3O3PA

Crystal structure of r. xylanophilus mpgs in complex with gdp-mannose
Total Genus 105
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
105
sequence length
325
structure length
318
Chain Sequence
GPASAAEWFRQRSYDYGQFPPEDLARRKRELGLTVSAVLPSRNVADTVGGIIDEIHALNERAPLIDQILVVDADSEDGTAGVAASHGAEVYSENELMSGYGDAHGKGDAMWRALSVTRGDLVLYIDADTRDFRPQLAYGVLGPVLEVPGVRFVKAAYRRPEEDGGGRVTELTAKPLFNLFYPELAGFVQPLAGEFVADRELFCSIPFLTGYAVETGIMIDVLKKVGLGAMAQVDLGERQNRHQHLRDLSRMSYAVVRAVARRLRQEGRLQQLREPGLPESFFQLSDYLHAVATPEGLKLQEYVEELVERPPINEVLRV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords Mannosyl-3-phosphoglycerate synthase
publication title Functional and structural characterization of a novel mannosyl-3-phosphoglycerate synthase from Rubrobacter xylanophilus reveals its dual substrate specificity
pubmed doi rcsb
source organism Rubrobacter xylanophilus
total genus 105
structure length 318
sequence length 325
chains with identical sequence B
ec nomenclature ec 2.4.1.217: Mannosyl-3-phosphoglycerate synthase.
pdb deposition date 2010-07-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00535 Glycos_transf_2 Glycosyl transferase family 2
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.550.10 Alpha Beta Alpha-Beta Complex Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A 3o3pA00
2RJ4A 5CMFX 5C38A 4FCEA 1FO8A 5DDVA 1W57A 2VS3A 3D8VA 3I0HA 1OQMB 2CU2A 1H5RA 1E5KA 4DDZA 2WVMA 4NAIA 1H5SC 3SX5A 2ICYA 4B42A 1G2VA 3HL3A 4FCUA 3POLA 5CMIA 4NAKA 4FROA 4Y62A 2Y4KA 4FQWA 2NXVA 3ZLKA 2PGYA 1H7FA 2X60A 4KT7A 2YQCA 2V0IA 2RJ0A 4M2BA 3CGXA 4FRMA 1GWWA 2Y4LA 4IRPA 4AC3A 1VGUA 3SXAA 1O23B 3NGWA 1GWVA 1H7TA 4EE5A 4UEGA 3BCVA 3I0GA 3LW6A 1JV1A 4NANA 1HM0A 1ZIZA 2PA4A 1ZCVA 5IDTA 3U0YA 4Y6UA 2OEFA 3SX8A 4KC2A 5I1FA 5IFYA 1ZCTA 2BO7A 2Y6PA 4Y9XA 2BO8A 2RJ7A 2QGIA 1G93A 2XWNA 5C4CA 1HM8A 4G3QA 1NHEB 5FTVA 5C36A 2RJ9A 1GX4A 5C3DA 4ECMA 2RJ8A 3SX3A 4EEMA 1VICA 1WT0A 1XHBA 2YQSA 2QKXA 2YC5A 5CQLX 3KIAA 2E3DA 1H7LA 1W77A 1S4PA 3N9WA 2XMHA 4CJ8A 1ON8A 3U2VA 1EYRA 5FU0A 3SXDA 2RIYA 1LVWA 1R7UA 4JD0A 5C4DA 2YQJA 4G3PA 4CJCA 2Y4JA 3D98A 4KPZA 5EJ1A 5AJOA 3E26A 4EEOA 5DDTA 4D0ZA 2MZBA 4KXOA 1MP3A 1G1LA 2O1FA 2V0HA 1ZJ0A 2VS4A 3JUJA 1PZYB 2WVKA 3OC9A 4B2WA 5J49A 2BO6A 5C3BA 1S4OA 4B3UA 1VZXA 2XMEA 1O0RA 1LL2A 3I0DA 3V0PA 4KQLA 1I52A 1WT2A 2JCLA 1VGTA 1FO9A 3CKJA 3I0LA 2P73A 4AYJA 2RITA 1TVYA 5C4EA 1MP4A 1TW1A 4EE3A 1ZI5A 2FFVA 4P02A 1R80A 1H7QA 1VZTA 2P6WA 4R7PA 3V91A 3SXGA 4AAWA 4LW6A 5IDSA 5CQMX 3V0QA 2AECA 1R81A 1INJA 4D11A 3OH1A 1HM9A 3Q7UA 1ZCUA 1ZJOA 2I5EA 1H4CA 1VZUA 4Y7TA 4DECA 1XZ6A 2FFUA 3K8DA 2AE7A 4FREA 1H7GA 3IOHA 4FRDA 1VPAA 1SS9A 1VGWA 4KRVA 3V8YA 4BQHA 3U2UA 2JCKA 4M2AA 1ZJPA 2W0VA 2VXMA 2Y4MA 2I5KA 4KPXA 2Q4JA 1YP3A 4Y63A 1GA8A 5CQNX 3ZLLA 3I0KA 4NALA 4FRBA 1FRWA 3ZF8A 4KC4A 2AESA 4B4MA 4D11C 4HCQA 4B4GA 1VH1A 1GQ9A 4BMAA 4D0TA 2OEGA 4EEAA 3R2WA 2AGDA 1R7VA 2PGVA 1JYLA 3I0IX 2GGOA 1ZI4A 4ARWA 2O1GA 1MC3A 1R7TA 5L6SA 2WE9A 1G0RA 2E8BA 1HV9A 2V0LA 4HO6A 2YESA 3I0FA 3ZGGA 1ZJ3A 3E25A 1WT1A 4KC1A 1OMZA 2V0KA 1H5SB 3I0CA 5FUHA 3SPTA 5CQOA 1FXJA 1PZTA 3BRKX 3CKNA 5C1LA 3USQA 1QG8A 2FY7A 2OI6A 3CKQA 1H5TB 3F1YA 1OMXA 4KNXA 1V82A 4HOCA 3F1CA 5L6VA 3ZGFA 5C1HA 4EVWA 1FGGA 3IOIA 4AYLA 1NKHB 1GX0A 4J18A 2AM4A 4D48A 4Y7UA 4HO5A 2DPWA 3GUEA 2D0JA 1FZWA 5CMHA 1R7XA 3RMWA 1TW5A 1GQCA 3RMVA 4FRPA 1V84A 3T7NA 3U2XA 4KNRA 4MNDA 3ST8A 3OH0A 1ZDFA 3I0EA 5C47A 5BXCA 2FYAA 5HS2A 2VSHA 3FOQA 1H5RB 1LZ0A 5CMGX 2XWMA 3K8EA 2ZU9A 1LZIA 1ZI3A 1MP5A 1H4DA 2BO4A 2ICXA 3Q4SA 1VH3A 4EE4A 4DE7A 3V8ZA 2V0JA 1KWSA 1O7OA 4HG6A 3IOJA 2GGQA 1QWJA 2FYDB 4FRHA 4L41C 2AM5A 3CKOA 2QH5A 1G3LA 1JV3A 1G8OA 1YROB 2FYCB 3OH4A 1R7YA 3R3IA 4ASYA 1R82A 2RJ1A 2AM3A 2UX8A 4Y7VA 2OI5A 4Y64A 1G9RA 2Z86A 5JQQA 1WVCA 1H3MA 1V83A 4JISA 4E1KA 1ZCYA 2VSIA 2X65A 1NQIB 1W55A 1YP2A 2A8WA 4HO9A 1WSZA 5FU8A 4G3SA 1ZDGA 2VS5A 4P00A 5FTSA 1IIMA 2W0WA 2Y7AA 5AJNA 1ON6A 1NWGB 3OGZA 1FG5N 5C3AA 1FOAA 2PX7A 3PKQA 1G97A 1INIA 4M4KA 2YC3A 2X5SA 1H7EA 3JUKA 3O3PA 2JCJA 1HJJA 2RJ5A 4Y6NA 4HO0A 3T7OA 2RIXA 2ZU8A 1LL3A 2YCMA 3FWWA 2WEEA 3Q80A 2APCA 3U0XA 4B5BA 4HO2A 1TZFA 4FRLA 4G87A 4MYBA 4Y7GA 3V0NA 5FYEA 3USRA 3U2TA 1LL0A 2I7BA 1YP4A 2P72A 3V0MA 1S4NA 2VFZA 1QGSA 2AH9A 3SX7A 1JYKA 3CKVA 3RSBA 2OI7A 3OAMA 1FR9A 2ZU7A 2WAWA 3EE5A 3SXCA 4B2XA 1VGZA 2VD4A 5C8RA 1LZJA 5C4FA 1VM8A 1K4VA 1NMMB 4IRQA 1JVDA 2D7IA 3TZTA 4YS8A 1EZIA 3CU0A 5EJZA 3PKPA 3DK5A 1G95A 1ZJ1A 1FXOA 5AJPA 1FR8A 5EIYA 2X5ZA 4CVHA 4LW3A 2XWLA 4XWIA 4FRQA 2VXLA 4C2SA 1FGXA 5C49A 2WVLA 1O7QA 1H5SD 2D7RA 5CQPA 3OH2A 3I0JA 3V0LA 5CMJA 4ZDQA 5FV9A 1WT3A 3SXEA 4HO4A 2O1HA 1G23A 1NF5B 2A8UA 5C4BA 2YQHA 2JCOA 4M28A 4K6RA 3U2WA 3T7MA 1H5SA 4CJBA 1ZHJA 1H4EA 4FRAA 3JTJA 2RIZA 1QGQA 1ZI1A 1Z90A 5C1GA 1H7HA 1FWYA 4EEGA 1H5TA 4HO8A 1JVGA 3V90A 4B4BA 3SXBA 1ZJ2A 1LZ7A 4GBPA 1HJLA 2FYBA 3D5NA 2Z87A 3OKRA 4ASJA 3TQDA 3PNNA 3DJ4A 3QVBA 2WGZA 3V0OA 2RJ6A 3OH3A 5C48A 4HO3A 3DUVA 4Y7FA 1IINA
chains in the Genus database with same CATH superfamily
2RJ4A 5CMFX 5C38A 4FCEA 1FO8A 5DDVA 1W57A 2VS3A 3D8VA 3I0HA 1OQMB 2CU2A 1H5RA 1E5KA 4DDZA 2WVMA 4NAIA 1H5SC 3SX5A 2ICYA 4B42A 1G2VA 3HL3A 4FCUA 3POLA 5CMIA 4NAKA 4FROA 4Y62A 2Y4KA 4FQWA 2NXVA 3ZLKA 2PGYA 1H7FA 2X60A 4KT7A 2YQCA 2V0IA 2RJ0A 4M2BA 3CGXA 4FRMA 1GWWA 2Y4LA 4IRPA 4AC3A 1VGUA 3SXAA 1O23B 3NGWA 1GWVA 1H7TA 4EE5A 4UEGA 3BCVA 3I0GA 3LW6A 1JV1A 4NANA 1HM0A 1ZIZA 2PA4A 1ZCVA 5IDTA 3U0YA 4Y6UA 2OEFA 3SX8A 4KC2A 5I1FA 5IFYA 1ZCTA 2BO7A 2Y6PA 4Y9XA 2BO8A 2RJ7A 2QGIA 1G93A 2XWNA 5C4CA 1HM8A 4G3QA 1NHEB 5FTVA 5C36A 2RJ9A 1GX4A 5C3DA 4ECMA 2RJ8A 3SX3A 4EEMA 1VICA 1WT0A 1XHBA 2YQSA 2QKXA 2YC5A 5CQLX 3KIAA 2E3DA 4FIYA 1H7LA 1W77A 1S4PA 3N9WA 2XMHA 4CJ8A 1ON8A 3U2VA 1EYRA 5FU0A 3SXDA 2RIYA 1LVWA 1R7UA 4JD0A 5C4DA 2YQJA 4G3PA 4CJCA 2Y4JA 3D98A 4KPZA 5EJ1A 5AJOA 3E26A 4EEOA 2J0AA 5DDTA 4D0ZA 2MZBA 4KXOA 1MP3A 1G1LA 2O1FA 2V0HA 1ZJ0A 2VS4A 3JUJA 1PZYB 2WVKA 3OC9A 4B2WA 5J49A 2BO6A 5C3BA 1S4OA 4B3UA 1VZXA 2XMEA 1O0RA 1LL2A 3I0DA 3V0PA 4KQLA 1I52A 1WT2A 2JCLA 1VGTA 1FO9A 3CKJA 3I0LA 2P73A 4AYJA 2RITA 1TVYA 5C4EA 1MP4A 1TW1A 4EE3A 1ZI5A 2FFVA 4P02A 1R80A 1H7QA 1VZTA 2P6WA 4R7PA 3V91A 3SXGA 4AAWA 4LW6A 5IDSA 5CQMX 3V0QA 2AECA 1R81A 1INJA 4D11A 3OH1A 1HM9A 3Q7UA 1ZCUA 1ZJOA 2I5EA 1H4CA 1VZUA 4Y7TA 4DECA 1XZ6A 2FFUA 3K8DA 4O6MA 2AE7A 4FREA 1H7GA 3IOHA 4FRDA 1VPAA 1SS9A 1VGWA 4KRVA 3V8YA 4BQHA 3U2UA 2JCKA 4M2AA 1ZJPA 2W0VA 2VXMA 2Y4MA 2I5KA 4KPXA 2Q4JA 1YP3A 4Y63A 1GA8A 5CQNX 3ZLLA 3I0KA 4NALA 4FRBA 1FRWA 3ZF8A 4KC4A 2AESA 4B4MA 4D11C 4HCQA 4B4GA 1VH1A 1GQ9A 4BMAA 4D0TA 2OEGA 4EEAA 3R2WA 2AGDA 4MIXA 1R7VA 2PGVA 1JYLA 3I0IX 2GGOA 1ZI4A 4ARWA 2O1GA 5D91A 1MC3A 1R7TA 5L6SA 2WE9A 1G0RA 2E8BA 1HV9A 2V0LA 4HO6A 2YESA 3I0FA 3ZGGA 1ZJ3A 3E25A 1WT1A 4KC1A 1OMZA 2V0KA 1H5SB 3I0CA 5FUHA 3SPTA 2VK9A 5CQOA 1FXJA 1PZTA 3BRKX 3CKNA 2J0BA 5C1LA 2C0NA 3USQA 1QG8A 2FY7A 2OI6A 3CKQA 1H5TB 3F1YA 1OMXA 4KNXA 1V82A 4HOCA 3F1CA 5L6VA 3ZGFA 5C1HA 4EVWA 1FGGA 3IOIA 4AYLA 1NKHB 1GX0A 4J18A 2AM4A 4D48A 4Y7UA 4HO5A 2DPWA 3GUEA 2D0JA 1FZWA 5CMHA 1R7XA 3RMWA 1TW5A 1GQCA 3RMVA 4FRPA 1V84A 3T7NA 3U2XA 4KNRA 4MNDA 3ST8A 3OH0A 1ZDFA 3I0EA 5C47A 5BXCA 2FYAA 5HS2A 2VSHA 3FOQA 1H5RB 1LZ0A 5CMGX 2XWMA 3K8EA 2ZU9A 1LZIA 1ZI3A 1MP5A 1H4DA 2BO4A 2ICXA 3Q4SA 1VH3A 4EE4A 4DE7A 3V8ZA 2V0JA 1KWSA 1O7OA 4HG6A 3IOJA 2GGQA 1QWJA 2FYDB 4FRHA 4L41C 2AM5A 3CKOA 2QH5A 1G3LA 1JV3A 1G8OA 1YROB 2FYCB 3OH4A 1R7YA 3R3IA 4ASYA 1R82A 2RJ1A 2AM3A 2UX8A 4Y7VA 2OI5A 4Y64A 1G9RA 2Z86A 5JQQA 1WVCA 4O6NA 1H3MA 1V83A 4JISA 4Q7CA 4E1KA 1ZCYA 5D92A 2VSIA 2X65A 1NQIB 1W55A 1YP2A 2A8WA 4HO9A 1WSZA 5FU8A 4G3SA 1ZDGA 2VS5A 4P00A 5FTSA 1IIMA 2W0WA 2Y7AA 5AJNA 1ON6A 1NWGB 3OGZA 1FG5N 5C3AA 1FOAA 2PX7A 3PKQA 1G97A 1INIA 4M4KA 2YC3A 2X5SA 1H7EA 3JUKA 3O3PA 2JCJA 1HJJA 2RJ5A 4Y6NA 4HO0A 3T7OA 2RIXA 2ZU8A 1LL3A 2YCMA 3FWWA 2WEEA 3Q80A 2APCA 3U0XA 4B5BA 4HO2A 1TZFA 4FRLA 4G87A 4MYBA 4Y7GA 3V0NA 5FYEA 3USRA 3U2TA 1LL0A 2I7BA 1YP4A 2P72A 3V0MA 1S4NA 2VFZA 1QGSA 2AH9A 3SX7A 1JYKA 3CKVA 3RSBA 2OI7A 3OAMA 1FR9A 2ZU7A 2WAWA 3EE5A 3SXCA 4B2XA 1VGZA 2VD4A 5C8RA 1LZJA 5C4FA 1VM8A 1K4VA 1NMMB 4IRQA 1JVDA 2D7IA 3TZTA 4YS8A 1EZIA 3CU0A 5EJZA 3PKPA 3DK5A 1G95A 1ZJ1A 1FXOA 5AJPA 1FR8A 5EIYA 2X5ZA 4CVHA 4LW3A 2XWLA 4XWIA 4FRQA 2VXLA 4C2SA 1FGXA 5C49A 2WVLA 1O7QA 1H5SD 2D7RA 5CQPA 3OH2A 3I0JA 3V0LA 5CMJA 4ZDQA 5FV9A 1WT3A 3SXEA 4HO4A 2O1HA 1G23A 1NF5B 2A8UA 5C4BA 2YQHA 2JCOA 4M28A 4K6RA 3U2WA 3T7MA 1H5SA 4CJBA 1ZHJA 1H4EA 4FRAA 3JTJA 2RIZA 1QGQA 1ZI1A 1Z90A 5C1GA 1H7HA 1FWYA 4EEGA 1H5TA 4HO8A 4FIXA 1JVGA 3V90A 4B4BA 3SXBA 1ZJ2A 1LZ7A 4GBPA 1HJLA 2FYBA 3D5NA 2Z87A 3OKRA 4ASJA 3TQDA 3PNNA 3DJ4A 3QVBA 2WGZA 3V0OA 2RJ6A 3OH3A 5C48A 4HO3A 3DUVA 4Y7FA 1IINA
chains in the Genus database with same CATH topology
2RJ4A 5CMFX 5C38A 4FCEA 1FO8A 5DDVA 1W57A 2VS3A 3D8VA 3I0HA 1OQMB 2CU2A 1H5RA 1E5KA 4DDZA 2WVMA 4NAIA 1H5SC 3SX5A 2ICYA 4B42A 1G2VA 3HL3A 4FCUA 3POLA 5CMIA 4NAKA 4FROA 4Y62A 2Y4KA 4FQWA 2NXVA 3ZLKA 2PGYA 1H7FA 2X60A 4KT7A 2YQCA 2V0IA 2RJ0A 4M2BA 3CGXA 4FRMA 1GWWA 2Y4LA 4IRPA 4AC3A 1VGUA 3SXAA 1O23B 3NGWA 1GWVA 1H7TA 4EE5A 4UEGA 3BCVA 3I0GA 3LW6A 1JV1A 4NANA 1HM0A 1ZIZA 2PA4A 1ZCVA 5IDTA 3U0YA 4Y6UA 2OEFA 3SX8A 4KC2A 5I1FA 5IFYA 1ZCTA 2BO7A 2Y6PA 4Y9XA 2BO8A 2RJ7A 2QGIA 1G93A 2XWNA 5C4CA 1HM8A 4G3QA 1NHEB 5FTVA 5C36A 2RJ9A 1GX4A 5C3DA 4ECMA 2RJ8A 3SX3A 4EEMA 1VICA 1WT0A 1XHBA 2YQSA 2QKXA 2YC5A 5CQLX 3KIAA 2E3DA 4FIYA 1H7LA 1W77A 1S4PA 3N9WA 2XMHA 4CJ8A 1ON8A 3U2VA 1EYRA 5FU0A 3SXDA 2RIYA 1LVWA 1R7UA 4JD0A 5C4DA 2YQJA 4G3PA 4CJCA 2Y4JA 3D98A 4KPZA 5EJ1A 5AJOA 3E26A 4EEOA 2J0AA 5DDTA 4D0ZA 2MZBA 4KXOA 1MP3A 1G1LA 2O1FA 2V0HA 1ZJ0A 2VS4A 3JUJA 1PZYB 2WVKA 3OC9A 4B2WA 5J49A 2BO6A 5C3BA 1S4OA 4B3UA 1VZXA 2XMEA 1O0RA 1LL2A 3I0DA 3V0PA 4KQLA 1I52A 1WT2A 2JCLA 1VGTA 1FO9A 3CKJA 3I0LA 2P73A 4AYJA 2RITA 1TVYA 5C4EA 1MP4A 1TW1A 4EE3A 1ZI5A 2FFVA 4P02A 1R80A 1H7QA 1VZTA 2P6WA 4R7PA 3V91A 3SXGA 4AAWA 4LW6A 5IDSA 5CQMX 3V0QA 2AECA 1R81A 1INJA 4D11A 3OH1A 1HM9A 3Q7UA 1ZCUA 1ZJOA 2I5EA 1H4CA 1VZUA 4Y7TA 4DECA 1XZ6A 2FFUA 3K8DA 4O6MA 2AE7A 4FREA 1H7GA 3IOHA 4FRDA 1VPAA 1SS9A 1VGWA 4KRVA 3V8YA 4BQHA 3U2UA 2JCKA 4M2AA 1ZJPA 2W0VA 2VXMA 2Y4MA 2I5KA 4KPXA 2Q4JA 1YP3A 4Y63A 1GA8A 5CQNX 3ZLLA 3I0KA 4NALA 4FRBA 1FRWA 3ZF8A 4KC4A 2AESA 4B4MA 4D11C 4HCQA 4B4GA 1VH1A 1GQ9A 4BMAA 4D0TA 2OEGA 4EEAA 3R2WA 2AGDA 4MIXA 1R7VA 2PGVA 1JYLA 3I0IX 2GGOA 1ZI4A 4ARWA 2O1GA 5D91A 1MC3A 1R7TA 5L6SA 2WE9A 1G0RA 2E8BA 1HV9A 2V0LA 4HO6A 2YESA 3I0FA 3ZGGA 1ZJ3A 3E25A 1WT1A 4KC1A 1OMZA 2V0KA 1H5SB 3I0CA 5FUHA 3SPTA 2VK9A 5CQOA 1FXJA 1PZTA 3BRKX 3CKNA 2J0BA 5C1LA 2C0NA 3USQA 1QG8A 2FY7A 2OI6A 3CKQA 1H5TB 3F1YA 1OMXA 4KNXA 1V82A 4HOCA 3F1CA 5L6VA 3ZGFA 5C1HA 4EVWA 1FGGA 3IOIA 4AYLA 1NKHB 1GX0A 4J18A 2AM4A 4D48A 4Y7UA 4HO5A 2DPWA 3GUEA 2D0JA 1FZWA 5CMHA 1R7XA 3RMWA 1TW5A 1GQCA 3RMVA 4FRPA 1V84A 3T7NA 3U2XA 4KNRA 4MNDA 3ST8A 3OH0A 1ZDFA 3I0EA 5C47A 5BXCA 2FYAA 5HS2A 2VSHA 3FOQA 1H5RB 1LZ0A 5CMGX 2XWMA 3K8EA 2ZU9A 1LZIA 1ZI3A 1MP5A 1H4DA 2BO4A 2ICXA 3Q4SA 1VH3A 4EE4A 4DE7A 3V8ZA 2V0JA 1KWSA 1O7OA 4HG6A 3IOJA 2GGQA 1QWJA 2FYDB 4FRHA 4L41C 2AM5A 3CKOA 2QH5A 1G3LA 1JV3A 1G8OA 1YROB 2FYCB 3OH4A 1R7YA 3R3IA 4ASYA 1R82A 2RJ1A 2AM3A 2UX8A 4Y7VA 2OI5A 4Y64A 1G9RA 2Z86A 5JQQA 1WVCA 4O6NA 1H3MA 1V83A 4JISA 4Q7CA 4E1KA 1ZCYA 5D92A 2VSIA 2X65A 1NQIB 1W55A 1YP2A 2A8WA 4HO9A 1WSZA 5FU8A 4G3SA 1ZDGA 2VS5A 4P00A 5FTSA 1IIMA 2W0WA 2Y7AA 5AJNA 1ON6A 1NWGB 3OGZA 1FG5N 5C3AA 1FOAA 2PX7A 3PKQA 1G97A 1INIA 4M4KA 2YC3A 2X5SA 1H7EA 3JUKA 3O3PA 2JCJA 1HJJA 2RJ5A 4Y6NA 4HO0A 3T7OA 2RIXA 2ZU8A 1LL3A 2YCMA 3FWWA 2WEEA 3Q80A 2APCA 3U0XA 4B5BA 4HO2A 1TZFA 4FRLA 4G87A 4MYBA 4Y7GA 3V0NA 5FYEA 3USRA 3U2TA 1LL0A 2I7BA 1YP4A 2P72A 3V0MA 1S4NA 2VFZA 1QGSA 2AH9A 3SX7A 1JYKA 3CKVA 3RSBA 2OI7A 3OAMA 1FR9A 2ZU7A 2WAWA 3EE5A 3SXCA 4B2XA 1VGZA 2VD4A 5C8RA 1LZJA 5C4FA 1VM8A 1K4VA 1NMMB 4IRQA 1JVDA 2D7IA 3TZTA 4YS8A 1EZIA 3CU0A 5EJZA 3PKPA 3DK5A 1G95A 1ZJ1A 1FXOA 5AJPA 1FR8A 5EIYA 2X5ZA 4CVHA 4LW3A 2XWLA 4XWIA 4FRQA 2VXLA 4C2SA 1FGXA 5C49A 2WVLA 1O7QA 1H5SD 2D7RA 5CQPA 3OH2A 3I0JA 3V0LA 5CMJA 4ZDQA 5FV9A 1WT3A 3SXEA 4HO4A 2O1HA 1G23A 1NF5B 2A8UA 5C4BA 2YQHA 2JCOA 4M28A 4K6RA 3U2WA 3T7MA 1H5SA 4CJBA 1ZHJA 1H4EA 4FRAA 3JTJA 2RIZA 1QGQA 1ZI1A 1Z90A 5C1GA 1H7HA 1FWYA 4EEGA 1H5TA 4HO8A 4FIXA 1JVGA 3V90A 4B4BA 3SXBA 1ZJ2A 1LZ7A 4GBPA 1HJLA 2FYBA 3D5NA 2Z87A 3OKRA 4ASJA 3TQDA 3PNNA 3DJ4A 3QVBA 2WGZA 3V0OA 2RJ6A 3OH3A 5C48A 4HO3A 3DUVA 4Y7FA 1IINA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2RJ4 A;  5CMF X;  5C38 A;  4FCE A;  1FO8 A;  5DDV A;  1W57 A;  2VS3 A;  3D8V A;  3I0H A;  1OQM B;  2CU2 A;  1H5R A;  1E5K A;  4DDZ A;  2WVM A;  4NAI A;  1H5S C;  3SX5 A;  2ICY A;  4B42 A;  1G2V A;  3HL3 A;  4FCU A;  3POL A;  5CMI A;  4NAK A;  4FRO A;  4Y62 A;  2Y4K A;  4FQW A;  2NXV A;  3ZLK A;  2PGY A;  1H7F A;  2X60 A;  4KT7 A;  2YQC A;  2V0I A;  2RJ0 A;  4M2B A;  3CGX A;  4FRM A;  1GWW A;  2Y4L A;  4IRP A;  4AC3 A;  1VGU A;  3SXA A;  1O23 B;  3NGW A;  1GWV A;  1H7T A;  4EE5 A;  4UEG A;  3BCV A;  3I0G A;  3LW6 A;  1JV1 A;  4NAN A;  1HM0 A;  1ZIZ A;  2PA4 A;  1ZCV A;  5IDT A;  3U0Y A;  4Y6U A;  2OEF A;  3SX8 A;  4KC2 A;  5I1F A;  5IFY A;  1ZCT A;  2BO7 A;  2Y6P A;  4Y9X A;  2BO8 A;  2RJ7 A;  2QGI A;  1G93 A;  2XWN A;  5C4C A;  1HM8 A;  4G3Q A;  1NHE B;  5FTV A;  5C36 A;  2RJ9 A;  1GX4 A;  5C3D A;  4ECM A;  2RJ8 A;  3SX3 A;  4EEM A;  1VIC A;  1WT0 A;  1XHB A;  2YQS A;  2QKX A;  2YC5 A;  5CQL X;  3KIA A;  2E3D A;  1H7L A;  1W77 A;  1S4P A;  3N9W A;  2XMH A;  4CJ8 A;  1ON8 A;  3U2V A;  1EYR A;  5FU0 A;  3SXD A;  2RIY A;  1LVW A;  1R7U A;  4JD0 A;  5C4D A;  2YQJ A;  4G3P A;  4CJC A;  2Y4J A;  3D98 A;  4KPZ A;  5EJ1 A;  5AJO A;  3E26 A;  4EEO A;  5DDT A;  4D0Z A;  2MZB A;  4KXO A;  1MP3 A;  1G1L A;  2O1F A;  2V0H A;  1ZJ0 A;  2VS4 A;  3JUJ A;  1PZY B;  2WVK A;  3OC9 A;  4B2W A;  5J49 A;  2BO6 A;  5C3B A;  1S4O A;  4B3U A;  1VZX A;  2XME A;  1O0R A;  1LL2 A;  3I0D A;  3V0P A;  4KQL A;  1I52 A;  1WT2 A;  2JCL A;  1VGT A;  1FO9 A;  3CKJ A;  3I0L A;  2P73 A;  4AYJ A;  2RIT A;  1TVY A;  5C4E A;  1MP4 A;  1TW1 A;  4EE3 A;  1ZI5 A;  2FFV A;  4P02 A;  1R80 A;  1H7Q A;  1VZT A;  2P6W A;  4R7P A;  3V91 A;  3SXG A;  4AAW A;  4LW6 A;  5IDS A;  5CQM X;  3V0Q A;  2AEC A;  1R81 A;  1INJ A;  4D11 A;  3OH1 A;  1HM9 A;  3Q7U A;  1ZCU A;  1ZJO A;  2I5E A;  1H4C A;  1VZU A;  4Y7T A;  4DEC A;  1XZ6 A;  2FFU A;  3K8D A;  2AE7 A;  4FRE A;  1H7G A;  3IOH A;  4FRD A;  1VPA A;  1SS9 A;  1VGW A;  4KRV A;  3V8Y A;  4BQH A;  3U2U A;  2JCK A;  4M2A A;  1ZJP A;  2W0V A;  2VXM A;  2Y4M A;  2I5K A;  4KPX A;  2Q4J A;  1YP3 A;  4Y63 A;  1GA8 A;  5CQN X;  3ZLL A;  3I0K A;  4NAL A;  4FRB A;  1FRW A;  3ZF8 A;  4KC4 A;  2AES A;  4B4M A;  4D11 C;  4HCQ A;  4B4G A;  1VH1 A;  1GQ9 A;  4BMA A;  4D0T A;  2OEG A;  4EEA A;  3R2W A;  2AGD A;  1R7V A;  2PGV A;  1JYL A;  3I0I X;  2GGO A;  1ZI4 A;  4ARW A;  2O1G A;  1MC3 A;  1R7T A;  5L6S A;  2WE9 A;  1G0R A;  2E8B A;  1HV9 A;  2V0L A;  4HO6 A;  2YES A;  3I0F A;  3ZGG A;  1ZJ3 A;  3E25 A;  1WT1 A;  4KC1 A;  1OMZ A;  2V0K A;  1H5S B;  3I0C A;  5FUH A;  3SPT A;  5CQO A;  1FXJ A;  1PZT A;  3BRK X;  3CKN A;  5C1L A;  3USQ A;  1QG8 A;  2FY7 A;  2OI6 A;  3CKQ A;  1H5T B;  3F1Y A;  1OMX A;  4KNX A;  1V82 A;  4HOC A;  3F1C A;  5L6V A;  3ZGF A;  5C1H A;  4EVW A;  1FGG A;  3IOI A;  4AYL A;  1NKH B;  1GX0 A;  4J18 A;  2AM4 A;  4D48 A;  4Y7U A;  4HO5 A;  2DPW A;  3GUE A;  2D0J A;  1FZW A;  5CMH A;  1R7X A;  3RMW A;  1TW5 A;  1GQC A;  3RMV A;  4FRP A;  1V84 A;  3T7N A;  3U2X A;  4KNR A;  4MND A;  3ST8 A;  3OH0 A;  1ZDF A;  3I0E A;  5C47 A;  5BXC A;  2FYA A;  5HS2 A;  2VSH A;  3FOQ A;  1H5R B;  1LZ0 A;  5CMG X;  2XWM A;  3K8E A;  2ZU9 A;  1LZI A;  1ZI3 A;  1MP5 A;  1H4D A;  2BO4 A;  2ICX A;  3Q4S A;  1VH3 A;  4EE4 A;  4DE7 A;  3V8Z A;  2V0J A;  1KWS A;  1O7O A;  4HG6 A;  3IOJ A;  2GGQ A;  1QWJ A;  2FYD B;  4FRH A;  4L41 C;  2AM5 A;  3CKO A;  2QH5 A;  1G3L A;  1JV3 A;  1G8O A;  1YRO B;  2FYC B;  3OH4 A;  1R7Y A;  3R3I A;  4ASY A;  1R82 A;  2RJ1 A;  2AM3 A;  2UX8 A;  4Y7V A;  2OI5 A;  4Y64 A;  1G9R A;  2Z86 A;  5JQQ A;  1WVC A;  1H3M A;  1V83 A;  4JIS A;  4E1K A;  1ZCY A;  2VSI A;  2X65 A;  1NQI B;  1W55 A;  1YP2 A;  2A8W A;  4HO9 A;  1WSZ A;  5FU8 A;  4G3S A;  1ZDG A;  2VS5 A;  4P00 A;  5FTS A;  1IIM A;  2W0W A;  2Y7A A;  5AJN A;  1ON6 A;  1NWG B;  3OGZ A;  1FG5 N;  5C3A A;  1FOA A;  2PX7 A;  3PKQ A;  1G97 A;  1INI A;  4M4K A;  2YC3 A;  2X5S A;  1H7E A;  3JUK A;  3O3P A;  2JCJ A;  1HJJ A;  2RJ5 A;  4Y6N A;  4HO0 A;  3T7O A;  2RIX A;  2ZU8 A;  1LL3 A;  2YCM A;  3FWW A;  2WEE A;  3Q80 A;  2APC A;  3U0X A;  4B5B A;  4HO2 A;  1TZF A;  4FRL A;  4G87 A;  4MYB A;  4Y7G A;  3V0N A;  5FYE A;  3USR A;  3U2T A;  1LL0 A;  2I7B A;  1YP4 A;  2P72 A;  3V0M A;  1S4N A;  2VFZ A;  1QGS A;  2AH9 A;  3SX7 A;  1JYK A;  3CKV A;  3RSB A;  2OI7 A;  3OAM A;  1FR9 A;  2ZU7 A;  2WAW A;  3EE5 A;  3SXC A;  4B2X A;  1VGZ A;  2VD4 A;  5C8R A;  1LZJ A;  5C4F A;  1VM8 A;  1K4V A;  1NMM B;  4IRQ A;  1JVD A;  2D7I A;  3TZT A;  4YS8 A;  1EZI A;  3CU0 A;  5EJZ A;  3PKP A;  3DK5 A;  1G95 A;  1ZJ1 A;  1FXO A;  5AJP A;  1FR8 A;  5EIY A;  2X5Z A;  4CVH A;  4LW3 A;  2XWL A;  4XWI A;  4FRQ A;  2VXL A;  4C2S A;  1FGX A;  5C49 A;  2WVL A;  1O7Q A;  1H5S D;  2D7R A;  5CQP A;  3OH2 A;  3I0J A;  3V0L A;  5CMJ A;  4ZDQ A;  5FV9 A;  1WT3 A;  3SXE A;  4HO4 A;  2O1H A;  1G23 A;  1NF5 B;  2A8U A;  5C4B A;  2YQH A;  2JCO A;  4M28 A;  4K6R A;  3U2W A;  3T7M A;  1H5S A;  4CJB A;  1ZHJ A;  1H4E A;  4FRA A;  3JTJ A;  2RIZ A;  1QGQ A;  1ZI1 A;  1Z90 A;  5C1G A;  1H7H A;  1FWY A;  4EEG A;  1H5T A;  4HO8 A;  1JVG A;  3V90 A;  4B4B A;  3SXB A;  1ZJ2 A;  1LZ7 A;  4GBP A;  1HJL A;  2FYB A;  3D5N A;  2Z87 A;  3OKR A;  4ASJ A;  3TQD A;  3PNN A;  3DJ4 A;  3QVB A;  2WGZ A;  3V0O A;  2RJ6 A;  3OH3 A;  5C48 A;  4HO3 A;  3DUV A;  4Y7F A;  1IIN A; 
#chains in the Genus database with same CATH topology
 2RJ4 A;  5CMF X;  5C38 A;  4FCE A;  1FO8 A;  5DDV A;  1W57 A;  2VS3 A;  3D8V A;  3I0H A;  1OQM B;  2CU2 A;  1H5R A;  1E5K A;  4DDZ A;  2WVM A;  4NAI A;  1H5S C;  3SX5 A;  2ICY A;  4B42 A;  1G2V A;  3HL3 A;  4FCU A;  3POL A;  5CMI A;  4NAK A;  4FRO A;  4Y62 A;  2Y4K A;  4FQW A;  2NXV A;  3ZLK A;  2PGY A;  1H7F A;  2X60 A;  4KT7 A;  2YQC A;  2V0I A;  2RJ0 A;  4M2B A;  3CGX A;  4FRM A;  1GWW A;  2Y4L A;  4IRP A;  4AC3 A;  1VGU A;  3SXA A;  1O23 B;  3NGW A;  1GWV A;  1H7T A;  4EE5 A;  4UEG A;  3BCV A;  3I0G A;  3LW6 A;  1JV1 A;  4NAN A;  1HM0 A;  1ZIZ A;  2PA4 A;  1ZCV A;  5IDT A;  3U0Y A;  4Y6U A;  2OEF A;  3SX8 A;  4KC2 A;  5I1F A;  5IFY A;  1ZCT A;  2BO7 A;  2Y6P A;  4Y9X A;  2BO8 A;  2RJ7 A;  2QGI A;  1G93 A;  2XWN A;  5C4C A;  1HM8 A;  4G3Q A;  1NHE B;  5FTV A;  5C36 A;  2RJ9 A;  1GX4 A;  5C3D A;  4ECM A;  2RJ8 A;  3SX3 A;  4EEM A;  1VIC A;  1WT0 A;  1XHB A;  2YQS A;  2QKX A;  2YC5 A;  5CQL X;  3KIA A;  2E3D A;  4FIY A;  1H7L A;  1W77 A;  1S4P A;  3N9W A;  2XMH A;  4CJ8 A;  1ON8 A;  3U2V A;  1EYR A;  5FU0 A;  3SXD A;  2RIY A;  1LVW A;  1R7U A;  4JD0 A;  5C4D A;  2YQJ A;  4G3P A;  4CJC A;  2Y4J A;  3D98 A;  4KPZ A;  5EJ1 A;  5AJO A;  3E26 A;  4EEO A;  2J0A A;  5DDT A;  4D0Z A;  2MZB A;  4KXO A;  1MP3 A;  1G1L A;  2O1F A;  2V0H A;  1ZJ0 A;  2VS4 A;  3JUJ A;  1PZY B;  2WVK A;  3OC9 A;  4B2W A;  5J49 A;  2BO6 A;  5C3B A;  1S4O A;  4B3U A;  1VZX A;  2XME A;  1O0R A;  1LL2 A;  3I0D A;  3V0P A;  4KQL A;  1I52 A;  1WT2 A;  2JCL A;  1VGT A;  1FO9 A;  3CKJ A;  3I0L A;  2P73 A;  4AYJ A;  2RIT A;  1TVY A;  5C4E A;  1MP4 A;  1TW1 A;  4EE3 A;  1ZI5 A;  2FFV A;  4P02 A;  1R80 A;  1H7Q A;  1VZT A;  2P6W A;  4R7P A;  3V91 A;  3SXG A;  4AAW A;  4LW6 A;  5IDS A;  5CQM X;  3V0Q A;  2AEC A;  1R81 A;  1INJ A;  4D11 A;  3OH1 A;  1HM9 A;  3Q7U A;  1ZCU A;  1ZJO A;  2I5E A;  1H4C A;  1VZU A;  4Y7T A;  4DEC A;  1XZ6 A;  2FFU A;  3K8D A;  4O6M A;  2AE7 A;  4FRE A;  1H7G A;  3IOH A;  4FRD A;  1VPA A;  1SS9 A;  1VGW A;  4KRV A;  3V8Y A;  4BQH A;  3U2U A;  2JCK A;  4M2A A;  1ZJP A;  2W0V A;  2VXM A;  2Y4M A;  2I5K A;  4KPX A;  2Q4J A;  1YP3 A;  4Y63 A;  1GA8 A;  5CQN X;  3ZLL A;  3I0K A;  4NAL A;  4FRB A;  1FRW A;  3ZF8 A;  4KC4 A;  2AES A;  4B4M A;  4D11 C;  4HCQ A;  4B4G A;  1VH1 A;  1GQ9 A;  4BMA A;  4D0T A;  2OEG A;  4EEA A;  3R2W A;  2AGD A;  4MIX A;  1R7V A;  2PGV A;  1JYL A;  3I0I X;  2GGO A;  1ZI4 A;  4ARW A;  2O1G A;  5D91 A;  1MC3 A;  1R7T A;  5L6S A;  2WE9 A;  1G0R A;  2E8B A;  1HV9 A;  2V0L A;  4HO6 A;  2YES A;  3I0F A;  3ZGG A;  1ZJ3 A;  3E25 A;  1WT1 A;  4KC1 A;  1OMZ A;  2V0K A;  1H5S B;  3I0C A;  5FUH A;  3SPT A;  2VK9 A;  5CQO A;  1FXJ A;  1PZT A;  3BRK X;  3CKN A;  2J0B A;  5C1L A;  2C0N A;  3USQ A;  1QG8 A;  2FY7 A;  2OI6 A;  3CKQ A;  1H5T B;  3F1Y A;  1OMX A;  4KNX A;  1V82 A;  4HOC A;  3F1C A;  5L6V A;  3ZGF A;  5C1H A;  4EVW A;  1FGG A;  3IOI A;  4AYL A;  1NKH B;  1GX0 A;  4J18 A;  2AM4 A;  4D48 A;  4Y7U A;  4HO5 A;  2DPW A;  3GUE A;  2D0J A;  1FZW A;  5CMH A;  1R7X A;  3RMW A;  1TW5 A;  1GQC A;  3RMV A;  4FRP A;  1V84 A;  3T7N A;  3U2X A;  4KNR A;  4MND A;  3ST8 A;  3OH0 A;  1ZDF A;  3I0E A;  5C47 A;  5BXC A;  2FYA A;  5HS2 A;  2VSH A;  3FOQ A;  1H5R B;  1LZ0 A;  5CMG X;  2XWM A;  3K8E A;  2ZU9 A;  1LZI A;  1ZI3 A;  1MP5 A;  1H4D A;  2BO4 A;  2ICX A;  3Q4S A;  1VH3 A;  4EE4 A;  4DE7 A;  3V8Z A;  2V0J A;  1KWS A;  1O7O A;  4HG6 A;  3IOJ A;  2GGQ A;  1QWJ A;  2FYD B;  4FRH A;  4L41 C;  2AM5 A;  3CKO A;  2QH5 A;  1G3L A;  1JV3 A;  1G8O A;  1YRO B;  2FYC B;  3OH4 A;  1R7Y A;  3R3I A;  4ASY A;  1R82 A;  2RJ1 A;  2AM3 A;  2UX8 A;  4Y7V A;  2OI5 A;  4Y64 A;  1G9R A;  2Z86 A;  5JQQ A;  1WVC A;  4O6N A;  1H3M A;  1V83 A;  4JIS A;  4Q7C A;  4E1K A;  1ZCY A;  5D92 A;  2VSI A;  2X65 A;  1NQI B;  1W55 A;  1YP2 A;  2A8W A;  4HO9 A;  1WSZ A;  5FU8 A;  4G3S A;  1ZDG A;  2VS5 A;  4P00 A;  5FTS A;  1IIM A;  2W0W A;  2Y7A A;  5AJN A;  1ON6 A;  1NWG B;  3OGZ A;  1FG5 N;  5C3A A;  1FOA A;  2PX7 A;  3PKQ A;  1G97 A;  1INI A;  4M4K A;  2YC3 A;  2X5S A;  1H7E A;  3JUK A;  3O3P A;  2JCJ A;  1HJJ A;  2RJ5 A;  4Y6N A;  4HO0 A;  3T7O A;  2RIX A;  2ZU8 A;  1LL3 A;  2YCM A;  3FWW A;  2WEE A;  3Q80 A;  2APC A;  3U0X A;  4B5B A;  4HO2 A;  1TZF A;  4FRL A;  4G87 A;  4MYB A;  4Y7G A;  3V0N A;  5FYE A;  3USR A;  3U2T A;  1LL0 A;  2I7B A;  1YP4 A;  2P72 A;  3V0M A;  1S4N A;  2VFZ A;  1QGS A;  2AH9 A;  3SX7 A;  1JYK A;  3CKV A;  3RSB A;  2OI7 A;  3OAM A;  1FR9 A;  2ZU7 A;  2WAW A;  3EE5 A;  3SXC A;  4B2X A;  1VGZ A;  2VD4 A;  5C8R A;  1LZJ A;  5C4F A;  1VM8 A;  1K4V A;  1NMM B;  4IRQ A;  1JVD A;  2D7I A;  3TZT A;  4YS8 A;  1EZI A;  3CU0 A;  5EJZ A;  3PKP A;  3DK5 A;  1G95 A;  1ZJ1 A;  1FXO A;  5AJP A;  1FR8 A;  5EIY A;  2X5Z A;  4CVH A;  4LW3 A;  2XWL A;  4XWI A;  4FRQ A;  2VXL A;  4C2S A;  1FGX A;  5C49 A;  2WVL A;  1O7Q A;  1H5S D;  2D7R A;  5CQP A;  3OH2 A;  3I0J A;  3V0L A;  5CMJ A;  4ZDQ A;  5FV9 A;  1WT3 A;  3SXE A;  4HO4 A;  2O1H A;  1G23 A;  1NF5 B;  2A8U A;  5C4B A;  2YQH A;  2JCO A;  4M28 A;  4K6R A;  3U2W A;  3T7M A;  1H5S A;  4CJB A;  1ZHJ A;  1H4E A;  4FRA A;  3JTJ A;  2RIZ A;  1QGQ A;  1ZI1 A;  1Z90 A;  5C1G A;  1H7H A;  1FWY A;  4EEG A;  1H5T A;  4HO8 A;  4FIX A;  1JVG A;  3V90 A;  4B4B A;  3SXB A;  1ZJ2 A;  1LZ7 A;  4GBP A;  1HJL A;  2FYB A;  3D5N A;  2Z87 A;  3OKR A;  4ASJ A;  3TQD A;  3PNN A;  3DJ4 A;  3QVB A;  2WGZ A;  3V0O A;  2RJ6 A;  3OH3 A;  5C48 A;  4HO3 A;  3DUV A;  4Y7F A;  1IIN A; 
#chains in the Genus database with same CATH homology
 2RJ4 A;  5CMF X;  5C38 A;  4FCE A;  1FO8 A;  5DDV A;  1W57 A;  2VS3 A;  3D8V A;  3I0H A;  1OQM B;  2CU2 A;  1H5R A;  1E5K A;  4DDZ A;  2WVM A;  4NAI A;  1H5S C;  3SX5 A;  2ICY A;  4B42 A;  1G2V A;  3HL3 A;  4FCU A;  3POL A;  5CMI A;  4NAK A;  4FRO A;  4Y62 A;  2Y4K A;  4FQW A;  2NXV A;  3ZLK A;  2PGY A;  1H7F A;  2X60 A;  4KT7 A;  2YQC A;  2V0I A;  2RJ0 A;  4M2B A;  3CGX A;  4FRM A;  1GWW A;  2Y4L A;  4IRP A;  4AC3 A;  1VGU A;  3SXA A;  1O23 B;  3NGW A;  1GWV A;  1H7T A;  4EE5 A;  4UEG A;  3BCV A;  3I0G A;  3LW6 A;  1JV1 A;  4NAN A;  1HM0 A;  1ZIZ A;  2PA4 A;  1ZCV A;  5IDT A;  3U0Y A;  4Y6U A;  2OEF A;  3SX8 A;  4KC2 A;  5I1F A;  5IFY A;  1ZCT A;  2BO7 A;  2Y6P A;  4Y9X A;  2BO8 A;  2RJ7 A;  2QGI A;  1G93 A;  2XWN A;  5C4C A;  1HM8 A;  4G3Q A;  1NHE B;  5FTV A;  5C36 A;  2RJ9 A;  1GX4 A;  5C3D A;  4ECM A;  2RJ8 A;  3SX3 A;  4EEM A;  1VIC A;  1WT0 A;  1XHB A;  2YQS A;  2QKX A;  2YC5 A;  5CQL X;  3KIA A;  2E3D A;  4FIY A;  1H7L A;  1W77 A;  1S4P A;  3N9W A;  2XMH A;  4CJ8 A;  1ON8 A;  3U2V A;  1EYR A;  5FU0 A;  3SXD A;  2RIY A;  1LVW A;  1R7U A;  4JD0 A;  5C4D A;  2YQJ A;  4G3P A;  4CJC A;  2Y4J A;  3D98 A;  4KPZ A;  5EJ1 A;  5AJO A;  3E26 A;  4EEO A;  2J0A A;  5DDT A;  4D0Z A;  2MZB A;  4KXO A;  1MP3 A;  1G1L A;  2O1F A;  2V0H A;  1ZJ0 A;  2VS4 A;  3JUJ A;  1PZY B;  2WVK A;  3OC9 A;  4B2W A;  5J49 A;  2BO6 A;  5C3B A;  1S4O A;  4B3U A;  1VZX A;  2XME A;  1O0R A;  1LL2 A;  3I0D A;  3V0P A;  4KQL A;  1I52 A;  1WT2 A;  2JCL A;  1VGT A;  1FO9 A;  3CKJ A;  3I0L A;  2P73 A;  4AYJ A;  2RIT A;  1TVY A;  5C4E A;  1MP4 A;  1TW1 A;  4EE3 A;  1ZI5 A;  2FFV A;  4P02 A;  1R80 A;  1H7Q A;  1VZT A;  2P6W A;  4R7P A;  3V91 A;  3SXG A;  4AAW A;  4LW6 A;  5IDS A;  5CQM X;  3V0Q A;  2AEC A;  1R81 A;  1INJ A;  4D11 A;  3OH1 A;  1HM9 A;  3Q7U A;  1ZCU A;  1ZJO A;  2I5E A;  1H4C A;  1VZU A;  4Y7T A;  4DEC A;  1XZ6 A;  2FFU A;  3K8D A;  4O6M A;  2AE7 A;  4FRE A;  1H7G A;  3IOH A;  4FRD A;  1VPA A;  1SS9 A;  1VGW A;  4KRV A;  3V8Y A;  4BQH A;  3U2U A;  2JCK A;  4M2A A;  1ZJP A;  2W0V A;  2VXM A;  2Y4M A;  2I5K A;  4KPX A;  2Q4J A;  1YP3 A;  4Y63 A;  1GA8 A;  5CQN X;  3ZLL A;  3I0K A;  4NAL A;  4FRB A;  1FRW A;  3ZF8 A;  4KC4 A;  2AES A;  4B4M A;  4D11 C;  4HCQ A;  4B4G A;  1VH1 A;  1GQ9 A;  4BMA A;  4D0T A;  2OEG A;  4EEA A;  3R2W A;  2AGD A;  4MIX A;  1R7V A;  2PGV A;  1JYL A;  3I0I X;  2GGO A;  1ZI4 A;  4ARW A;  2O1G A;  5D91 A;  1MC3 A;  1R7T A;  5L6S A;  2WE9 A;  1G0R A;  2E8B A;  1HV9 A;  2V0L A;  4HO6 A;  2YES A;  3I0F A;  3ZGG A;  1ZJ3 A;  3E25 A;  1WT1 A;  4KC1 A;  1OMZ A;  2V0K A;  1H5S B;  3I0C A;  5FUH A;  3SPT A;  2VK9 A;  5CQO A;  1FXJ A;  1PZT A;  3BRK X;  3CKN A;  2J0B A;  5C1L A;  2C0N A;  3USQ A;  1QG8 A;  2FY7 A;  2OI6 A;  3CKQ A;  1H5T B;  3F1Y A;  1OMX A;  4KNX A;  1V82 A;  4HOC A;  3F1C A;  5L6V A;  3ZGF A;  5C1H A;  4EVW A;  1FGG A;  3IOI A;  4AYL A;  1NKH B;  1GX0 A;  4J18 A;  2AM4 A;  4D48 A;  4Y7U A;  4HO5 A;  2DPW A;  3GUE A;  2D0J A;  1FZW A;  5CMH A;  1R7X A;  3RMW A;  1TW5 A;  1GQC A;  3RMV A;  4FRP A;  1V84 A;  3T7N A;  3U2X A;  4KNR A;  4MND A;  3ST8 A;  3OH0 A;  1ZDF A;  3I0E A;  5C47 A;  5BXC A;  2FYA A;  5HS2 A;  2VSH A;  3FOQ A;  1H5R B;  1LZ0 A;  5CMG X;  2XWM A;  3K8E A;  2ZU9 A;  1LZI A;  1ZI3 A;  1MP5 A;  1H4D A;  2BO4 A;  2ICX A;  3Q4S A;  1VH3 A;  4EE4 A;  4DE7 A;  3V8Z A;  2V0J A;  1KWS A;  1O7O A;  4HG6 A;  3IOJ A;  2GGQ A;  1QWJ A;  2FYD B;  4FRH A;  4L41 C;  2AM5 A;  3CKO A;  2QH5 A;  1G3L A;  1JV3 A;  1G8O A;  1YRO B;  2FYC B;  3OH4 A;  1R7Y A;  3R3I A;  4ASY A;  1R82 A;  2RJ1 A;  2AM3 A;  2UX8 A;  4Y7V A;  2OI5 A;  4Y64 A;  1G9R A;  2Z86 A;  5JQQ A;  1WVC A;  4O6N A;  1H3M A;  1V83 A;  4JIS A;  4Q7C A;  4E1K A;  1ZCY A;  5D92 A;  2VSI A;  2X65 A;  1NQI B;  1W55 A;  1YP2 A;  2A8W A;  4HO9 A;  1WSZ A;  5FU8 A;  4G3S A;  1ZDG A;  2VS5 A;  4P00 A;  5FTS A;  1IIM A;  2W0W A;  2Y7A A;  5AJN A;  1ON6 A;  1NWG B;  3OGZ A;  1FG5 N;  5C3A A;  1FOA A;  2PX7 A;  3PKQ A;  1G97 A;  1INI A;  4M4K A;  2YC3 A;  2X5S A;  1H7E A;  3JUK A;  3O3P A;  2JCJ A;  1HJJ A;  2RJ5 A;  4Y6N A;  4HO0 A;  3T7O A;  2RIX A;  2ZU8 A;  1LL3 A;  2YCM A;  3FWW A;  2WEE A;  3Q80 A;  2APC A;  3U0X A;  4B5B A;  4HO2 A;  1TZF A;  4FRL A;  4G87 A;  4MYB A;  4Y7G A;  3V0N A;  5FYE A;  3USR A;  3U2T A;  1LL0 A;  2I7B A;  1YP4 A;  2P72 A;  3V0M A;  1S4N A;  2VFZ A;  1QGS A;  2AH9 A;  3SX7 A;  1JYK A;  3CKV A;  3RSB A;  2OI7 A;  3OAM A;  1FR9 A;  2ZU7 A;  2WAW A;  3EE5 A;  3SXC A;  4B2X A;  1VGZ A;  2VD4 A;  5C8R A;  1LZJ A;  5C4F A;  1VM8 A;  1K4V A;  1NMM B;  4IRQ A;  1JVD A;  2D7I A;  3TZT A;  4YS8 A;  1EZI A;  3CU0 A;  5EJZ A;  3PKP A;  3DK5 A;  1G95 A;  1ZJ1 A;  1FXO A;  5AJP A;  1FR8 A;  5EIY A;  2X5Z A;  4CVH A;  4LW3 A;  2XWL A;  4XWI A;  4FRQ A;  2VXL A;  4C2S A;  1FGX A;  5C49 A;  2WVL A;  1O7Q A;  1H5S D;  2D7R A;  5CQP A;  3OH2 A;  3I0J A;  3V0L A;  5CMJ A;  4ZDQ A;  5FV9 A;  1WT3 A;  3SXE A;  4HO4 A;  2O1H A;  1G23 A;  1NF5 B;  2A8U A;  5C4B A;  2YQH A;  2JCO A;  4M28 A;  4K6R A;  3U2W A;  3T7M A;  1H5S A;  4CJB A;  1ZHJ A;  1H4E A;  4FRA A;  3JTJ A;  2RIZ A;  1QGQ A;  1ZI1 A;  1Z90 A;  5C1G A;  1H7H A;  1FWY A;  4EEG A;  1H5T A;  4HO8 A;  4FIX A;  1JVG A;  3V90 A;  4B4B A;  3SXB A;  1ZJ2 A;  1LZ7 A;  4GBP A;  1HJL A;  2FYB A;  3D5N A;  2Z87 A;  3OKR A;  4ASJ A;  3TQD A;  3PNN A;  3DJ4 A;  3QVB A;  2WGZ A;  3V0O A;  2RJ6 A;  3OH3 A;  5C48 A;  4HO3 A;  3DUV A;  4Y7F A;  1IIN A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...