY A;  1S4O A;  4Y64 A;  1VGZ A;  2E3D A;  4AYL A;  1K4V A;  4B42 A;  5CMI A;  3T7N A;  3I0K A;  3IOJ A;  3OC9 A;  4LW6 A;  2VS5 A;  5FU0 A;  1H7L A;  2VS4 A;  3SXA A;  4FRM A;  2YC5 A;  2WVM A;  1G97 A;  2WAW A;  1R7T A;  2QH5 A;  5AJP A;  4KPZ A;  4ZDQ A;  1FOA A;  4P00 A;  1NWG B;  5FYE A;  2P73 A;  4KNX A;  1W57 A;  1ZJ3 A;  2ZU8 A;  3QVB A;  4GBP A;  2X5Z A;  4IRP A;  3ZLK A;  1GWW A;  4HO8 A;  1H4E A;  3D5N A;  3POL A;  1FR8 A;  4Y9X A;  1R81 A;  4NAI A;  5CQL X;  4EE4 A;  1QGQ A;  1ZJ0 A;  2W0V A;  3OH2 A;  2O1F A;  5DDT A;  3U2W A;  3USR A;  1ZI3 A;  1G2V A;  3RMW A;  1FGG A;  1QG8 A;  2XMH A;  5C36 A;  4AYJ A;  1H7E A;  2AM5 A;  4BQH A;  3CKJ A;  4HO3 A;  5FTS A;  2W0W A;  3SX3 A;  3JTJ A;  3JUK A;  5IDS A;  1HM8 A;  4G3P A;  3Q7U A;  4NAN A;  4HO5 A;  1G3L A;  1R7U A;  5CQO A;  3PNN A;  1LZ0 A;  1ZCY A;  4KC2 A;  1FO9 A;  2MZB A;  1HJL A;  4Y7T A;  1VZX A;  4KPX A;  1NF5 B;  2YQH A;  1GA8 A;  4HCQ A;  1VGW A;  1XZ6 A;  2JCO A;  2JCL A;  4KNR A;  4D0T A;  4C2S A;  4HO4 A;  1IIM A;  2P72 A;  3I0L A;  4MYB A;  1R7Y A;  1VM8 A;  2ZU9 A;  3PKQ A;  3D98 A;  1FZW A;  3V0N A;  5CQM X;  2WVL A;  1VZT A;  2XWM A;  4CVH A;  2ICY A;  4B5B A; 
#chains in the Genus database with same CATH topology
 4K6R A;  4XWI A;  3RSB A;  5C3B A;  3SXG A;  2RJ5 A;  5AJN A;  1OMX A;  5CQP A;  1O7Q A;  4JD0 A;  4FRQ A;  2BO6 A;  2FFU A;  1EZI A;  2RJ6 A;  3Q80 A;  5CMG X;  1FWY A;  2GGO A;  2APC A;  2D0J A;  4E1K A;  2YCM A;  3DK5 A;  2A8U A;  1HM0 A;  3ZF8 A;  4M2A A;  4FRB A;  1G8O A;  3TQD A;  2AGD A;  3V90 A;  3V0Q A;  3CKQ A;  5AJO A;  4B2W A;  1KWS A;  4JIS A;  1TZF A;  1I52 A;  3SXE A;  4DDZ A;  4FRP A;  1ZCU A;  4KXO A;  1JVG A;  4IRQ A;  5D92 A;  5BXC A;  2AM4 A;  3I0C A;  4FIX A;  2Y4J A;  2RJ8 A;  2QGI A;  2WEE A;  2I5E A;  2AH9 A;  4Y7G A;  1MC3 A;  3N9W A;  1R7V A;  3OH4 A;  4ECM A;  1G93 A;  1G9R A;  4R7P A;  4B4B A;  1S4P A;  1H5S D;  1V82 A;  3OKR A;  5JQQ A;  2X60 A;  2AES A;  2Q4J A;  3OH3 A;  4HO6 A;  3O3P A;  4EVW A;  1R82 A;  3SXB A;  3I0G A;  3V0L A;  4AC3 A;  3SPT A;  2AE7 A;  3FOQ A;  2J0B A;  1H7H A;  4MND A;  1TW5 A;  3RMV A;  2Z87 A;  1XHB A;  2WGZ A;  4FCU A;  1LL2 A;  2V0J A;  4NAL A;  3U2T A;  1ZI1 A;  1EYR A;  3FWW A;  4D11 A;  4UEG A;  1GX4 A;  1H7F A;  1ZHJ A;  1ZJO A;  2JCK A;  1JYK A;  3V8Z A;  4ARW A;  1ZJP A;  4KRV A;  3F1C A;  1TW1 A;  1H5S A;  5C3D A;  2OI5 A;  4Y63 A;  4O6N A;  5C1H A;  3I0I X;  1FO8 A;  1INI A;  2RIZ A;  1LZ7 A;  1LZJ A;  4D48 A;  2X65 A;  2RJ1 A;  2AEC A;  3HL3 A;  2VFZ A;  4FRL A;  3E26 A;  5IDT A;  1QGS A;  4Y6N A;  4ASJ A;  4CJ8 A;  3K8D A;  3JUJ A;  4EEG A;  3V8Y A;  1ZJ2 A;  2PGY A;  3CKN A;  1NQI B;  1G0R A;  1H4D A;  3CU0 A;  5C3A A;  1Z90 A;  2ICX A;  5EJ1 A;  2Y4L A;  5C4F A;  2NXV A;  1H5R B;  2BO8 A;  2RJ4 A;  3SXD A;  5FU8 A;  2GGQ A;  3T7O A;  3CKO A;  2YQC A;  1WSZ A;  1W77 A;  4Y7U A;  4LW3 A;  3EE5 A;  2AM3 A;  2O1G A;  5C48 A;  1ZI5 A;  1LVW A;  4D11 C;  3SX7 A;  3TZT A;  1H5T A;  1PZY B;  2RIY A;  2RIX A;  3CKV A;  4NAK A;  3BCV A;  2OI7 A;  2I7B A;  3I0J A;  2DPW A;  4DEC A;  4Y62 A;  3OH1 A;  5C4E A;  3CGX A;  2Y4K A;  3I0F A;  1WT1 A;  1WT2 A;  4FRA A;  1JYL A;  3SXC A;  2FFV A;  1VH1 A;  1O7O A;  1VIC A;  1H7Q A;  4B3U A;  4AAW A;  2Z86 A;  3GUE A;  1FXJ A;  2BO4 A;  2V0I A;  2RJ7 A;  1S4N A;  1JV1 A;  4G3Q A;  5EIY A;  1TVY A;  2VXL A;  4EE5 A;  1GQC A;  1H4C A;  5L6V A;  1HV9 A;  4HO0 A;  2RIT A;  2VSI A;  1HJJ A;  3ZLL A;  2ZU7 A;  4FRD A;  3SX8 A;  1G23 A;  1WT0 A;  1QWJ A;  1ON6 A;  2WE9 A;  1WT3 A;  4ASY A;  5HS2 A;  2OEF A;  5DDV A;  2E8B A;  3KIA A;  2RJ0 A;  5C1G A;  2PGV A;  3SX5 A;  3U0Y A;  5FTV A;  1MP5 A;  2Y4M A;  4EEA A;  4FCE A;  1H7T A;  2FYD B;  1R7X A;  2PX7 A;  5FUH A;  1VZU A;  3BRK X;  4J18 A;  5J49 A;  3OH0 A;  2VD4 A;  1V84 A;  1WVC A;  1FR9 A;  5C4D A;  5I1F A;  4KC1 A;  2JCJ A;  3K8E A;  2V0H A;  3PKP A;  4Y7F A;  1VGT A;  2X5S A;  2UX8 A;  1ZCT A;  1ZCV A;  1MP3 A;  4FQW A;  1O23 B;  2D7I A;  2PA4 A;  2I5K A;  4Y6U A;  1VGU A;  3I0D A;  4EEO A;  4BMA A;  3ST8 A;  3F1Y A;  4HG6 A;  1GQ9 A;  1H5T B;  2YQJ A;  5L6S A;  2C0N A;  2XWL A;  2VK9 A;  3V0P A;  5C47 A;  1LZI A;  4YS8 A;  4M28 A;  2YQS A;  5CMJ A;  1NMM B;  2Y6P A;  3I0H A;  1VPA A;  2RJ9 A;  2V0L A;  1H7G A;  1H3M A;  1NHE B;  2D7R A;  4B4M A;  1PZT A;  1IIN A;  4EE3 A;  5C8R A;  4G87 A;  2YC3 A;  1INJ A;  5CMH A;  2WVK A;  1V83 A;  3OGZ A;  1YP3 A;  4L41 C;  1ZDG A;  1JV3 A;  1O0R A;  2VS3 A;  3OAM A;  5C1L A;  5C49 A;  3IOI A;  5CQN X;  1R80 A;  2QKX A;  3U0X A;  1GWV A;  1OQM B;  3U2U A;  1GX0 A;  1H5S C;  1FG5 N;  3R2W A;  3USQ A;  3V91 A;  4CJC A;  3V0O A;  1FXO A;  2P6W A;  3ZGG A;  4KT7 A;  3ZGF A;  3LW6 A;  3DJ4 A;  5CMF X;  2FY7 A;  1G95 A;  2O1H A;  1NKH B;  4HO9 A;  4KQL A;  3DUV A;  5C38 A;  4M4K A;  3V0M A;  1YRO B;  2J0A A;  1YP2 A;  2OI6 A;  2Y7A A;  3D8V A;  4CJB A;  2FYA A;  4EEM A;  4G3S A;  2XME A;  3I0E A;  1LL3 A;  4DE7 A;  1LL0 A;  1MP4 A;  4FRH A;  5FV9 A;  4MIX A;  1FRW A;  3T7M A;  2YES A;  1JVD A;  4FRE A;  4B4G A;  5C4C A;  1H5R A;  4D0Z A;  1ZIZ A;  3NGW A;  1E5K A;  2FYC B;  2VXM A;  3IOH A;  1SS9 A;  1W55 A;  3Q4S A;  4P02 A;  3E25 A;  1YP4 A;  1H5S B;  2OEG A;  1HM9 A;  2BO7 A;  4Q7C A;  1OMZ A;  1ZDF A;  4KC4 A;  3U2X A;  4HO2 A;  2A8W A;  2VSH A;  4Y7V A;  1VH3 A;  1G1L A;  3U2V A;  2V0K A;  4O6M A;  2FYB A;  5C4B A;  2XWN A;  1ZI4 A;  1ZJ1 A;  4HOC A;  2CU2 A;  4B2X A;  1ON8 A;  4M2B A;  3R3I A;  4FRO A;  1FGX A;  5EJZ A;  5IFY A;  1S4O A;  4Y64 A;  1VGZ A;  2E3D A;  4AYL A;  1K4V A;  4B42 A;  5CMI A;  3T7N A;  3I0K A;  3IOJ A;  3OC9 A;  4LW6 A;  2VS5 A;  5FU0 A;  1H7L A;  2VS4 A;  3SXA A;  4FRM A;  2YC5 A;  2WVM A;  1G97 A;  2WAW A;  1R7T A;  5D91 A;  2QH5 A;  5AJP A;  4KPZ A;  4ZDQ A;  1FOA A;  4FIY A;  4P00 A;  1NWG B;  5FYE A;  2P73 A;  4KNX A;  1W57 A;  1ZJ3 A;  2ZU8 A;  3QVB A;  4GBP A;  2X5Z A;  4IRP A;  3ZLK A;  1GWW A;  4HO8 A;  1H4E A;  3D5N A;  3POL A;  1FR8 A;  4Y9X A;  1R81 A;  4NAI A;  5CQL X;  4EE4 A;  1QGQ A;  1ZJ0 A;  2W0V A;  3OH2 A;  2O1F A;  5DDT A;  3U2W A;  3USR A;  1ZI3 A;  1G2V A;  3RMW A;  1FGG A;  1QG8 A;  2XMH A;  5C36 A;  4AYJ A;  1H7E A;  2AM5 A;  4BQH A;  3CKJ A;  4HO3 A;  5FTS A;  2W0W A;  3SX3 A;  3JTJ A;  3JUK A;  5IDS A;  1HM8 A;  4G3P A;  3Q7U A;  4NAN A;  4HO5 A;  1G3L A;  1R7U A;  5CQO A;  3PNN A;  1LZ0 A;  1ZCY A;  4KC2 A;  1FO9 A;  2MZB A;  1HJL A;  4Y7T A;  1VZX A;  4KPX A;  1NF5 B;  2YQH A;  1GA8 A;  4HCQ A;  1VGW A;  1XZ6 A;  2JCO A;  2JCL A;  4KNR A;  4D0T A;  4C2S A;  4HO4 A;  1IIM A;  2P72 A;  3I0L A;  4MYB A;  1R7Y A;  1VM8 A;  2ZU9 A;  3PKQ A;  3D98 A;  1FZW A;  3V0N A;  5CQM X;  2WVL A;  1VZT A;  2XWM A;  4CVH A;  2ICY A;  4B5B A; 
#chains in the Genus database with same CATH homology
 4K6R A;  4XWI A;  3RSB A;  5C3B A;  3SXG A;  2RJ5 A;  5AJN A;  1OMX A;  5CQP A;  1O7Q A;  4JD0 A;  4FRQ A;  2BO6 A;  2FFU A;  1EZI A;  2RJ6 A;  3Q80 A;  5CMG X;  1FWY A;  2GGO A;  2APC A;  2D0J A;  4E1K A;  2YCM A;  3DK5 A;  2A8U A;  1HM0 A;  3ZF8 A;  4M2A A;  4FRB A;  1G8O A;  3TQD A;  2AGD A;  3V90 A;  3V0Q A;  3CKQ A;  5AJO A;  4B2W A;  1KWS A;  4JIS A;  1TZF A;  1I52 A;  3SXE A;  4DDZ A;  4FRP A;  1ZCU A;  4KXO A;  1JVG A;  4IRQ A;  5D92 A;  5BXC A;  2AM4 A;  3I0C A;  4FIX A;  2Y4J A;  2RJ8 A;  2QGI A;  2WEE A;  2I5E A;  2AH9 A;  4Y7G A;  1MC3 A;  3N9W A;  1R7V A;  3OH4 A;  4ECM A;  1G93 A;  1G9R A;  4R7P A;  4B4B A;  1S4P A;  1H5S D;  1V82 A;  3OKR A;  5JQQ A;  2X60 A;  2AES A;  2Q4J A;  3OH3 A;  4HO6 A;  3O3P A;  4EVW A;  1R82 A;  3SXB A;  3I0G A;  3V0L A;  4AC3 A;  3SPT A;  2AE7 A;  3FOQ A;  2J0B A;  1H7H A;  4MND A;  1TW5 A;  3RMV A;  2Z87 A;  1XHB A;  2WGZ A;  4FCU A;  1LL2 A;  2V0J A;  4NAL A;  3U2T A;  1ZI1 A;  1EYR A;  3FWW A;  4D11 A;  4UEG A;  1GX4 A;  1H7F A;  1ZHJ A;  1ZJO A;  2JCK A;  1JYK A;  3V8Z A;  4ARW A;  1ZJP A;  4KRV A;  3F1C A;  1TW1 A;  1H5S A;  5C3D A;  2OI5 A;  4Y63 A;  4O6N A;  5C1H A;  3I0I X;  1FO8 A;  1INI A;  2RIZ A;  1LZ7 A;  1LZJ A;  4D48 A;  2X65 A;  2RJ1 A;  2AEC A;  3HL3 A;  2VFZ A;  4FRL A;  3E26 A;  5IDT A;  1QGS A;  4Y6N A;  4ASJ A;  4CJ8 A;  3K8D A;  3JUJ A;  4EEG A;  3V8Y A;  1ZJ2 A;  2PGY A;  3CKN A;  1NQI B;  1G0R A;  1H4D A;  3CU0 A;  5C3A A;  1Z90 A;  2ICX A;  5EJ1 A;  2Y4L A;  5C4F A;  2NXV A;  1H5R B;  2BO8 A;  2RJ4 A;  3SXD A;  5FU8 A;  2GGQ A;  3T7O A;  3CKO A;  2YQC A;  1WSZ A;  1W77 A;  4Y7U A;  4LW3 A;  3EE5 A;  2AM3 A;  2O1G A;  5C48 A;  1ZI5 A;  1LVW A;  4D11 C;  3SX7 A;  3TZT A;  1H5T A;  1PZY B;  2RIY A;  2RIX A;  3CKV A;  4NAK A;  3BCV A;  2OI7 A;  2I7B A;  3I0J A;  2DPW A;  4DEC A;  4Y62 A;  3OH1 A;  5C4E A;  3CGX A;  2Y4K A;  3I0F A;  1WT1 A;  1WT2 A;  4FRA A;  1JYL A;  3SXC A;  2FFV A;  1VH1 A;  1O7O A;  1VIC A;  1H7Q A;  4B3U A;  4AAW A;  2Z86 A;  3GUE A;  1FXJ A;  2BO4 A;  2V0I A;  2RJ7 A;  1S4N A;  1JV1 A;  4G3Q A;  5EIY A;  1TVY A;  2VXL A;  4EE5 A;  1GQC A;  1H4C A;  5L6V A;  1HV9 A;  4HO0 A;  2RIT A;  2VSI A;  1HJJ A;  3ZLL A;  2ZU7 A;  4FRD A;  3SX8 A;  1G23 A;  1WT0 A;  1QWJ A;  1ON6 A;  2WE9 A;  1WT3 A;  4ASY A;  5HS2 A;  2OEF A;  5DDV A;  2E8B A;  3KIA A;  2RJ0 A;  5C1G A;  2PGV A;  3SX5 A;  3U0Y A;  5FTV A;  1MP5 A;  2Y4M A;  4EEA A;  4FCE A;  1H7T A;  2FYD B;  1R7X A;  2PX7 A;  5FUH A;  1VZU A;  3BRK X;  4J18 A;  5J49 A;  3OH0 A;  2VD4 A;  1V84 A;  1WVC A;  1FR9 A;  5C4D A;  5I1F A;  4KC1 A;  2JCJ A;  3K8E A;  2V0H A;  3PKP A;  4Y7F A;  1VGT A;  2X5S A;  2UX8 A;  1ZCT A;  1ZCV A;  1MP3 A;  4FQW A;  1O23 B;  2D7I A;  2PA4 A;  2I5K A;  4Y6U A;  1VGU A;  3I0D A;  4EEO A;  4BMA A;  3ST8 A;  3F1Y A;  4HG6 A;  1GQ9 A;  1H5T B;  2YQJ A;  5L6S A;  2C0N A;  2XWL A;  2VK9 A;  3V0P A;  5C47 A;  1LZI A;  4YS8 A;  4M28 A;  2YQS A;  5CMJ A;  1NMM B;  2Y6P A;  3I0H A;  1VPA A;  2RJ9 A;  2V0L A;  1H7G A;  1H3M A;  1NHE B;  2D7R A;  4B4M A;  1PZT A;  1IIN A;  4EE3 A;  5C8R A;  4G87 A;  2YC3 A;  1INJ A;  5CMH A;  2WVK A;  1V83 A;  3OGZ A;  1YP3 A;  4L41 C;  1ZDG A;  1JV3 A;  1O0R A;  2VS3 A;  3OAM A;  5C1L A;  5C49 A;  3IOI A;  5CQN X;  1R80 A;  2QKX A;  3U0X A;  1GWV A;  1OQM B;  3U2U A;  1GX0 A;  1H5S C;  1FG5 N;  3R2W A;  3USQ A;  3V91 A;  4CJC A;  3V0O A;  1FXO A;  2P6W A;  3ZGG A;  4KT7 A;  3ZGF A;  3LW6 A;  3DJ4 A;  5CMF X;  2FY7 A;  1G95 A;  2O1H A;  1NKH B;  4HO9 A;  4KQL A;  3DUV A;  5C38 A;  4M4K A;  3V0M A;  1YRO B;  2J0A A;  1YP2 A;  2OI6 A;  2Y7A A;  3D8V A;  4CJB A;  2FYA A;  4EEM A;  4G3S A;  2XME A;  3I0E A;  1LL3 A;  4DE7 A;  1LL0 A;  1MP4 A;  4FRH A;  5FV9 A;  4MIX A;  1FRW A;  3T7M A;  2YES A;  1JVD A;  4FRE A;  4B4G A;  5C4C A;  1H5R A;  4D0Z A;  1ZIZ A;  3NGW A;  1E5K A;  2FYC B;  2VXM A;  3IOH A;  1SS9 A;  1W55 A;  3Q4S A;  4P02 A;  3E25 A;  1YP4 A;  1H5S B;  2OEG A;  1HM9 A;  2BO7 A;  4Q7C A;  1OMZ A;  1ZDF A;  4KC4 A;  3U2X A;  4HO2 A;  2A8W A;  2VSH A;  4Y7V A;  1VH3 A;  1G1L A;  3U2V A;  2V0K A;  4O6M A;  2FYB A;  5C4B A;  2XWN A;  1ZI4 A;  1ZJ1 A;  4HOC A;  2CU2 A;  4B2X A;  1ON8 A;  4M2B A;  3R3I A;  4FRO A;  1FGX A;  5EJZ A;  5IFY A;  1S4O A;  4Y64 A;  1VGZ A;  2E3D A;  4AYL A;  1K4V A;  4B42 A;  5CMI A;  3T7N A;  3I0K A;  3IOJ A;  3OC9 A;  4LW6 A;  2VS5 A;  5FU0 A;  1H7L A;  2VS4 A;  3SXA A;  4FRM A;  2YC5 A;  2WVM A;  1G97 A;  2WAW A;  1R7T A;  5D91 A;  2QH5 A;  5AJP A;  4KPZ A;  4ZDQ A;  1FOA A;  4FIY A;  4P00 A;  1NWG B;  5FYE A;  2P73 A;  4KNX A;  1W57 A;  1ZJ3 A;  2ZU8 A;  3QVB A;  4GBP A;  2X5Z A;  4IRP A;  3ZLK A;  1GWW A;  4HO8 A;  1H4E A;  3D5N A;  3POL A;  1FR8 A;  4Y9X A;  1R81 A;  4NAI A;  5CQL X;  4EE4 A;  1QGQ A;  1ZJ0 A;  2W0V A;  3OH2 A;  2O1F A;  5DDT A;  3U2W A;  3USR A;  1ZI3 A;  1G2V A;  3RMW A;  1FGG A;  1QG8 A;  2XMH A;  5C36 A;  4AYJ A;  1H7E A;  2AM5 A;  4BQH A;  3CKJ A;  4HO3 A;  5FTS A;  2W0W A;  3SX3 A;  3JTJ A;  3JUK A;  5IDS A;  1HM8 A;  4G3P A;  3Q7U A;  4NAN A;  4HO5 A;  1G3L A;  1R7U A;  5CQO A;  3PNN A;  1LZ0 A;  1ZCY A;  4KC2 A;  1FO9 A;  2MZB A;  1HJL A;  4Y7T A;  1VZX A;  4KPX A;  1NF5 B;  2YQH A;  1GA8 A;  4HCQ A;  1VGW A;  1XZ6 A;  2JCO A;  2JCL A;  4KNR A;  4D0T A;  4C2S A;  4HO4 A;  1IIM A;  2P72 A;  3I0L A;  4MYB A;  1R7Y A;  1VM8 A;  2ZU9 A;  3PKQ A;  3D98 A;  1FZW A;  3V0N A;  5CQM X;  2WVL A;  1VZT A;  2XWM A;  4CVH A;  2ICY A;  4B5B A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...