1QWJA

The crystal structure of murine cmp-5-n-acetylneuraminic acid synthetase
Total Genus 65
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
65
sequence length
228
structure length
228
Chain Sequence
PPHLAALVLARGGSKGIPLKNIKRLAGVPLIGWVLRAALDAGVFQSVWVSTDHDEIENVAKQFGAQVHRRSSETSKDSSTSLDAIVEFLNYHNEVDIVGNIQATSPCLHPTDLQKVAEMIREEGYDSVFSVVRRHQFRWSEIQKGVREVTEPLNLNPAKRPRRQDWDGELYENGSFYFAKRHLIEMGYLQGGKMAYYEMRAEHSVDIDVDIDWPIAEQRVLRFGYFGK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords cytidine monophospho-N-acetylneuraminic acid synthetase
publication title The Crystal Structure of Murine CMP-5-N-acetylneuraminic Acid Synthetase
pubmed doi rcsb
source organism Mus musculus
total genus 65
structure length 228
sequence length 228
chains with identical sequence B, C, D
ec nomenclature ec 2.7.7.43: N-acylneuraminate cytidylyltransferase.
pdb deposition date 2003-09-02
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.550.10 Alpha Beta Alpha-Beta Complex Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A 1qwjA00
1IINA 1NMMB 1MC3A 2XWMA 1FOAA 1VZUA 3R2WA 3IOHA 3RSBA 5HS2A 2YESA 3OH3A 2YC5A 3V0MA 4FRDA 4NANA 1E5KA 2OEGA 4HCQA 4HO5A 2RJ8A 3JUJA 2VD4A 2AECA 1VICA 3EE5A 1ZCVA 1INIA 1H4DA 4CJBA 2WVLA 3I0JA 5FTSA 3SXCA 4E1KA 4AC3A 4L41C 1MP4A 4JISA 4K6RA 3SXGA 1H5TB 2FYDB 2I5EA 3IOIA 1O23B 3LW6A 4GBPA 2PGYA 1ZJ3A 1GWVA 2D7IA 1FXOA 1QG8A 4KT7A 2O1GA 1LL3A 3OH0A 5AJPA 2RIYA 3ST8A 4AYLA 4ARWA 3TQDA 3F1CA 1FO9A 3CKJA 4G3QA 2YQHA 5C1GA 3CKQA 2ZU8A 2WVKA 5JQQA 2GGOA 2Y4MA 4MNDA 3RMVA 2MZBA 4FRPA 2CU2A 2Y4JA 3USRA 2AM5A 1VZXA 4M4KA 5CQMX 4D11A 4FRMA 3OC9A 3K8DA 3D5NA 3V0NA 3JTJA 3V0OA 5C3DA 3SXBA 1G2VA 1V83A 4HO6A 4G3PA 1G3LA 3CKVA 3V0LA 3ZLKA 3I0DA 2P6WA 4NALA 1R82A 4KNRA 2FYAA 2V0LA 2Y4KA 5C4DA 3BRKX 3I0KA 5CMFX 3KIAA 1O7QA 1WSZA 3D8VA 4EE5A 1LL0A 5J49A 1S4PA 4D11C 1WVCA 1H5TA 1OMXA 3ZF8A 1O0RA 2ZU7A 4ASJA 1MP3A 2PGVA 1JVGA 1H7TA 1G93A 3U2UA 1VGZA 5CQPA 4EVWA 4CJCA 4D0TA 4FROA 2FY7A 2Q4JA 3POLA 4FREA 5C36A 1JYLA 5L6SA 1G8OA 4CJ8A 5IDSA 1H5SB 2NXVA 4FRHA 2FFVA 2ICXA 1NQIB 1EZIA 3FWWA 4FRAA 5CMGX 1ZJ0A 4MYBA 2YQSA 2AM4A 3U0XA 1ZCTA 2VS5A 3D98A 1GWWA 2XWNA 2Y7AA 4XWIA 2OI7A 1ZJOA 2RIZA 2UX8A 4DECA 1GX4A 1PZYB 2D0JA 3SXDA 3V8YA 1ON8A 2DPWA 4FRLA 5C4FA 4EE3A 4C2SA 1H7FA 4IRPA 3Q4SA 1H5RB 5FUHA 4Y62A 5C1LA 1MP5A 5AJOA 5FYEA 2JCLA 3V91A 4JD0A 2VFZA 1ZJ2A 4KC4A 4EEGA 4B4GA 3CU0A 2FFUA 1ZI3A 5EJZA 3F1YA 1HM9A 4HO0A 3U0YA 3JUKA 3TZTA 4HO9A 4BQHA 3V90A 5IFYA 1W55A 1TZFA 1H5SA 1WT2A 2X60A 4ZDQA 2PX7A 5C1HA 1ZI1A 4KNXA 4UEGA 2VS3A 3V0PA 3OH1A 4M2AA 1G0RA 1W77A 2VXMA 4KC1A 1HM0A 1NHEB 2O1FA 2YQJA 1ZDFA 1FGXA 3T7NA 1O7OA 3RMWA 3V0QA 3I0IX 1FR9A 1FXJA 4HO4A 2X5SA 3OH4A 4P00A 1H5SC 2WEEA 3V8ZA 3U2VA 3OGZA 1FR8A 1R7TA 1VM8A 1LZJA 2V0JA 2AESA 1R80A 5L6VA 1VGUA 2Z86A 1QGQA 2FYBA 1S4OA 5C38A 1H5RA 5FTVA 1KWSA 2WE9A 3E25A 2I7BA 2YCMA 3GUEA 1YP4A 1R7YA 5CMIA 1ON6A 4D48A 2X65A 3CKOA 2FYCB 4NAKA 1R81A 4KXOA 4Y9XA 2W0VA 4KC2A 3ZGFA 3R3IA 2XMHA 4EEAA 4BMAA 1G23A 2E3DA 1R7XA 2WGZA 5C4EA 2BO7A 2RJ4A 4HG6A 4DDZA 1G9RA 1H5SD 3OAMA 2RJ1A 3USQA 2A8WA 5DDVA 2AH9A 2XMEA 1TW5A 1LVWA 2RJ9A 3U2WA 4B4MA 2VS4A 1G97A 1HJJA 4FRBA 5FU0A 3SXAA 2AM3A 4B4BA 5BXCA 1TVYA 1K4VA 1H7QA 5C8RA 1WT1A 1H7GA 1PZTA 1JV3A 2E8BA 1JV1A 3U2XA 3K8EA 3BCVA 3DUVA 1W57A 1OQMB 1ZIZA 5C48A 2RJ5A 4B2XA 4Y64A 2I5KA 2BO8A 1HJLA 5DDTA 1FWYA 2OEFA 5AJNA 2V0HA 3T7MA 1HM8A 2Z87A 2RJ0A 4KPZA 1LL2A 4LW3A 1Z90A 2XWLA 2VSHA 4J18A 5CQOA 5EJ1A 1TW1A 1G95A 1VGWA 1I52A 2YQCA 1H7EA 3QVBA 4FCEA 4G87A 1GQCA 1GX0A 5FV9A 4Y7UA 5EIYA 2QH5A 4M2BA 2BO6A 1IIMA 1R7UA 1LZ0A 1VH1A 3ZGGA 4EE4A 1WT3A 3PNNA 1H4CA 1LZIA 1ZCYA 4FCUA 3I0GA 4HOCA 1LZ7A 2QGIA 2WVMA 3T7OA 5CMJA 1HV9A 3O3PA 2RITA 3ZLLA 2RJ7A 3SX7A 4FQWA 1NKHB 1H7LA 1G1LA 3I0LA 3SPTA 2Y4LA 1FG5N 3Q80A 2A8UA 1FRWA 4AYJA 1NWGB 4B42A 1VPAA 3I0HA 4Y6UA 5CQNX 2O1HA 1R7VA 1EYRA 5CQLX 4B5BA 4B2WA 1ZHJA 3Q7UA 4B3UA 3OH2A 2AE7A 4YS8A 1ZJPA 4HO3A 4P02A 1QGSA 2V0IA 4KRVA 2W0WA 1FZWA 1YP2A 4ASYA 5C4BA 2GGQA 2Y6PA 5C3BA 5IDTA 1H4EA 2ZU9A 1V84A 1JVDA 1XZ6A 2ICYA 3E26A 4HO8A 4Y7GA 2X5ZA 3FOQA 4Y7TA 2RIXA 1VH3A 1YROB 2JCKA 4Y7FA 3U2TA 4D0ZA 2BO4A 3OKRA 4R7PA 2D7RA 3I0CA 2WAWA 3DJ4A 4IRQA 2AGDA 2P72A 2QKXA 2VSIA 1FGGA 2YC3A 1VZTA 2P73A 5FU8A 3I0FA 1WT0A 3IOJA 5I1FA 1INJA 4HO2A 1H3MA 2JCJA 3CKNA 4FRQA 1V82A 4EEOA 4DE7A 2JCOA 1ZDGA 1SS9A 3SX5A 5C49A 1GQ9A 4Y63A 5CMHA 4Y7VA 3PKQA 5C4CA 4NAIA 1ZI4A 1YP3A 1ZJ1A 2OI5A 3SXEA 1QWJA 4Y6NA 4G3SA 3SX8A 4EEMA 1FO8A 4LW6A 3NGWA 3SX3A 3CGXA 2V0KA 4ECMA 1OMZA 3PKPA 2VXLA 4KPXA 1H7HA 3I0EA 1ZI5A 4AAWA 1ZCUA 5C3AA 3N9WA 5C47A 4KQLA 1VGTA 1XHBA 4CVHA 1GA8A 1NF5B 2OI6A 3HL3A 2RJ6A 3DK5A 2APCA 2PA4A 1JYKA 4M28A 1S4NA
chains in the Genus database with same CATH superfamily
1IINA 1NMMB 1MC3A 2XWMA 1FOAA 1VZUA 3R2WA 3IOHA 3RSBA 5HS2A 2YESA 3OH3A 2YC5A 3V0MA 4FRDA 4NANA 1E5KA 2OEGA 4HCQA 4HO5A 2RJ8A 3JUJA 2VD4A 2AECA 1VICA 3EE5A 1ZCVA 1INIA 1H4DA 4CJBA 2WVLA 3I0JA 5FTSA 3SXCA 4E1KA 4AC3A 4L41C 1MP4A 4JISA 4K6RA 3SXGA 1H5TB 2FYDB 2I5EA 3IOIA 1O23B 3LW6A 4GBPA 2PGYA 1ZJ3A 1GWVA 2D7IA 1FXOA 1QG8A 4KT7A 2O1GA 1LL3A 3OH0A 5AJPA 2RIYA 3ST8A 4AYLA 4ARWA 3TQDA 3F1CA 1FO9A 3CKJA 4G3QA 2YQHA 5C1GA 3CKQA 2ZU8A 2WVKA 5JQQA 2GGOA 2Y4MA 4MNDA 3RMVA 2MZBA 4FRPA 2CU2A 2Y4JA 3USRA 2AM5A 1VZXA 4M4KA 5CQMX 4D11A 4FRMA 3OC9A 3K8DA 3D5NA 3V0NA 3JTJA 3V0OA 5C3DA 4Q7CA 3SXBA 1G2VA 1V83A 4HO6A 4G3PA 1G3LA 3CKVA 3V0LA 3ZLKA 3I0DA 2P6WA 4NALA 1R82A 4KNRA 2FYAA 2V0LA 2Y4KA 5C4DA 3BRKX 3I0KA 5CMFX 3KIAA 1O7QA 1WSZA 3D8VA 4EE5A 1LL0A 5J49A 1S4PA 4D11C 1WVCA 1H5TA 1OMXA 3ZF8A 1O0RA 2ZU7A 4ASJA 1MP3A 2PGVA 1JVGA 1H7TA 1G93A 3U2UA 1VGZA 5CQPA 4EVWA 4CJCA 4D0TA 4FROA 2FY7A 2Q4JA 3POLA 4FREA 5C36A 1JYLA 5L6SA 1G8OA 4CJ8A 5IDSA 1H5SB 2NXVA 4FRHA 2FFVA 2ICXA 1NQIB 1EZIA 3FWWA 4FRAA 5CMGX 1ZJ0A 4FIXA 2VK9A 4MYBA 2YQSA 2AM4A 3U0XA 1ZCTA 2VS5A 3D98A 1GWWA 2XWNA 2Y7AA 4XWIA 2OI7A 1ZJOA 2RIZA 2UX8A 4DECA 1GX4A 1PZYB 2D0JA 3SXDA 3V8YA 1ON8A 2DPWA 4FRLA 5C4FA 4EE3A 4C2SA 1H7FA 4IRPA 3Q4SA 1H5RB 5FUHA 4Y62A 5C1LA 1MP5A 5AJOA 5FYEA 2JCLA 3V91A 4JD0A 2VFZA 1ZJ2A 4KC4A 4EEGA 4B4GA 3CU0A 2FFUA 1ZI3A 5EJZA 3F1YA 1HM9A 4HO0A 3U0YA 3JUKA 3TZTA 4HO9A 4BQHA 3V90A 5IFYA 1W55A 1TZFA 1H5SA 1WT2A 2X60A 4ZDQA 2PX7A 4O6MA 5C1HA 1ZI1A 4KNXA 4UEGA 2VS3A 3V0PA 3OH1A 4M2AA 1G0RA 1W77A 2VXMA 4KC1A 1HM0A 1NHEB 2O1FA 2YQJA 1ZDFA 1FGXA 3T7NA 1O7OA 3RMWA 3V0QA 3I0IX 1FR9A 1FXJA 4HO4A 2X5SA 3OH4A 4P00A 1H5SC 2WEEA 3V8ZA 3U2VA 3OGZA 1FR8A 1R7TA 1VM8A 1LZJA 2V0JA 2AESA 1R80A 5L6VA 1VGUA 2Z86A 1QGQA 2FYBA 1S4OA 5C38A 1H5RA 5FTVA 1KWSA 2WE9A 3E25A 2I7BA 2YCMA 3GUEA 1YP4A 1R7YA 5CMIA 1ON6A 4D48A 2X65A 3CKOA 2FYCB 4NAKA 1R81A 4KXOA 4Y9XA 2W0VA 4KC2A 3ZGFA 3R3IA 2XMHA 4EEAA 4BMAA 1G23A 2E3DA 1R7XA 2WGZA 5C4EA 2BO7A 2RJ4A 4HG6A 4DDZA 1G9RA 1H5SD 3OAMA 2RJ1A 3USQA 2A8WA 5DDVA 2AH9A 2XMEA 1TW5A 1LVWA 2RJ9A 3U2WA 4B4MA 2VS4A 1G97A 1HJJA 4FRBA 5FU0A 3SXAA 2AM3A 4B4BA 5BXCA 1TVYA 1K4VA 1H7QA 5C8RA 1WT1A 1H7GA 1PZTA 1JV3A 2E8BA 1JV1A 3U2XA 3K8EA 3BCVA 3DUVA 1W57A 1OQMB 1ZIZA 5C48A 2RJ5A 4B2XA 4Y64A 2I5KA 2BO8A 1HJLA 5DDTA 1FWYA 2OEFA 5AJNA 2V0HA 4FIYA 3T7MA 1HM8A 2Z87A 2RJ0A 4KPZA 1LL2A 5D91A 2J0AA 4LW3A 1Z90A 2XWLA 2VSHA 4J18A 5CQOA 5EJ1A 1TW1A 1G95A 1VGWA 1I52A 2YQCA 1H7EA 3QVBA 4FCEA 4G87A 1GQCA 1GX0A 5FV9A 4Y7UA 5EIYA 2QH5A 4M2BA 2BO6A 1IIMA 1R7UA 1LZ0A 1VH1A 3ZGGA 4EE4A 1WT3A 3PNNA 1H4CA 1LZIA 1ZCYA 4FCUA 3I0GA 4HOCA 1LZ7A 2QGIA 2WVMA 3T7OA 5CMJA 1HV9A 3O3PA 2RITA 3ZLLA 2RJ7A 3SX7A 4FQWA 1NKHB 1H7LA 1G1LA 3I0LA 3SPTA 2Y4LA 1FG5N 2J0BA 3Q80A 2A8UA 1FRWA 4AYJA 1NWGB 4B42A 1VPAA 3I0HA 4Y6UA 5CQNX 2O1HA 1R7VA 1EYRA 5CQLX 4B5BA 4B2WA 1ZHJA 3Q7UA 4B3UA 3OH2A 2AE7A 4YS8A 1ZJPA 4HO3A 4P02A 1QGSA 2V0IA 4KRVA 2W0WA 1FZWA 1YP2A 4ASYA 5C4BA 4MIXA 2GGQA 2Y6PA 5C3BA 5IDTA 1H4EA 2ZU9A 1V84A 1JVDA 1XZ6A 2ICYA 3E26A 4HO8A 4Y7GA 2X5ZA 3FOQA 4Y7TA 2RIXA 1VH3A 1YROB 2JCKA 4Y7FA 3U2TA 4D0ZA 2BO4A 3OKRA 4R7PA 2D7RA 3I0CA 2WAWA 3DJ4A 4IRQA 2AGDA 2P72A 2QKXA 2VSIA 1FGGA 4O6NA 2YC3A 1VZTA 2P73A 5FU8A 3I0FA 1WT0A 3IOJA 5I1FA 1INJA 4HO2A 1H3MA 2JCJA 3CKNA 4FRQA 1V82A 4EEOA 4DE7A 2JCOA 1ZDGA 1SS9A 3SX5A 5C49A 1GQ9A 4Y63A 5CMHA 4Y7VA 3PKQA 5C4CA 4NAIA 1ZI4A 1YP3A 1ZJ1A 2OI5A 3SXEA 1QWJA 4Y6NA 4G3SA 3SX8A 2C0NA 4EEMA 1FO8A 4LW6A 3NGWA 3SX3A 3CGXA 2V0KA 4ECMA 1OMZA 3PKPA 2VXLA 4KPXA 1H7HA 3I0EA 1ZI5A 4AAWA 1ZCUA 5C3AA 3N9WA 5C47A 4KQLA 1VGTA 1XHBA 4CVHA 1GA8A 1NF5B 2OI6A 5D92A 3HL3A 2RJ6A 3DK5A 2APCA 2PA4A 1JYKA 4M28A 1S4NA
chains in the Genus database with same CATH topology
1IINA 1NMMB 1MC3A 2XWMA 1FOAA 1VZUA 3R2WA 3IOHA 3RSBA 5HS2A 2YESA 3OH3A 2YC5A 3V0MA 4FRDA 4NANA 1E5KA 2OEGA 4HCQA 4HO5A 2RJ8A 3JUJA 2VD4A 2AECA 1VICA 3EE5A 1ZCVA 1INIA 1H4DA 4CJBA 2WVLA 3I0JA 5FTSA 3SXCA 4E1KA 4AC3A 4L41C 1MP4A 4JISA 4K6RA 3SXGA 1H5TB 2FYDB 2I5EA 3IOIA 1O23B 3LW6A 4GBPA 2PGYA 1ZJ3A 1GWVA 2D7IA 1FXOA 1QG8A 4KT7A 2O1GA 1LL3A 3OH0A 5AJPA 2RIYA 3ST8A 4AYLA 4ARWA 3TQDA 3F1CA 1FO9A 3CKJA 4G3QA 2YQHA 5C1GA 3CKQA 2ZU8A 2WVKA 5JQQA 2GGOA 2Y4MA 4MNDA 3RMVA 2MZBA 4FRPA 2CU2A 2Y4JA 3USRA 2AM5A 1VZXA 4M4KA 5CQMX 4D11A 4FRMA 3OC9A 3K8DA 3D5NA 3V0NA 3JTJA 3V0OA 5C3DA 4Q7CA 3SXBA 1G2VA 1V83A 4HO6A 4G3PA 1G3LA 3CKVA 3V0LA 3ZLKA 3I0DA 2P6WA 4NALA 1R82A 4KNRA 2FYAA 2V0LA 2Y4KA 5C4DA 3BRKX 3I0KA 5CMFX 3KIAA 1O7QA 1WSZA 3D8VA 4EE5A 1LL0A 5J49A 1S4PA 4D11C 1WVCA 1H5TA 1OMXA 3ZF8A 1O0RA 2ZU7A 4ASJA 1MP3A 2PGVA 1JVGA 1H7TA 1G93A 3U2UA 1VGZA 5CQPA 4EVWA 4CJCA 4D0TA 4FROA 2FY7A 2Q4JA 3POLA 4FREA 5C36A 1JYLA 5L6SA 1G8OA 4CJ8A 5IDSA 1H5SB 2NXVA 4FRHA 2FFVA 2ICXA 1NQIB 1EZIA 3FWWA 4FRAA 5CMGX 1ZJ0A 4FIXA 2VK9A 4MYBA 2YQSA 2AM4A 3U0XA 1ZCTA 2VS5A 3D98A 1GWWA 2XWNA 2Y7AA 4XWIA 2OI7A 1ZJOA 2RIZA 2UX8A 4DECA 1GX4A 1PZYB 2D0JA 3SXDA 3V8YA 1ON8A 2DPWA 4FRLA 5C4FA 4EE3A 4C2SA 1H7FA 4IRPA 3Q4SA 1H5RB 5FUHA 4Y62A 5C1LA 1MP5A 5AJOA 5FYEA 2JCLA 3V91A 4JD0A 2VFZA 1ZJ2A 4KC4A 4EEGA 4B4GA 3CU0A 2FFUA 1ZI3A 5EJZA 3F1YA 1HM9A 4HO0A 3U0YA 3JUKA 3TZTA 4HO9A 4BQHA 3V90A 5IFYA 1W55A 1TZFA 1H5SA 1WT2A 2X60A 4ZDQA 2PX7A 4O6MA 5C1HA 1ZI1A 4KNXA 4UEGA 2VS3A 3V0PA 3OH1A 4M2AA 1G0RA 1W77A 2VXMA 4KC1A 1HM0A 1NHEB 2O1FA 2YQJA 1ZDFA 1FGXA 3T7NA 1O7OA 3RMWA 3V0QA 3I0IX 1FR9A 1FXJA 4HO4A 2X5SA 3OH4A 4P00A 1H5SC 2WEEA 3V8ZA 3U2VA 3OGZA 1FR8A 1R7TA 1VM8A 1LZJA 2V0JA 2AESA 1R80A 5L6VA 1VGUA 2Z86A 1QGQA 2FYBA 1S4OA 5C38A 1H5RA 5FTVA 1KWSA 2WE9A 3E25A 2I7BA 2YCMA 3GUEA 1YP4A 1R7YA 5CMIA 1ON6A 4D48A 2X65A 3CKOA 2FYCB 4NAKA 1R81A 4KXOA 4Y9XA 2W0VA 4KC2A 3ZGFA 3R3IA 2XMHA 4EEAA 4BMAA 1G23A 2E3DA 1R7XA 2WGZA 5C4EA 2BO7A 2RJ4A 4HG6A 4DDZA 1G9RA 1H5SD 3OAMA 2RJ1A 3USQA 2A8WA 5DDVA 2AH9A 2XMEA 1TW5A 1LVWA 2RJ9A 3U2WA 4B4MA 2VS4A 1G97A 1HJJA 4FRBA 5FU0A 3SXAA 2AM3A 4B4BA 5BXCA 1TVYA 1K4VA 1H7QA 5C8RA 1WT1A 1H7GA 1PZTA 1JV3A 2E8BA 1JV1A 3U2XA 3K8EA 3BCVA 3DUVA 1W57A 1OQMB 1ZIZA 5C48A 2RJ5A 4B2XA 4Y64A 2I5KA 2BO8A 1HJLA 5DDTA 1FWYA 2OEFA 5AJNA 2V0HA 4FIYA 3T7MA 1HM8A 2Z87A 2RJ0A 4KPZA 1LL2A 5D91A 2J0AA 4LW3A 1Z90A 2XWLA 2VSHA 4J18A 5CQOA 5EJ1A 1TW1A 1G95A 1VGWA 1I52A 2YQCA 1H7EA 3QVBA 4FCEA 4G87A 1GQCA 1GX0A 5FV9A 4Y7UA 5EIYA 2QH5A 4M2BA 2BO6A 1IIMA 1R7UA 1LZ0A 1VH1A 3ZGGA 4EE4A 1WT3A 3PNNA 1H4CA 1LZIA 1ZCYA 4FCUA 3I0GA 4HOCA 1LZ7A 2QGIA 2WVMA 3T7OA 5CMJA 1HV9A 3O3PA 2RITA 3ZLLA 2RJ7A 3SX7A 4FQWA 1NKHB 1H7LA 1G1LA 3I0LA 3SPTA 2Y4LA 1FG5N 2J0BA 3Q80A 2A8UA 1FRWA 4AYJA 1NWGB 4B42A 1VPAA 3I0HA 4Y6UA 5CQNX 2O1HA 1R7VA 1EYRA 5CQLX 4B5BA 4B2WA 1ZHJA 3Q7UA 4B3UA 3OH2A 2AE7A 4YS8A 1ZJPA 4HO3A 4P02A 1QGSA 2V0IA 4KRVA 2W0WA 1FZWA 1YP2A 4ASYA 5C4BA 4MIXA 2GGQA 2Y6PA 5C3BA 5IDTA 1H4EA 2ZU9A 1V84A 1JVDA 1XZ6A 2ICYA 3E26A 4HO8A 4Y7GA 2X5ZA 3FOQA 4Y7TA 2RIXA 1VH3A 1YROB 2JCKA 4Y7FA 3U2TA 4D0ZA 2BO4A 3OKRA 4R7PA 2D7RA 3I0CA 2WAWA 3DJ4A 4IRQA 2AGDA 2P72A 2QKXA 2VSIA 1FGGA 4O6NA 2YC3A 1VZTA 2P73A 5FU8A 3I0FA 1WT0A 3IOJA 5I1FA 1INJA 4HO2A 1H3MA 2JCJA 3CKNA 4FRQA 1V82A 4EEOA 4DE7A 2JCOA 1ZDGA 1SS9A 3SX5A 5C49A 1GQ9A 4Y63A 5CMHA 4Y7VA 3PKQA 5C4CA 4NAIA 1ZI4A 1YP3A 1ZJ1A 2OI5A 3SXEA 1QWJA 4Y6NA 4G3SA 3SX8A 2C0NA 4EEMA 1FO8A 4LW6A 3NGWA 3SX3A 3CGXA 2V0KA 4ECMA 1OMZA 3PKPA 2VXLA 4KPXA 1H7HA 3I0EA 1ZI5A 4AAWA 1ZCUA 5C3AA 3N9WA 5C47A 4KQLA 1VGTA 1XHBA 4CVHA 1GA8A 1NF5B 2OI6A 5D92A 3HL3A 2RJ6A 3DK5A 2APCA 2PA4A 1JYKA 4M28A 1S4NA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1IIN A;  1NMM B;  1MC3 A;  2XWM A;  1FOA A;  1VZU A;  3R2W A;  3IOH A;  3RSB A;  5HS2 A;  2YES A;  3OH3 A;  2YC5 A;  3V0M A;  4FRD A;  4NAN A;  1E5K A;  2OEG A;  4HCQ A;  4HO5 A;  2RJ8 A;  3JUJ A;  2VD4 A;  2AEC A;  1VIC A;  3EE5 A;  1ZCV A;  1INI A;  1H4D A;  4CJB A;  2WVL A;  3I0J A;  5FTS A;  3SXC A;  4E1K A;  4AC3 A;  4L41 C;  1MP4 A;  4JIS A;  4K6R A;  3SXG A;  1H5T B;  2FYD B;  2I5E A;  3IOI A;  1O23 B;  3LW6 A;  4GBP A;  2PGY A;  1ZJ3 A;  1GWV A;  2D7I A;  1FXO A;  1QG8 A;  4KT7 A;  2O1G A;  1LL3 A;  3OH0 A;  5AJP A;  2RIY A;  3ST8 A;  4AYL A;  4ARW A;  3TQD A;  3F1C A;  1FO9 A;  3CKJ A;  4G3Q A;  2YQH A;  5C1G A;  3CKQ A;  2ZU8 A;  2WVK A;  5JQQ A;  2GGO A;  2Y4M A;  4MND A;  3RMV A;  2MZB A;  4FRP A;  2CU2 A;  2Y4J A;  3USR A;  2AM5 A;  1VZX A;  4M4K A;  5CQM X;  4D11 A;  4FRM A;  3OC9 A;  3K8D A;  3D5N A;  3V0N A;  3JTJ A;  3V0O A;  5C3D A;  3SXB A;  1G2V A;  1V83 A;  4HO6 A;  4G3P A;  1G3L A;  3CKV A;  3V0L A;  3ZLK A;  3I0D A;  2P6W A;  4NAL A;  1R82 A;  4KNR A;  2FYA A;  2V0L A;  2Y4K A;  5C4D A;  3BRK X;  3I0K A;  5CMF X;  3KIA A;  1O7Q A;  1WSZ A;  3D8V A;  4EE5 A;  1LL0 A;  5J49 A;  1S4P A;  4D11 C;  1WVC A;  1H5T A;  1OMX A;  3ZF8 A;  1O0R A;  2ZU7 A;  4ASJ A;  1MP3 A;  2PGV A;  1JVG A;  1H7T A;  1G93 A;  3U2U A;  1VGZ A;  5CQP A;  4EVW A;  4CJC A;  4D0T A;  4FRO A;  2FY7 A;  2Q4J A;  3POL A;  4FRE A;  5C36 A;  1JYL A;  5L6S A;  1G8O A;  4CJ8 A;  5IDS A;  1H5S B;  2NXV A;  4FRH A;  2FFV A;  2ICX A;  1NQI B;  1EZI A;  3FWW A;  4FRA A;  5CMG X;  1ZJ0 A;  4MYB A;  2YQS A;  2AM4 A;  3U0X A;  1ZCT A;  2VS5 A;  3D98 A;  1GWW A;  2XWN A;  2Y7A A;  4XWI A;  2OI7 A;  1ZJO A;  2RIZ A;  2UX8 A;  4DEC A;  1GX4 A;  1PZY B;  2D0J A;  3SXD A;  3V8Y A;  1ON8 A;  2DPW A;  4FRL A;  5C4F A;  4EE3 A;  4C2S A;  1H7F A;  4IRP A;  3Q4S A;  1H5R B;  5FUH A;  4Y62 A;  5C1L A;  1MP5 A;  5AJO A;  5FYE A;  2JCL A;  3V91 A;  4JD0 A;  2VFZ A;  1ZJ2 A;  4KC4 A;  4EEG A;  4B4G A;  3CU0 A;  2FFU A;  1ZI3 A;  5EJZ A;  3F1Y A;  1HM9 A;  4HO0 A;  3U0Y A;  3JUK A;  3TZT A;  4HO9 A;  4BQH A;  3V90 A;  5IFY A;  1W55 A;  1TZF A;  1H5S A;  1WT2 A;  2X60 A;  4ZDQ A;  2PX7 A;  5C1H A;  1ZI1 A;  4KNX A;  4UEG A;  2VS3 A;  3V0P A;  3OH1 A;  4M2A A;  1G0R A;  1W77 A;  2VXM A;  4KC1 A;  1HM0 A;  1NHE B;  2O1F A;  2YQJ A;  1ZDF A;  1FGX A;  3T7N A;  1O7O A;  3RMW A;  3V0Q A;  3I0I X;  1FR9 A;  1FXJ A;  4HO4 A;  2X5S A;  3OH4 A;  4P00 A;  1H5S C;  2WEE A;  3V8Z A;  3U2V A;  3OGZ A;  1FR8 A;  1R7T A;  1VM8 A;  1LZJ A;  2V0J A;  2AES A;  1R80 A;  5L6V A;  1VGU A;  2Z86 A;  1QGQ A;  2FYB A;  1S4O A;  5C38 A;  1H5R A;  5FTV A;  1KWS A;  2WE9 A;  3E25 A;  2I7B A;  2YCM A;  3GUE A;  1YP4 A;  1R7Y A;  5CMI A;  1ON6 A;  4D48 A;  2X65 A;  3CKO A;  2FYC B;  4NAK A;  1R81 A;  4KXO A;  4Y9X A;  2W0V A;  4KC2 A;  3ZGF A;  3R3I A;  2XMH A;  4EEA A;  4BMA A;  1G23 A;  2E3D A;  1R7X A;  2WGZ A;  5C4E A;  2BO7 A;  2RJ4 A;  4HG6 A;  4DDZ A;  1G9R A;  1H5S D;  3OAM A;  2RJ1 A;  3USQ A;  2A8W A;  5DDV A;  2AH9 A;  2XME A;  1TW5 A;  1LVW A;  2RJ9 A;  3U2W A;  4B4M A;  2VS4 A;  1G97 A;  1HJJ A;  4FRB A;  5FU0 A;  3SXA A;  2AM3 A;  4B4B A;  5BXC A;  1TVY A;  1K4V A;  1H7Q A;  5C8R A;  1WT1 A;  1H7G A;  1PZT A;  1JV3 A;  2E8B A;  1JV1 A;  3U2X A;  3K8E A;  3BCV A;  3DUV A;  1W57 A;  1OQM B;  1ZIZ A;  5C48 A;  2RJ5 A;  4B2X A;  4Y64 A;  2I5K A;  2BO8 A;  1HJL A;  5DDT A;  1FWY A;  2OEF A;  5AJN A;  2V0H A;  3T7M A;  1HM8 A;  2Z87 A;  2RJ0 A;  4KPZ A;  1LL2 A;  4LW3 A;  1Z90 A;  2XWL A;  2VSH A;  4J18 A;  5CQO A;  5EJ1 A;  1TW1 A;  1G95 A;  1VGW A;  1I52 A;  2YQC A;  1H7E A;  3QVB A;  4FCE A;  4G87 A;  1GQC A;  1GX0 A;  5FV9 A;  4Y7U A;  5EIY A;  2QH5 A;  4M2B A;  2BO6 A;  1IIM A;  1R7U A;  1LZ0 A;  1VH1 A;  3ZGG A;  4EE4 A;  1WT3 A;  3PNN A;  1H4C A;  1LZI A;  1ZCY A;  4FCU A;  3I0G A;  4HOC A;  1LZ7 A;  2QGI A;  2WVM A;  3T7O A;  5CMJ A;  1HV9 A;  3O3P A;  2RIT A;  3ZLL A;  2RJ7 A;  3SX7 A;  4FQW A;  1NKH B;  1H7L A;  1G1L A;  3I0L A;  3SPT A;  2Y4L A;  1FG5 N;  3Q80 A;  2A8U A;  1FRW A;  4AYJ A;  1NWG B;  4B42 A;  1VPA A;  3I0H A;  4Y6U A;  5CQN X;  2O1H A;  1R7V A;  1EYR A;  5CQL X;  4B5B A;  4B2W A;  1ZHJ A;  3Q7U A;  4B3U A;  3OH2 A;  2AE7 A;  4YS8 A;  1ZJP A;  4HO3 A;  4P02 A;  1QGS A;  2V0I A;  4KRV A;  2W0W A;  1FZW A;  1YP2 A;  4ASY A;  5C4B A;  2GGQ A;  2Y6P A;  5C3B A;  5IDT A;  1H4E A;  2ZU9 A;  1V84 A;  1JVD A;  1XZ6 A;  2ICY A;  3E26 A;  4HO8 A;  4Y7G A;  2X5Z A;  3FOQ A;  4Y7T A;  2RIX A;  1VH3 A;  1YRO B;  2JCK A;  4Y7F A;  3U2T A;  4D0Z A;  2BO4 A;  3OKR A;  4R7P A;  2D7R A;  3I0C A;  2WAW A;  3DJ4 A;  4IRQ A;  2AGD A;  2P72 A;  2QKX A;  2VSI A;  1FGG A;  2YC3 A;  1VZT A;  2P73 A;  5FU8 A;  3I0F A;  1WT0 A;  3IOJ A;  5I1F A;  1INJ A;  4HO2 A;  1H3M A;  2JCJ A;  3CKN A;  4FRQ A;  1V82 A;  4EEO A;  4DE7 A;  2JCO A;  1ZDG A;  1SS9 A;  3SX5 A;  5C49 A;  1GQ9 A;  4Y63 A;  5CMH A;  4Y7V A;  3PKQ A;  5C4C A;  4NAI A;  1ZI4 A;  1YP3 A;  1ZJ1 A;  2OI5 A;  3SXE A;  1QWJ A;  4Y6N A;  4G3S A;  3SX8 A;  4EEM A;  1FO8 A;  4LW6 A;  3NGW A;  3SX3 A;  3CGX A;  2V0K A;  4ECM A;  1OMZ A;  3PKP A;  2VXL A;  4KPX A;  1H7H A;  3I0E A;  1ZI5 A;  4AAW A;  1ZCU A;  5C3A A;  3N9W A;  5C47 A;  4KQL A;  1VGT A;  1XHB A;  4CVH A;  1GA8 A;  1NF5 B;  2OI6 A;  3HL3 A;  2RJ6 A;  3DK5 A;  2APC A;  2PA4 A;  1JYK A;  4M28 A;  1S4N A; 
#chains in the Genus database with same CATH topology
 1IIN A;  1NMM B;  1MC3 A;  2XWM A;  1FOA A;  1VZU A;  3R2W A;  3IOH A;  3RSB A;  5HS2 A;  2YES A;  3OH3 A;  2YC5 A;  3V0M A;  4FRD A;  4NAN A;  1E5K A;  2OEG A;  4HCQ A;  4HO5 A;  2RJ8 A;  3JUJ A;  2VD4 A;  2AEC A;  1VIC A;  3EE5 A;  1ZCV A;  1INI A;  1H4D A;  4CJB A;  2WVL A;  3I0J A;  5FTS A;  3SXC A;  4E1K A;  4AC3 A;  4L41 C;  1MP4 A;  4JIS A;  4K6R A;  3SXG A;  1H5T B;  2FYD B;  2I5E A;  3IOI A;  1O23 B;  3LW6 A;  4GBP A;  2PGY A;  1ZJ3 A;  1GWV A;  2D7I A;  1FXO A;  1QG8 A;  4KT7 A;  2O1G A;  1LL3 A;  3OH0 A;  5AJP A;  2RIY A;  3ST8 A;  4AYL A;  4ARW A;  3TQD A;  3F1C A;  1FO9 A;  3CKJ A;  4G3Q A;  2YQH A;  5C1G A;  3CKQ A;  2ZU8 A;  2WVK A;  5JQQ A;  2GGO A;  2Y4M A;  4MND A;  3RMV A;  2MZB A;  4FRP A;  2CU2 A;  2Y4J A;  3USR A;  2AM5 A;  1VZX A;  4M4K A;  5CQM X;  4D11 A;  4FRM A;  3OC9 A;  3K8D A;  3D5N A;  3V0N A;  3JTJ A;  3V0O A;  5C3D A;  4Q7C A;  3SXB A;  1G2V A;  1V83 A;  4HO6 A;  4G3P A;  1G3L A;  3CKV A;  3V0L A;  3ZLK A;  3I0D A;  2P6W A;  4NAL A;  1R82 A;  4KNR A;  2FYA A;  2V0L A;  2Y4K A;  5C4D A;  3BRK X;  3I0K A;  5CMF X;  3KIA A;  1O7Q A;  1WSZ A;  3D8V A;  4EE5 A;  1LL0 A;  5J49 A;  1S4P A;  4D11 C;  1WVC A;  1H5T A;  1OMX A;  3ZF8 A;  1O0R A;  2ZU7 A;  4ASJ A;  1MP3 A;  2PGV A;  1JVG A;  1H7T A;  1G93 A;  3U2U A;  1VGZ A;  5CQP A;  4EVW A;  4CJC A;  4D0T A;  4FRO A;  2FY7 A;  2Q4J A;  3POL A;  4FRE A;  5C36 A;  1JYL A;  5L6S A;  1G8O A;  4CJ8 A;  5IDS A;  1H5S B;  2NXV A;  4FRH A;  2FFV A;  2ICX A;  1NQI B;  1EZI A;  3FWW A;  4FRA A;  5CMG X;  1ZJ0 A;  4FIX A;  2VK9 A;  4MYB A;  2YQS A;  2AM4 A;  3U0X A;  1ZCT A;  2VS5 A;  3D98 A;  1GWW A;  2XWN A;  2Y7A A;  4XWI A;  2OI7 A;  1ZJO A;  2RIZ A;  2UX8 A;  4DEC A;  1GX4 A;  1PZY B;  2D0J A;  3SXD A;  3V8Y A;  1ON8 A;  2DPW A;  4FRL A;  5C4F A;  4EE3 A;  4C2S A;  1H7F A;  4IRP A;  3Q4S A;  1H5R B;  5FUH A;  4Y62 A;  5C1L A;  1MP5 A;  5AJO A;  5FYE A;  2JCL A;  3V91 A;  4JD0 A;  2VFZ A;  1ZJ2 A;  4KC4 A;  4EEG A;  4B4G A;  3CU0 A;  2FFU A;  1ZI3 A;  5EJZ A;  3F1Y A;  1HM9 A;  4HO0 A;  3U0Y A;  3JUK A;  3TZT A;  4HO9 A;  4BQH A;  3V90 A;  5IFY A;  1W55 A;  1TZF A;  1H5S A;  1WT2 A;  2X60 A;  4ZDQ A;  2PX7 A;  4O6M A;  5C1H A;  1ZI1 A;  4KNX A;  4UEG A;  2VS3 A;  3V0P A;  3OH1 A;  4M2A A;  1G0R A;  1W77 A;  2VXM A;  4KC1 A;  1HM0 A;  1NHE B;  2O1F A;  2YQJ A;  1ZDF A;  1FGX A;  3T7N A;  1O7O A;  3RMW A;  3V0Q A;  3I0I X;  1FR9 A;  1FXJ A;  4HO4 A;  2X5S A;  3OH4 A;  4P00 A;  1H5S C;  2WEE A;  3V8Z A;  3U2V A;  3OGZ A;  1FR8 A;  1R7T A;  1VM8 A;  1LZJ A;  2V0J A;  2AES A;  1R80 A;  5L6V A;  1VGU A;  2Z86 A;  1QGQ A;  2FYB A;  1S4O A;  5C38 A;  1H5R A;  5FTV A;  1KWS A;  2WE9 A;  3E25 A;  2I7B A;  2YCM A;  3GUE A;  1YP4 A;  1R7Y A;  5CMI A;  1ON6 A;  4D48 A;  2X65 A;  3CKO A;  2FYC B;  4NAK A;  1R81 A;  4KXO A;  4Y9X A;  2W0V A;  4KC2 A;  3ZGF A;  3R3I A;  2XMH A;  4EEA A;  4BMA A;  1G23 A;  2E3D A;  1R7X A;  2WGZ A;  5C4E A;  2BO7 A;  2RJ4 A;  4HG6 A;  4DDZ A;  1G9R A;  1H5S D;  3OAM A;  2RJ1 A;  3USQ A;  2A8W A;  5DDV A;  2AH9 A;  2XME A;  1TW5 A;  1LVW A;  2RJ9 A;  3U2W A;  4B4M A;  2VS4 A;  1G97 A;  1HJJ A;  4FRB A;  5FU0 A;  3SXA A;  2AM3 A;  4B4B A;  5BXC A;  1TVY A;  1K4V A;  1H7Q A;  5C8R A;  1WT1 A;  1H7G A;  1PZT A;  1JV3 A;  2E8B A;  1JV1 A;  3U2X A;  3K8E A;  3BCV A;  3DUV A;  1W57 A;  1OQM B;  1ZIZ A;  5C48 A;  2RJ5 A;  4B2X A;  4Y64 A;  2I5K A;  2BO8 A;  1HJL A;  5DDT A;  1FWY A;  2OEF A;  5AJN A;  2V0H A;  4FIY A;  3T7M A;  1HM8 A;  2Z87 A;  2RJ0 A;  4KPZ A;  1LL2 A;  5D91 A;  2J0A A;  4LW3 A;  1Z90 A;  2XWL A;  2VSH A;  4J18 A;  5CQO A;  5EJ1 A;  1TW1 A;  1G95 A;  1VGW A;  1I52 A;  2YQC A;  1H7E A;  3QVB A;  4FCE A;  4G87 A;  1GQC A;  1GX0 A;  5FV9 A;  4Y7U A;  5EIY A;  2QH5 A;  4M2B A;  2BO6 A;  1IIM A;  1R7U A;  1LZ0 A;  1VH1 A;  3ZGG A;  4EE4 A;  1WT3 A;  3PNN A;  1H4C A;  1LZI A;  1ZCY A;  4FCU A;  3I0G A;  4HOC A;  1LZ7 A;  2QGI A;  2WVM A;  3T7O A;  5CMJ A;  1HV9 A;  3O3P A;  2RIT A;  3ZLL A;  2RJ7 A;  3SX7 A;  4FQW A;  1NKH B;  1H7L A;  1G1L A;  3I0L A;  3SPT A;  2Y4L A;  1FG5 N;  2J0B A;  3Q80 A;  2A8U A;  1FRW A;  4AYJ A;  1NWG B;  4B42 A;  1VPA A;  3I0H A;  4Y6U A;  5CQN X;  2O1H A;  1R7V A;  1EYR A;  5CQL X;  4B5B A;  4B2W A;  1ZHJ A;  3Q7U A;  4B3U A;  3OH2 A;  2AE7 A;  4YS8 A;  1ZJP A;  4HO3 A;  4P02 A;  1QGS A;  2V0I A;  4KRV A;  2W0W A;  1FZW A;  1YP2 A;  4ASY A;  5C4B A;  4MIX A;  2GGQ A;  2Y6P A;  5C3B A;  5IDT A;  1H4E A;  2ZU9 A;  1V84 A;  1JVD A;  1XZ6 A;  2ICY A;  3E26 A;  4HO8 A;  4Y7G A;  2X5Z A;  3FOQ A;  4Y7T A;  2RIX A;  1VH3 A;  1YRO B;  2JCK A;  4Y7F A;  3U2T A;  4D0Z A;  2BO4 A;  3OKR A;  4R7P A;  2D7R A;  3I0C A;  2WAW A;  3DJ4 A;  4IRQ A;  2AGD A;  2P72 A;  2QKX A;  2VSI A;  1FGG A;  4O6N A;  2YC3 A;  1VZT A;  2P73 A;  5FU8 A;  3I0F A;  1WT0 A;  3IOJ A;  5I1F A;  1INJ A;  4HO2 A;  1H3M A;  2JCJ A;  3CKN A;  4FRQ A;  1V82 A;  4EEO A;  4DE7 A;  2JCO A;  1ZDG A;  1SS9 A;  3SX5 A;  5C49 A;  1GQ9 A;  4Y63 A;  5CMH A;  4Y7V A;  3PKQ A;  5C4C A;  4NAI A;  1ZI4 A;  1YP3 A;  1ZJ1 A;  2OI5 A;  3SXE A;  1QWJ A;  4Y6N A;  4G3S A;  3SX8 A;  2C0N A;  4EEM A;  1FO8 A;  4LW6 A;  3NGW A;  3SX3 A;  3CGX A;  2V0K A;  4ECM A;  1OMZ A;  3PKP A;  2VXL A;  4KPX A;  1H7H A;  3I0E A;  1ZI5 A;  4AAW A;  1ZCU A;  5C3A A;  3N9W A;  5C47 A;  4KQL A;  1VGT A;  1XHB A;  4CVH A;  1GA8 A;  1NF5 B;  2OI6 A;  5D92 A;  3HL3 A;  2RJ6 A;  3DK5 A;  2APC A;  2PA4 A;  1JYK A;  4M28 A;  1S4N A; 
#chains in the Genus database with same CATH homology
 1IIN A;  1NMM B;  1MC3 A;  2XWM A;  1FOA A;  1VZU A;  3R2W A;  3IOH A;  3RSB A;  5HS2 A;  2YES A;  3OH3 A;  2YC5 A;  3V0M A;  4FRD A;  4NAN A;  1E5K A;  2OEG A;  4HCQ A;  4HO5 A;  2RJ8 A;  3JUJ A;  2VD4 A;  2AEC A;  1VIC A;  3EE5 A;  1ZCV A;  1INI A;  1H4D A;  4CJB A;  2WVL A;  3I0J A;  5FTS A;  3SXC A;  4E1K A;  4AC3 A;  4L41 C;  1MP4 A;  4JIS A;  4K6R A;  3SXG A;  1H5T B;  2FYD B;  2I5E A;  3IOI A;  1O23 B;  3LW6 A;  4GBP A;  2PGY A;  1ZJ3 A;  1GWV A;  2D7I A;  1FXO A;  1QG8 A;  4KT7 A;  2O1G A;  1LL3 A;  3OH0 A;  5AJP A;  2RIY A;  3ST8 A;  4AYL A;  4ARW A;  3TQD A;  3F1C A;  1FO9 A;  3CKJ A;  4G3Q A;  2YQH A;  5C1G A;  3CKQ A;  2ZU8 A;  2WVK A;  5JQQ A;  2GGO A;  2Y4M A;  4MND A;  3RMV A;  2MZB A;  4FRP A;  2CU2 A;  2Y4J A;  3USR A;  2AM5 A;  1VZX A;  4M4K A;  5CQM X;  4D11 A;  4FRM A;  3OC9 A;  3K8D A;  3D5N A;  3V0N A;  3JTJ A;  3V0O A;  5C3D A;  4Q7C A;  3SXB A;  1G2V A;  1V83 A;  4HO6 A;  4G3P A;  1G3L A;  3CKV A;  3V0L A;  3ZLK A;  3I0D A;  2P6W A;  4NAL A;  1R82 A;  4KNR A;  2FYA A;  2V0L A;  2Y4K A;  5C4D A;  3BRK X;  3I0K A;  5CMF X;  3KIA A;  1O7Q A;  1WSZ A;  3D8V A;  4EE5 A;  1LL0 A;  5J49 A;  1S4P A;  4D11 C;  1WVC A;  1H5T A;  1OMX A;  3ZF8 A;  1O0R A;  2ZU7 A;  4ASJ A;  1MP3 A;  2PGV A;  1JVG A;  1H7T A;  1G93 A;  3U2U A;  1VGZ A;  5CQP A;  4EVW A;  4CJC A;  4D0T A;  4FRO A;  2FY7 A;  2Q4J A;  3POL A;  4FRE A;  5C36 A;  1JYL A;  5L6S A;  1G8O A;  4CJ8 A;  5IDS A;  1H5S B;  2NXV A;  4FRH A;  2FFV A;  2ICX A;  1NQI B;  1EZI A;  3FWW A;  4FRA A;  5CMG X;  1ZJ0 A;  4FIX A;  2VK9 A;  4MYB A;  2YQS A;  2AM4 A;  3U0X A;  1ZCT A;  2VS5 A;  3D98 A;  1GWW A;  2XWN A;  2Y7A A;  4XWI A;  2OI7 A;  1ZJO A;  2RIZ A;  2UX8 A;  4DEC A;  1GX4 A;  1PZY B;  2D0J A;  3SXD A;  3V8Y A;  1ON8 A;  2DPW A;  4FRL A;  5C4F A;  4EE3 A;  4C2S A;  1H7F A;  4IRP A;  3Q4S A;  1H5R B;  5FUH A;  4Y62 A;  5C1L A;  1MP5 A;  5AJO A;  5FYE A;  2JCL A;  3V91 A;  4JD0 A;  2VFZ A;  1ZJ2 A;  4KC4 A;  4EEG A;  4B4G A;  3CU0 A;  2FFU A;  1ZI3 A;  5EJZ A;  3F1Y A;  1HM9 A;  4HO0 A;  3U0Y A;  3JUK A;  3TZT A;  4HO9 A;  4BQH A;  3V90 A;  5IFY A;  1W55 A;  1TZF A;  1H5S A;  1WT2 A;  2X60 A;  4ZDQ A;  2PX7 A;  4O6M A;  5C1H A;  1ZI1 A;  4KNX A;  4UEG A;  2VS3 A;  3V0P A;  3OH1 A;  4M2A A;  1G0R A;  1W77 A;  2VXM A;  4KC1 A;  1HM0 A;  1NHE B;  2O1F A;  2YQJ A;  1ZDF A;  1FGX A;  3T7N A;  1O7O A;  3RMW A;  3V0Q A;  3I0I X;  1FR9 A;  1FXJ A;  4HO4 A;  2X5S A;  3OH4 A;  4P00 A;  1H5S C;  2WEE A;  3V8Z A;  3U2V A;  3OGZ A;  1FR8 A;  1R7T A;  1VM8 A;  1LZJ A;  2V0J A;  2AES A;  1R80 A;  5L6V A;  1VGU A;  2Z86 A;  1QGQ A;  2FYB A;  1S4O A;  5C38 A;  1H5R A;  5FTV A;  1KWS A;  2WE9 A;  3E25 A;  2I7B A;  2YCM A;  3GUE A;  1YP4 A;  1R7Y A;  5CMI A;  1ON6 A;  4D48 A;  2X65 A;  3CKO A;  2FYC B;  4NAK A;  1R81 A;  4KXO A;  4Y9X A;  2W0V A;  4KC2 A;  3ZGF A;  3R3I A;  2XMH A;  4EEA A;  4BMA A;  1G23 A;  2E3D A;  1R7X A;  2WGZ A;  5C4E A;  2BO7 A;  2RJ4 A;  4HG6 A;  4DDZ A;  1G9R A;  1H5S D;  3OAM A;  2RJ1 A;  3USQ A;  2A8W A;  5DDV A;  2AH9 A;  2XME A;  1TW5 A;  1LVW A;  2RJ9 A;  3U2W A;  4B4M A;  2VS4 A;  1G97 A;  1HJJ A;  4FRB A;  5FU0 A;  3SXA A;  2AM3 A;  4B4B A;  5BXC A;  1TVY A;  1K4V A;  1H7Q A;  5C8R A;  1WT1 A;  1H7G A;  1PZT A;  1JV3 A;  2E8B A;  1JV1 A;  3U2X A;  3K8E A;  3BCV A;  3DUV A;  1W57 A;  1OQM B;  1ZIZ A;  5C48 A;  2RJ5 A;  4B2X A;  4Y64 A;  2I5K A;  2BO8 A;  1HJL A;  5DDT A;  1FWY A;  2OEF A;  5AJN A;  2V0H A;  4FIY A;  3T7M A;  1HM8 A;  2Z87 A;  2RJ0 A;  4KPZ A;  1LL2 A;  5D91 A;  2J0A A;  4LW3 A;  1Z90 A;  2XWL A;  2VSH A;  4J18 A;  5CQO A;  5EJ1 A;  1TW1 A;  1G95 A;  1VGW A;  1I52 A;  2YQC A;  1H7E A;  3QVB A;  4FCE A;  4G87 A;  1GQC A;  1GX0 A;  5FV9 A;  4Y7U A;  5EIY A;  2QH5 A;  4M2B A;  2BO6 A;  1IIM A;  1R7U A;  1LZ0 A;  1VH1 A;  3ZGG A;  4EE4 A;  1WT3 A;  3PNN A;  1H4C A;  1LZI A;  1ZCY A;  4FCU A;  3I0G A;  4HOC A;  1LZ7 A;  2QGI A;  2WVM A;  3T7O A;  5CMJ A;  1HV9 A;  3O3P A;  2RIT A;  3ZLL A;  2RJ7 A;  3SX7 A;  4FQW A;  1NKH B;  1H7L A;  1G1L A;  3I0L A;  3SPT A;  2Y4L A;  1FG5 N;  2J0B A;  3Q80 A;  2A8U A;  1FRW A;  4AYJ A;  1NWG B;  4B42 A;  1VPA A;  3I0H A;  4Y6U A;  5CQN X;  2O1H A;  1R7V A;  1EYR A;  5CQL X;  4B5B A;  4B2W A;  1ZHJ A;  3Q7U A;  4B3U A;  3OH2 A;  2AE7 A;  4YS8 A;  1ZJP A;  4HO3 A;  4P02 A;  1QGS A;  2V0I A;  4KRV A;  2W0W A;  1FZW A;  1YP2 A;  4ASY A;  5C4B A;  4MIX A;  2GGQ A;  2Y6P A;  5C3B A;  5IDT A;  1H4E A;  2ZU9 A;  1V84 A;  1JVD A;  1XZ6 A;  2ICY A;  3E26 A;  4HO8 A;  4Y7G A;  2X5Z A;  3FOQ A;  4Y7T A;  2RIX A;  1VH3 A;  1YRO B;  2JCK A;  4Y7F A;  3U2T A;  4D0Z A;  2BO4 A;  3OKR A;  4R7P A;  2D7R A;  3I0C A;  2WAW A;  3DJ4 A;  4IRQ A;  2AGD A;  2P72 A;  2QKX A;  2VSI A;  1FGG A;  4O6N A;  2YC3 A;  1VZT A;  2P73 A;  5FU8 A;  3I0F A;  1WT0 A;  3IOJ A;  5I1F A;  1INJ A;  4HO2 A;  1H3M A;  2JCJ A;  3CKN A;  4FRQ A;  1V82 A;  4EEO A;  4DE7 A;  2JCO A;  1ZDG A;  1SS9 A;  3SX5 A;  5C49 A;  1GQ9 A;  4Y63 A;  5CMH A;  4Y7V A;  3PKQ A;  5C4C A;  4NAI A;  1ZI4 A;  1YP3 A;  1ZJ1 A;  2OI5 A;  3SXE A;  1QWJ A;  4Y6N A;  4G3S A;  3SX8 A;  2C0N A;  4EEM A;  1FO8 A;  4LW6 A;  3NGW A;  3SX3 A;  3CGX A;  2V0K A;  4ECM A;  1OMZ A;  3PKP A;  2VXL A;  4KPX A;  1H7H A;  3I0E A;  1ZI5 A;  4AAW A;  1ZCU A;  5C3A A;  3N9W A;  5C47 A;  4KQL A;  1VGT A;  1XHB A;  4CVH A;  1GA8 A;  1NF5 B;  2OI6 A;  5D92 A;  3HL3 A;  2RJ6 A;  3DK5 A;  2APC A;  2PA4 A;  1JYK A;  4M28 A;  1S4N A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...