1H5SA

Thymidylyltransferase complexed with tmp
Total Genus 101
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
101
sequence length
290
structure length
290
Chain Sequence
KMRKGIILAGGSGTRLYPVTMAVSKQLLPIYDKPMIYYPLSTLMLAGIRDILIISTPQDTPRFQQLLGDGSQWGLNLQYKVQPSPDGLAQAFIIGEEFIGGDDCALVLGDNIFYGHDLPKLMEAAVNKESGATVFAYHVNDPERYGVVEFDKNGTAISLEEKPLEPKSNYAVTGLYFYDNDVVLMAKNLKPSARGELEITDINRIYLEQGRLSVALMGRGYAWLDTGTHQSLIEASNFIATIEERQGLKVSCPEEIAFRKGFIDVEQVRKLAVPLIKNNYGQYLYKMTKD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords Glucose-1-phosphate thymidylyltransferase 1
publication title Kinetic and crystallographic analyses support a sequential-ordered bi bi catalytic mechanism for Escherichia coli glucose-1-phosphate thymidylyltransferase.
pubmed doi rcsb
source organism Escherichia coli
total genus 101
structure length 290
sequence length 290
ec nomenclature ec 2.7.7.24: Glucose-1-phosphate thymidylyltransferase.
pdb deposition date 2001-05-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00483 NTP_transferase Nucleotidyl transferase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.550.10 Alpha Beta Alpha-Beta Complex Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A 1h5sA00
2YQJA 4D0ZA 1H5SC 3SPTA 2YQCA 3PKPA 3OGZA 1VH1A 4HOCA 2JCOA 2VSIA 3BCVA 4JD0A 3USQA 4C2SA 1HM8A 1G93A 2RJ6A 2A8WA 4Y7FA 1V83A 3PNNA 1HM0A 3D98A 3HL3A 2W0WA 4D11C 2Z87A 1H7EA 1WT3A 1VM8A 1WT2A 2QGIA 2Y4KA 4HO5A 4Y6UA 2AGDA 4Y7GA 1W57A 1O0RA 1ZJPA 2CU2A 3E25A 5C4CA 1G3LA 2D7RA 2VXMA 4KT7A 5CMJA 2RJ0A 1R80A 4Y7TA 4ZDQA 3SX8A 1OQMB 1VPAA 3U2TA 4FRAA 1GQ9A 2YC5A 1TW1A 5C4EA 4NANA 4Y64A 2X5SA 5C1HA 3I0CA 3KIAA 3OH0A 3CKVA 4G87A 1FXJA 1VICA 2QKXA 4EE4A 5FU0A 3U0YA 1S4PA 4ECMA 2NXVA 1GQCA 4B42A 4YS8A 1FZWA 3OH1A 5C4DA 1NHEB 1ZI3A 4NAIA 4KNRA 1H5SA 3U2UA 2P73A 4BQHA 1YROB 4DECA 5IDTA 2JCJA 4EEMA 4IRPA 3ZLKA 3SX3A 4B3UA 2Q4JA 1ZI5A 4GBPA 1VZXA 1TZFA 1LVWA 1MP3A 2PGVA 5BXCA 2XMHA 1ZI1A 2Y4MA 2YQHA 4CVHA 3ZGGA 5DDTA 3RMWA 2Y7AA 2AM3A 2A8UA 1NWGB 5C4FA 3V91A 1PZTA 4KRVA 5L6SA 2Y4JA 5CQNX 1H7HA 4P02A 1TVYA 4B5BA 3TQDA 4FROA 4LW3A 1H4EA 1H7TA 1ZJ0A 1R7UA 5AJOA 4B4GA 3OAMA 2WAWA 2BO6A 3V8ZA 2APCA 4M4KA 1ZHJA 1VGTA 2FYBA 4NAKA 2VXLA 3I0KA 3SXDA 1LZIA 2E8BA 1G8OA 4B2WA 3TZTA 1R7XA 1H4CA 4EE3A 2I7BA 1W55A 2RIYA 4EEOA 1JYKA 2XWMA 3DUVA 5CMIA 2BO8A 1XZ6A 3ST8A 1ZJ2A 5AJNA 4B4BA 3SXCA 3OH4A 3I0EA 4EEAA 3K8DA 3K8EA 1NKHB 4EEGA 1MP4A 4M28A 4NALA 3T7OA 3BRKX 5IDSA 1E5KA 3I0IX 5C36A 1FO8A 2OEFA 2RJ9A 1YP2A 2V0KA 4G3PA 3R2WA 4FRHA 4CJ8A 3SX7A 1ZDFA 5C4BA 4CJBA 1GWWA 2RITA 1S4NA 2Y4LA 2W0VA 2QH5A 3USRA 2O1GA 1W77A 1HJLA 2ZU8A 1ZJ1A 3E26A 1YP4A 2MZBA 3FOQA 3I0DA 5L6VA 1GWVA 3NGWA 5FTVA 4FRMA 5FU8A 1G2VA 2GGOA 3SXEA 5CQLX 3CKJA 2V0JA 1VGWA 3IOJA 5EJZA 3SXBA 2OI5A 1FGXA 2RIXA 2VD4A 4B2XA 2D7IA 4E1KA 4CJCA 1VZTA 3I0HA 5CQOA 1JVDA 4Y63A 3V0MA 4AAWA 2PGYA 3LW6A 4HG6A 5FYEA 1H7QA 2XMEA 5CMHA 3RMVA 5C47A 3OKRA 5CQMX 2YC3A 4D11A 1FR9A 1G0RA 1WSZA 3I0FA 3JTJA 4KC1A 1ZCTA 4L41C 2X60A 4HO9A 3D5NA 3FWWA 1ZI4A 4FRDA 5C3DA 1K4VA 1R82A 2WVMA 1QGSA 2OEGA 3CKNA 1SS9A 1QG8A 2ZU7A 2V0HA 2FFVA 1GA8A 3I0GA 1GX0A 4J18A 5CMGX 1ZJOA 1S4OA 1NQIB 2RJ4A 1FO9A 3POLA 1JV3A 1GX4A 3D8VA 4ASYA 4Y7VA 1ZCUA 1OMXA 1FWYA 1H5SB 1H5RA 3ZGFA 2I5EA 4HO3A 1R81A 1JV1A 5C1LA 4KPXA 1H3MA 1ON6A 2D0JA 3CGXA 3CU0A 4MNDA 5JQQA 2RJ5A 3SX5A 4ARWA 1IIMA 4G3SA 1OMZA 3SXAA 2FY7A 4LW6A 3QVBA 2OI7A 1WVCA 3RSBA 2AESA 1G9RA 3Q7UA 1VGUA 1VGZA 3U2VA 4HO8A 4FREA 5IFYA 4UEGA 1O7QA 5FV9A 3U2WA 1PZYB 3JUKA 1FRWA 4HO4A 3DK5A 5C1GA 2Z86A 4HO0A 3V0OA 1H5SD 1IINA 4FRPA 1Z90A 3T7NA 3EE5A 5HS2A 1ZCVA 4KC2A 2P6WA 1H7FA 1VH3A 1QWJA 3OH3A 5J49A 2RIZA 2YCMA 4Y62A 1H7GA 5FUHA 2FYAA 2VS4A 4MYBA 2O1FA 1ON8A 4FRBA 4BMAA 2AE7A 1HV9A 1JYLA 3IOIA 3ZLLA 2RJ1A 1LZ0A 4XWIA 3OH2A 4HCQA 5CMFX 4AYJA 2WVKA 3U0XA 4FCUA 4Y6NA 1ZIZA 3DJ4A 3IOHA 1O7OA 4KQLA 2WE9A 3CKOA 2XWLA 2RJ7A 1G97A 2ICXA 2YESA 4D48A 2Y6PA 4FRLA 2WEEA 4M2AA 1O23B 4HO2A 3SXGA 4EVWA 1G23A 2FYCB 2YQSA 1H5TA 5C8RA 3OC9A 4FRQA 3V8YA 3O3PA 1JVGA 2X5ZA 5FTSA 1V82A 5AJPA 3Q80A 2BO4A 3PKQA 4ASJA 3F1YA 1FXOA 4EE5A 4P00A 3R3IA 2VS3A 4FQWA 2UX8A 1MP5A 4DE7A 1INIA 1R7YA 2P72A 1QGQA 2PA4A 2JCKA 2O1HA 3ZF8A 2OI6A 3I0JA 1H7LA 2BO7A 4KPZA 3F1CA 1INJA 1KWSA 3U2XA 4G3QA 5C38A 1I52A 2AH9A 2X65A 1H5TB 4JISA 2E3DA 4FCEA 1LZ7A 1ZJ3A 1FGGA 3T7MA 2AM4A 1HM9A 2GGQA 2I5KA 3GUEA 1R7TA 2AM5A 2WGZA 5C49A 4IRQA 5C3BA 4D0TA 1TW5A 1ZCYA 1HJJA 2AECA 1FG5N 1NF5B 1EYRA 1V84A 1XHBA 3JUJA 2PX7A 2WVLA 5I1FA 5CQPA 3V90A 2DPWA 4DDZA 4R7PA 1LZJA 1R7VA 5DDVA 1NMMB 3N9WA 3V0QA 5EJ1A 5C3AA 1G95A 1WT1A 3V0PA 4M2BA 1H4DA 1LL3A 1FOAA 3V0LA 1MC3A 1G1LA 4Y9XA 1FR8A 3CKQA 1EZIA 4KC4A 4KNXA 5EIYA 2VSHA 2VFZA 4K6RA 1WT0A 2RJ8A 1YP3A 1ZDGA 1LL2A 2JCLA 4HO6A 1LL0A 1H5RB 2V0IA 4KXOA 2ICYA 1VZUA 3Q4SA 2ZU9A 2VS5A 4Y7UA 5C48A 2FYDB 4AYLA 3V0NA 4B4MA 3I0LA 2V0LA 4AC3A 2XWNA 2FFUA
chains in the Genus database with same CATH superfamily
2YQJA 4D0ZA 1H5SC 3SPTA 2YQCA 3PKPA 3OGZA 1VH1A 4HOCA 2JCOA 2VSIA 3BCVA 4JD0A 3USQA 4C2SA 1HM8A 1G93A 2RJ6A 2A8WA 4Y7FA 1V83A 3PNNA 1HM0A 3D98A 3HL3A 2W0WA 4D11C 2Z87A 1H7EA 1WT3A 1VM8A 1WT2A 2QGIA 2Y4KA 4HO5A 4Y6UA 2AGDA 4Y7GA 1W57A 1O0RA 1ZJPA 2CU2A 3E25A 5C4CA 1G3LA 2D7RA 2VXMA 4KT7A 5CMJA 2RJ0A 1R80A 4Y7TA 4ZDQA 3SX8A 1OQMB 1VPAA 3U2TA 4FRAA 1GQ9A 2YC5A 1TW1A 5C4EA 4NANA 4Y64A 2X5SA 5C1HA 3I0CA 3KIAA 3OH0A 5D92A 3CKVA 4G87A 1FXJA 1VICA 2QKXA 4EE4A 5FU0A 3U0YA 1S4PA 4ECMA 2NXVA 1GQCA 4B42A 4YS8A 1FZWA 3OH1A 5C4DA 1NHEB 1ZI3A 4NAIA 4KNRA 1H5SA 3U2UA 2P73A 4BQHA 1YROB 4DECA 5IDTA 2JCJA 4EEMA 4IRPA 3ZLKA 3SX3A 4B3UA 2Q4JA 1ZI5A 4GBPA 1VZXA 1TZFA 1LVWA 1MP3A 2PGVA 5BXCA 2XMHA 1ZI1A 2Y4MA 2YQHA 4CVHA 3ZGGA 5DDTA 3RMWA 2Y7AA 2AM3A 2A8UA 1NWGB 5C4FA 4FIXA 3V91A 1PZTA 4KRVA 5L6SA 2Y4JA 5CQNX 1H7HA 4P02A 1TVYA 4B5BA 3TQDA 4FROA 4LW3A 1H4EA 1H7TA 1ZJ0A 1R7UA 5AJOA 4B4GA 3OAMA 2WAWA 2BO6A 3V8ZA 2APCA 4M4KA 1ZHJA 1VGTA 2FYBA 4NAKA 2VXLA 3I0KA 3SXDA 1LZIA 2E8BA 1G8OA 4B2WA 3TZTA 1R7XA 1H4CA 4EE3A 2I7BA 1W55A 2RIYA 5D91A 4EEOA 1JYKA 2XWMA 3DUVA 5CMIA 2BO8A 1XZ6A 3ST8A 1ZJ2A 5AJNA 4B4BA 3SXCA 3OH4A 3I0EA 4EEAA 3K8DA 3K8EA 1NKHB 4EEGA 1MP4A 4M28A 4NALA 3T7OA 3BRKX 5IDSA 1E5KA 3I0IX 5C36A 1FO8A 2OEFA 2RJ9A 1YP2A 2V0KA 4G3PA 3R2WA 4FRHA 4CJ8A 3SX7A 1ZDFA 5C4BA 4CJBA 1GWWA 2RITA 1S4NA 2Y4LA 2W0VA 2QH5A 3USRA 2O1GA 1W77A 1HJLA 2ZU8A 1ZJ1A 3E26A 1YP4A 2MZBA 3FOQA 3I0DA 5L6VA 1GWVA 3NGWA 5FTVA 4FRMA 5FU8A 1G2VA 2GGOA 3SXEA 5CQLX 3CKJA 2V0JA 1VGWA 3IOJA 5EJZA 3SXBA 2OI5A 1FGXA 2RIXA 2VD4A 4B2XA 2D7IA 4E1KA 4CJCA 1VZTA 3I0HA 5CQOA 1JVDA 4Y63A 3V0MA 4AAWA 2PGYA 3LW6A 4HG6A 5FYEA 1H7QA 2XMEA 5CMHA 3RMVA 5C47A 3OKRA 5CQMX 2YC3A 4D11A 1FR9A 1G0RA 1WSZA 3I0FA 3JTJA 4KC1A 1ZCTA 4L41C 2X60A 4HO9A 3D5NA 3FWWA 1ZI4A 4FRDA 5C3DA 1K4VA 1R82A 2WVMA 1QGSA 2OEGA 3CKNA 1SS9A 1QG8A 2ZU7A 2V0HA 2FFVA 1GA8A 3I0GA 1GX0A 4J18A 4O6NA 2VK9A 5CMGX 1ZJOA 1S4OA 1NQIB 2RJ4A 1FO9A 3POLA 1JV3A 1GX4A 3D8VA 4ASYA 4Y7VA 1ZCUA 1OMXA 1FWYA 1H5SB 1H5RA 2J0AA 3ZGFA 2I5EA 4HO3A 1R81A 1JV1A 2J0BA 5C1LA 4KPXA 1H3MA 1ON6A 2D0JA 3CGXA 3CU0A 4MNDA 5JQQA 2RJ5A 3SX5A 4ARWA 1IIMA 4G3SA 1OMZA 3SXAA 2FY7A 4LW6A 3QVBA 2OI7A 1WVCA 3RSBA 2AESA 1G9RA 3Q7UA 1VGUA 1VGZA 3U2VA 4HO8A 4FREA 5IFYA 4UEGA 1O7QA 5FV9A 3U2WA 1PZYB 3JUKA 1FRWA 4HO4A 3DK5A 5C1GA 2Z86A 4HO0A 3V0OA 1H5SD 1IINA 2C0NA 4FRPA 1Z90A 3T7NA 3EE5A 5HS2A 1ZCVA 4KC2A 2P6WA 1H7FA 1VH3A 1QWJA 3OH3A 5J49A 2RIZA 2YCMA 4Y62A 1H7GA 5FUHA 2FYAA 2VS4A 4MYBA 4Q7CA 2O1FA 1ON8A 4FIYA 4FRBA 4BMAA 2AE7A 1HV9A 1JYLA 3IOIA 3ZLLA 2RJ1A 1LZ0A 4XWIA 3OH2A 4HCQA 5CMFX 4AYJA 2WVKA 3U0XA 4FCUA 4Y6NA 1ZIZA 3DJ4A 3IOHA 1O7OA 4KQLA 2WE9A 3CKOA 2XWLA 2RJ7A 1G97A 2ICXA 2YESA 4D48A 2Y6PA 4FRLA 2WEEA 4M2AA 1O23B 4HO2A 3SXGA 4EVWA 1G23A 2FYCB 2YQSA 1H5TA 5C8RA 3OC9A 4FRQA 3V8YA 3O3PA 1JVGA 2X5ZA 5FTSA 1V82A 5AJPA 3Q80A 2BO4A 3PKQA 4ASJA 3F1YA 1FXOA 4EE5A 4P00A 3R3IA 2VS3A 4FQWA 2UX8A 1MP5A 4DE7A 1INIA 1R7YA 2P72A 1QGQA 2PA4A 2JCKA 2O1HA 3ZF8A 2OI6A 3I0JA 1H7LA 2BO7A 4KPZA 3F1CA 1INJA 1KWSA 3U2XA 4G3QA 5C38A 1I52A 2AH9A 2X65A 1H5TB 4JISA 2E3DA 4FCEA 1LZ7A 1ZJ3A 1FGGA 3T7MA 2AM4A 1HM9A 2GGQA 2I5KA 3GUEA 1R7TA 2AM5A 2WGZA 5C49A 4IRQA 5C3BA 4D0TA 1TW5A 1ZCYA 1HJJA 2AECA 1FG5N 1NF5B 1EYRA 1V84A 1XHBA 3JUJA 2PX7A 2WVLA 5I1FA 5CQPA 3V90A 2DPWA 4DDZA 4R7PA 1LZJA 1R7VA 5DDVA 1NMMB 3N9WA 3V0QA 5EJ1A 5C3AA 1G95A 1WT1A 3V0PA 4M2BA 1H4DA 1LL3A 1FOAA 3V0LA 1MC3A 1G1LA 4Y9XA 1FR8A 4MIXA 3CKQA 1EZIA 4KC4A 4KNXA 5EIYA 2VSHA 2VFZA 4K6RA 1WT0A 2RJ8A 1YP3A 1ZDGA 4O6MA 1LL2A 2JCLA 4HO6A 1LL0A 1H5RB 2V0IA 4KXOA 2ICYA 1VZUA 3Q4SA 2ZU9A 2VS5A 4Y7UA 5C48A 2FYDB 4AYLA 3V0NA 4B4MA 3I0LA 2V0LA 4AC3A 2XWNA 2FFUA
chains in the Genus database with same CATH topology
2YQJA 4D0ZA 1H5SC 3SPTA 2YQCA 3PKPA 3OGZA 1VH1A 4HOCA 2JCOA 2VSIA 3BCVA 4JD0A 3USQA 4C2SA 1HM8A 1G93A 2RJ6A 2A8WA 4Y7FA 1V83A 3PNNA 1HM0A 3D98A 3HL3A 2W0WA 4D11C 2Z87A 1H7EA 1WT3A 1VM8A 1WT2A 2QGIA 2Y4KA 4HO5A 4Y6UA 2AGDA 4Y7GA 1W57A 1O0RA 1ZJPA 2CU2A 3E25A 5C4CA 1G3LA 2D7RA 2VXMA 4KT7A 5CMJA 2RJ0A 1R80A 4Y7TA 4ZDQA 3SX8A 1OQMB 1VPAA 3U2TA 4FRAA 1GQ9A 2YC5A 1TW1A 5C4EA 4NANA 4Y64A 2X5SA 5C1HA 3I0CA 3KIAA 3OH0A 5D92A 3CKVA 4G87A 1FXJA 1VICA 2QKXA 4EE4A 5FU0A 3U0YA 1S4PA 4ECMA 2NXVA 1GQCA 4B42A 4YS8A 1FZWA 3OH1A 5C4DA 1NHEB 1ZI3A 4NAIA 4KNRA 1H5SA 3U2UA 2P73A 4BQHA 1YROB 4DECA 5IDTA 2JCJA 4EEMA 4IRPA 3ZLKA 3SX3A 4B3UA 2Q4JA 1ZI5A 4GBPA 1VZXA 1TZFA 1LVWA 1MP3A 2PGVA 5BXCA 2XMHA 1ZI1A 2Y4MA 2YQHA 4CVHA 3ZGGA 5DDTA 3RMWA 2Y7AA 2AM3A 2A8UA 1NWGB 5C4FA 4FIXA 3V91A 1PZTA 4KRVA 5L6SA 2Y4JA 5CQNX 1H7HA 4P02A 1TVYA 4B5BA 3TQDA 4FROA 4LW3A 1H4EA 1H7TA 1ZJ0A 1R7UA 5AJOA 4B4GA 3OAMA 2WAWA 2BO6A 3V8ZA 2APCA 4M4KA 1ZHJA 1VGTA 2FYBA 4NAKA 2VXLA 3I0KA 3SXDA 1LZIA 2E8BA 1G8OA 4B2WA 3TZTA 1R7XA 1H4CA 4EE3A 2I7BA 1W55A 2RIYA 5D91A 4EEOA 1JYKA 2XWMA 3DUVA 5CMIA 2BO8A 1XZ6A 3ST8A 1ZJ2A 5AJNA 4B4BA 3SXCA 3OH4A 3I0EA 4EEAA 3K8DA 3K8EA 1NKHB 4EEGA 1MP4A 4M28A 4NALA 3T7OA 3BRKX 5IDSA 1E5KA 3I0IX 5C36A 1FO8A 2OEFA 2RJ9A 1YP2A 2V0KA 4G3PA 3R2WA 4FRHA 4CJ8A 3SX7A 1ZDFA 5C4BA 4CJBA 1GWWA 2RITA 1S4NA 2Y4LA 2W0VA 2QH5A 3USRA 2O1GA 1W77A 1HJLA 2ZU8A 1ZJ1A 3E26A 1YP4A 2MZBA 3FOQA 3I0DA 5L6VA 1GWVA 3NGWA 5FTVA 4FRMA 5FU8A 1G2VA 2GGOA 3SXEA 5CQLX 3CKJA 2V0JA 1VGWA 3IOJA 5EJZA 3SXBA 2OI5A 1FGXA 2RIXA 2VD4A 4B2XA 2D7IA 4E1KA 4CJCA 1VZTA 3I0HA 5CQOA 1JVDA 4Y63A 3V0MA 4AAWA 2PGYA 3LW6A 4HG6A 5FYEA 1H7QA 2XMEA 5CMHA 3RMVA 5C47A 3OKRA 5CQMX 2YC3A 4D11A 1FR9A 1G0RA 1WSZA 3I0FA 3JTJA 4KC1A 1ZCTA 4L41C 2X60A 4HO9A 3D5NA 3FWWA 1ZI4A 4FRDA 5C3DA 1K4VA 1R82A 2WVMA 1QGSA 2OEGA 3CKNA 1SS9A 1QG8A 2ZU7A 2V0HA 2FFVA 1GA8A 3I0GA 1GX0A 4J18A 4O6NA 2VK9A 5CMGX 1ZJOA 1S4OA 1NQIB 2RJ4A 1FO9A 3POLA 1JV3A 1GX4A 3D8VA 4ASYA 4Y7VA 1ZCUA 1OMXA 1FWYA 1H5SB 1H5RA 2J0AA 3ZGFA 2I5EA 4HO3A 1R81A 1JV1A 2J0BA 5C1LA 4KPXA 1H3MA 1ON6A 2D0JA 3CGXA 3CU0A 4MNDA 5JQQA 2RJ5A 3SX5A 4ARWA 1IIMA 4G3SA 1OMZA 3SXAA 2FY7A 4LW6A 3QVBA 2OI7A 1WVCA 3RSBA 2AESA 1G9RA 3Q7UA 1VGUA 1VGZA 3U2VA 4HO8A 4FREA 5IFYA 4UEGA 1O7QA 5FV9A 3U2WA 1PZYB 3JUKA 1FRWA 4HO4A 3DK5A 5C1GA 2Z86A 4HO0A 3V0OA 1H5SD 1IINA 2C0NA 4FRPA 1Z90A 3T7NA 3EE5A 5HS2A 1ZCVA 4KC2A 2P6WA 1H7FA 1VH3A 1QWJA 3OH3A 5J49A 2RIZA 2YCMA 4Y62A 1H7GA 5FUHA 2FYAA 2VS4A 4MYBA 4Q7CA 2O1FA 1ON8A 4FIYA 4FRBA 4BMAA 2AE7A 1HV9A 1JYLA 3IOIA 3ZLLA 2RJ1A 1LZ0A 4XWIA 3OH2A 4HCQA 5CMFX 4AYJA 2WVKA 3U0XA 4FCUA 4Y6NA 1ZIZA 3DJ4A 3IOHA 1O7OA 4KQLA 2WE9A 3CKOA 2XWLA 2RJ7A 1G97A 2ICXA 2YESA 4D48A 2Y6PA 4FRLA 2WEEA 4M2AA 1O23B 4HO2A 3SXGA 4EVWA 1G23A 2FYCB 2YQSA 1H5TA 5C8RA 3OC9A 4FRQA 3V8YA 3O3PA 1JVGA 2X5ZA 5FTSA 1V82A 5AJPA 3Q80A 2BO4A 3PKQA 4ASJA 3F1YA 1FXOA 4EE5A 4P00A 3R3IA 2VS3A 4FQWA 2UX8A 1MP5A 4DE7A 1INIA 1R7YA 2P72A 1QGQA 2PA4A 2JCKA 2O1HA 3ZF8A 2OI6A 3I0JA 1H7LA 2BO7A 4KPZA 3F1CA 1INJA 1KWSA 3U2XA 4G3QA 5C38A 1I52A 2AH9A 2X65A 1H5TB 4JISA 2E3DA 4FCEA 1LZ7A 1ZJ3A 1FGGA 3T7MA 2AM4A 1HM9A 2GGQA 2I5KA 3GUEA 1R7TA 2AM5A 2WGZA 5C49A 4IRQA 5C3BA 4D0TA 1TW5A 1ZCYA 1HJJA 2AECA 1FG5N 1NF5B 1EYRA 1V84A 1XHBA 3JUJA 2PX7A 2WVLA 5I1FA 5CQPA 3V90A 2DPWA 4DDZA 4R7PA 1LZJA 1R7VA 5DDVA 1NMMB 3N9WA 3V0QA 5EJ1A 5C3AA 1G95A 1WT1A 3V0PA 4M2BA 1H4DA 1LL3A 1FOAA 3V0LA 1MC3A 1G1LA 4Y9XA 1FR8A 4MIXA 3CKQA 1EZIA 4KC4A 4KNXA 5EIYA 2VSHA 2VFZA 4K6RA 1WT0A 2RJ8A 1YP3A 1ZDGA 4O6MA 1LL2A 2JCLA 4HO6A 1LL0A 1H5RB 2V0IA 4KXOA 2ICYA 1VZUA 3Q4SA 2ZU9A 2VS5A 4Y7UA 5C48A 2FYDB 4AYLA 3V0NA 4B4MA 3I0LA 2V0LA 4AC3A 2XWNA 2FFUA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2YQJ A;  4D0Z A;  1H5S C;  3SPT A;  2YQC A;  3PKP A;  3OGZ A;  1VH1 A;  4HOC A;  2JCO A;  2VSI A;  3BCV A;  4JD0 A;  3USQ A;  4C2S A;  1HM8 A;  1G93 A;  2RJ6 A;  2A8W A;  4Y7F A;  1V83 A;  3PNN A;  1HM0 A;  3D98 A;  3HL3 A;  2W0W A;  4D11 C;  2Z87 A;  1H7E A;  1WT3 A;  1VM8 A;  1WT2 A;  2QGI A;  2Y4K A;  4HO5 A;  4Y6U A;  2AGD A;  4Y7G A;  1W57 A;  1O0R A;  1ZJP A;  2CU2 A;  3E25 A;  5C4C A;  1G3L A;  2D7R A;  2VXM A;  4KT7 A;  5CMJ A;  2RJ0 A;  1R80 A;  4Y7T A;  4ZDQ A;  3SX8 A;  1OQM B;  1VPA A;  3U2T A;  4FRA A;  1GQ9 A;  2YC5 A;  1TW1 A;  5C4E A;  4NAN A;  4Y64 A;  2X5S A;  5C1H A;  3I0C A;  3KIA A;  3OH0 A;  3CKV A;  4G87 A;  1FXJ A;  1VIC A;  2QKX A;  4EE4 A;  5FU0 A;  3U0Y A;  1S4P A;  4ECM A;  2NXV A;  1GQC A;  4B42 A;  4YS8 A;  1FZW A;  3OH1 A;  5C4D A;  1NHE B;  1ZI3 A;  4NAI A;  4KNR A;  1H5S A;  3U2U A;  2P73 A;  4BQH A;  1YRO B;  4DEC A;  5IDT A;  2JCJ A;  4EEM A;  4IRP A;  3ZLK A;  3SX3 A;  4B3U A;  2Q4J A;  1ZI5 A;  4GBP A;  1VZX A;  1TZF A;  1LVW A;  1MP3 A;  2PGV A;  5BXC A;  2XMH A;  1ZI1 A;  2Y4M A;  2YQH A;  4CVH A;  3ZGG A;  5DDT A;  3RMW A;  2Y7A A;  2AM3 A;  2A8U A;  1NWG B;  5C4F A;  3V91 A;  1PZT A;  4KRV A;  5L6S A;  2Y4J A;  5CQN X;  1H7H A;  4P02 A;  1TVY A;  4B5B A;  3TQD A;  4FRO A;  4LW3 A;  1H4E A;  1H7T A;  1ZJ0 A;  1R7U A;  5AJO A;  4B4G A;  3OAM A;  2WAW A;  2BO6 A;  3V8Z A;  2APC A;  4M4K A;  1ZHJ A;  1VGT A;  2FYB A;  4NAK A;  2VXL A;  3I0K A;  3SXD A;  1LZI A;  2E8B A;  1G8O A;  4B2W A;  3TZT A;  1R7X A;  1H4C A;  4EE3 A;  2I7B A;  1W55 A;  2RIY A;  4EEO A;  1JYK A;  2XWM A;  3DUV A;  5CMI A;  2BO8 A;  1XZ6 A;  3ST8 A;  1ZJ2 A;  5AJN A;  4B4B A;  3SXC A;  3OH4 A;  3I0E A;  4EEA A;  3K8D A;  3K8E A;  1NKH B;  4EEG A;  1MP4 A;  4M28 A;  4NAL A;  3T7O A;  3BRK X;  5IDS A;  1E5K A;  3I0I X;  5C36 A;  1FO8 A;  2OEF A;  2RJ9 A;  1YP2 A;  2V0K A;  4G3P A;  3R2W A;  4FRH A;  4CJ8 A;  3SX7 A;  1ZDF A;  5C4B A;  4CJB A;  1GWW A;  2RIT A;  1S4N A;  2Y4L A;  2W0V A;  2QH5 A;  3USR A;  2O1G A;  1W77 A;  1HJL A;  2ZU8 A;  1ZJ1 A;  3E26 A;  1YP4 A;  2MZB A;  3FOQ A;  3I0D A;  5L6V A;  1GWV A;  3NGW A;  5FTV A;  4FRM A;  5FU8 A;  1G2V A;  2GGO A;  3SXE A;  5CQL X;  3CKJ A;  2V0J A;  1VGW A;  3IOJ A;  5EJZ A;  3SXB A;  2OI5 A;  1FGX A;  2RIX A;  2VD4 A;  4B2X A;  2D7I A;  4E1K A;  4CJC A;  1VZT A;  3I0H A;  5CQO A;  1JVD A;  4Y63 A;  3V0M A;  4AAW A;  2PGY A;  3LW6 A;  4HG6 A;  5FYE A;  1H7Q A;  2XME A;  5CMH A;  3RMV A;  5C47 A;  3OKR A;  5CQM X;  2YC3 A;  4D11 A;  1FR9 A;  1G0R A;  1WSZ A;  3I0F A;  3JTJ A;  4KC1 A;  1ZCT A;  4L41 C;  2X60 A;  4HO9 A;  3D5N A;  3FWW A;  1ZI4 A;  4FRD A;  5C3D A;  1K4V A;  1R82 A;  2WVM A;  1QGS A;  2OEG A;  3CKN A;  1SS9 A;  1QG8 A;  2ZU7 A;  2V0H A;  2FFV A;  1GA8 A;  3I0G A;  1GX0 A;  4J18 A;  5CMG X;  1ZJO A;  1S4O A;  1NQI B;  2RJ4 A;  1FO9 A;  3POL A;  1JV3 A;  1GX4 A;  3D8V A;  4ASY A;  4Y7V A;  1ZCU A;  1OMX A;  1FWY A;  1H5S B;  1H5R A;  3ZGF A;  2I5E A;  4HO3 A;  1R81 A;  1JV1 A;  5C1L A;  4KPX A;  1H3M A;  1ON6 A;  2D0J A;  3CGX A;  3CU0 A;  4MND A;  5JQQ A;  2RJ5 A;  3SX5 A;  4ARW A;  1IIM A;  4G3S A;  1OMZ A;  3SXA A;  2FY7 A;  4LW6 A;  3QVB A;  2OI7 A;  1WVC A;  3RSB A;  2AES A;  1G9R A;  3Q7U A;  1VGU A;  1VGZ A;  3U2V A;  4HO8 A;  4FRE A;  5IFY A;  4UEG A;  1O7Q A;  5FV9 A;  3U2W A;  1PZY B;  3JUK A;  1FRW A;  4HO4 A;  3DK5 A;  5C1G A;  2Z86 A;  4HO0 A;  3V0O A;  1H5S D;  1IIN A;  4FRP A;  1Z90 A;  3T7N A;  3EE5 A;  5HS2 A;  1ZCV A;  4KC2 A;  2P6W A;  1H7F A;  1VH3 A;  1QWJ A;  3OH3 A;  5J49 A;  2RIZ A;  2YCM A;  4Y62 A;  1H7G A;  5FUH A;  2FYA A;  2VS4 A;  4MYB A;  2O1F A;  1ON8 A;  4FRB A;  4BMA A;  2AE7 A;  1HV9 A;  1JYL A;  3IOI A;  3ZLL A;  2RJ1 A;  1LZ0 A;  4XWI A;  3OH2 A;  4HCQ A;  5CMF X;  4AYJ A;  2WVK A;  3U0X A;  4FCU A;  4Y6N A;  1ZIZ A;  3DJ4 A;  3IOH A;  1O7O A;  4KQL A;  2WE9 A;  3CKO A;  2XWL A;  2RJ7 A;  1G97 A;  2ICX A;  2YES A;  4D48 A;  2Y6P A;  4FRL A;  2WEE A;  4M2A A;  1O23 B;  4HO2 A;  3SXG A;  4EVW A;  1G23 A;  2FYC B;  2YQS A;  1H5T A;  5C8R A;  3OC9 A;  4FRQ A;  3V8Y A;  3O3P A;  1JVG A;  2X5Z A;  5FTS A;  1V82 A;  5AJP A;  3Q80 A;  2BO4 A;  3PKQ A;  4ASJ A;  3F1Y A;  1FXO A;  4EE5 A;  4P00 A;  3R3I A;  2VS3 A;  4FQW A;  2UX8 A;  1MP5 A;  4DE7 A;  1INI A;  1R7Y A;  2P72 A;  1QGQ A;  2PA4 A;  2JCK A;  2O1H A;  3ZF8 A;  2OI6 A;  3I0J A;  1H7L A;  2BO7 A;  4KPZ A;  3F1C A;  1INJ A;  1KWS A;  3U2X A;  4G3Q A;  5C38 A;  1I52 A;  2AH9 A;  2X65 A;  1H5T B;  4JIS A;  2E3D A;  4FCE A;  1LZ7 A;  1ZJ3 A;  1FGG A;  3T7M A;  2AM4 A;  1HM9 A;  2GGQ A;  2I5K A;  3GUE A;  1R7T A;  2AM5 A;  2WGZ A;  5C49 A;  4IRQ A;  5C3B A;  4D0T A;  1TW5 A;  1ZCY A;  1HJJ A;  2AEC A;  1FG5 N;  1NF5 B;  1EYR A;  1V84 A;  1XHB A;  3JUJ A;  2PX7 A;  2WVL A;  5I1F A;  5CQP A;  3V90 A;  2DPW A;  4DDZ A;  4R7P A;  1LZJ A;  1R7V A;  5DDV A;  1NMM B;  3N9W A;  3V0Q A;  5EJ1 A;  5C3A A;  1G95 A;  1WT1 A;  3V0P A;  4M2B A;  1H4D A;  1LL3 A;  1FOA A;  3V0L A;  1MC3 A;  1G1L A;  4Y9X A;  1FR8 A;  3CKQ A;  1EZI A;  4KC4 A;  4KNX A;  5EIY A;  2VSH A;  2VFZ A;  4K6R A;  1WT0 A;  2RJ8 A;  1YP3 A;  1ZDG A;  1LL2 A;  2JCL A;  4HO6 A;  1LL0 A;  1H5R B;  2V0I A;  4KXO A;  2ICY A;  1VZU A;  3Q4S A;  2ZU9 A;  2VS5 A;  4Y7U A;  5C48 A;  2FYD B;  4AYL A;  3V0N A;  4B4M A;  3I0L A;  2V0L A;  4AC3 A;  2XWN A;  2FFU A; 
#chains in the Genus database with same CATH topology
 2YQJ A;  4D0Z A;  1H5S C;  3SPT A;  2YQC A;  3PKP A;  3OGZ A;  1VH1 A;  4HOC A;  2JCO A;  2VSI A;  3BCV A;  4JD0 A;  3USQ A;  4C2S A;  1HM8 A;  1G93 A;  2RJ6 A;  2A8W A;  4Y7F A;  1V83 A;  3PNN A;  1HM0 A;  3D98 A;  3HL3 A;  2W0W A;  4D11 C;  2Z87 A;  1H7E A;  1WT3 A;  1VM8 A;  1WT2 A;  2QGI A;  2Y4K A;  4HO5 A;  4Y6U A;  2AGD A;  4Y7G A;  1W57 A;  1O0R A;  1ZJP A;  2CU2 A;  3E25 A;  5C4C A;  1G3L A;  2D7R A;  2VXM A;  4KT7 A;  5CMJ A;  2RJ0 A;  1R80 A;  4Y7T A;  4ZDQ A;  3SX8 A;  1OQM B;  1VPA A;  3U2T A;  4FRA A;  1GQ9 A;  2YC5 A;  1TW1 A;  5C4E A;  4NAN A;  4Y64 A;  2X5S A;  5C1H A;  3I0C A;  3KIA A;  3OH0 A;  5D92 A;  3CKV A;  4G87 A;  1FXJ A;  1VIC A;  2QKX A;  4EE4 A;  5FU0 A;  3U0Y A;  1S4P A;  4ECM A;  2NXV A;  1GQC A;  4B42 A;  4YS8 A;  1FZW A;  3OH1 A;  5C4D A;  1NHE B;  1ZI3 A;  4NAI A;  4KNR A;  1H5S A;  3U2U A;  2P73 A;  4BQH A;  1YRO B;  4DEC A;  5IDT A;  2JCJ A;  4EEM A;  4IRP A;  3ZLK A;  3SX3 A;  4B3U A;  2Q4J A;  1ZI5 A;  4GBP A;  1VZX A;  1TZF A;  1LVW A;  1MP3 A;  2PGV A;  5BXC A;  2XMH A;  1ZI1 A;  2Y4M A;  2YQH A;  4CVH A;  3ZGG A;  5DDT A;  3RMW A;  2Y7A A;  2AM3 A;  2A8U A;  1NWG B;  5C4F A;  4FIX A;  3V91 A;  1PZT A;  4KRV A;  5L6S A;  2Y4J A;  5CQN X;  1H7H A;  4P02 A;  1TVY A;  4B5B A;  3TQD A;  4FRO A;  4LW3 A;  1H4E A;  1H7T A;  1ZJ0 A;  1R7U A;  5AJO A;  4B4G A;  3OAM A;  2WAW A;  2BO6 A;  3V8Z A;  2APC A;  4M4K A;  1ZHJ A;  1VGT A;  2FYB A;  4NAK A;  2VXL A;  3I0K A;  3SXD A;  1LZI A;  2E8B A;  1G8O A;  4B2W A;  3TZT A;  1R7X A;  1H4C A;  4EE3 A;  2I7B A;  1W55 A;  2RIY A;  5D91 A;  4EEO A;  1JYK A;  2XWM A;  3DUV A;  5CMI A;  2BO8 A;  1XZ6 A;  3ST8 A;  1ZJ2 A;  5AJN A;  4B4B A;  3SXC A;  3OH4 A;  3I0E A;  4EEA A;  3K8D A;  3K8E A;  1NKH B;  4EEG A;  1MP4 A;  4M28 A;  4NAL A;  3T7O A;  3BRK X;  5IDS A;  1E5K A;  3I0I X;  5C36 A;  1FO8 A;  2OEF A;  2RJ9 A;  1YP2 A;  2V0K A;  4G3P A;  3R2W A;  4FRH A;  4CJ8 A;  3SX7 A;  1ZDF A;  5C4B A;  4CJB A;  1GWW A;  2RIT A;  1S4N A;  2Y4L A;  2W0V A;  2QH5 A;  3USR A;  2O1G A;  1W77 A;  1HJL A;  2ZU8 A;  1ZJ1 A;  3E26 A;  1YP4 A;  2MZB A;  3FOQ A;  3I0D A;  5L6V A;  1GWV A;  3NGW A;  5FTV A;  4FRM A;  5FU8 A;  1G2V A;  2GGO A;  3SXE A;  5CQL X;  3CKJ A;  2V0J A;  1VGW A;  3IOJ A;  5EJZ A;  3SXB A;  2OI5 A;  1FGX A;  2RIX A;  2VD4 A;  4B2X A;  2D7I A;  4E1K A;  4CJC A;  1VZT A;  3I0H A;  5CQO A;  1JVD A;  4Y63 A;  3V0M A;  4AAW A;  2PGY A;  3LW6 A;  4HG6 A;  5FYE A;  1H7Q A;  2XME A;  5CMH A;  3RMV A;  5C47 A;  3OKR A;  5CQM X;  2YC3 A;  4D11 A;  1FR9 A;  1G0R A;  1WSZ A;  3I0F A;  3JTJ A;  4KC1 A;  1ZCT A;  4L41 C;  2X60 A;  4HO9 A;  3D5N A;  3FWW A;  1ZI4 A;  4FRD A;  5C3D A;  1K4V A;  1R82 A;  2WVM A;  1QGS A;  2OEG A;  3CKN A;  1SS9 A;  1QG8 A;  2ZU7 A;  2V0H A;  2FFV A;  1GA8 A;  3I0G A;  1GX0 A;  4J18 A;  4O6N A;  2VK9 A;  5CMG X;  1ZJO A;  1S4O A;  1NQI B;  2RJ4 A;  1FO9 A;  3POL A;  1JV3 A;  1GX4 A;  3D8V A;  4ASY A;  4Y7V A;  1ZCU A;  1OMX A;  1FWY A;  1H5S B;  1H5R A;  2J0A A;  3ZGF A;  2I5E A;  4HO3 A;  1R81 A;  1JV1 A;  2J0B A;  5C1L A;  4KPX A;  1H3M A;  1ON6 A;  2D0J A;  3CGX A;  3CU0 A;  4MND A;  5JQQ A;  2RJ5 A;  3SX5 A;  4ARW A;  1IIM A;  4G3S A;  1OMZ A;  3SXA A;  2FY7 A;  4LW6 A;  3QVB A;  2OI7 A;  1WVC A;  3RSB A;  2AES A;  1G9R A;  3Q7U A;  1VGU A;  1VGZ A;  3U2V A;  4HO8 A;  4FRE A;  5IFY A;  4UEG A;  1O7Q A;  5FV9 A;  3U2W A;  1PZY B;  3JUK A;  1FRW A;  4HO4 A;  3DK5 A;  5C1G A;  2Z86 A;  4HO0 A;  3V0O A;  1H5S D;  1IIN A;  2C0N A;  4FRP A;  1Z90 A;  3T7N A;  3EE5 A;  5HS2 A;  1ZCV A;  4KC2 A;  2P6W A;  1H7F A;  1VH3 A;  1QWJ A;  3OH3 A;  5J49 A;  2RIZ A;  2YCM A;  4Y62 A;  1H7G A;  5FUH A;  2FYA A;  2VS4 A;  4MYB A;  4Q7C A;  2O1F A;  1ON8 A;  4FIY A;  4FRB A;  4BMA A;  2AE7 A;  1HV9 A;  1JYL A;  3IOI A;  3ZLL A;  2RJ1 A;  1LZ0 A;  4XWI A;  3OH2 A;  4HCQ A;  5CMF X;  4AYJ A;  2WVK A;  3U0X A;  4FCU A;  4Y6N A;  1ZIZ A;  3DJ4 A;  3IOH A;  1O7O A;  4KQL A;  2WE9 A;  3CKO A;  2XWL A;  2RJ7 A;  1G97 A;  2ICX A;  2YES A;  4D48 A;  2Y6P A;  4FRL A;  2WEE A;  4M2A A;  1O23 B;  4HO2 A;  3SXG A;  4EVW A;  1G23 A;  2FYC B;  2YQS A;  1H5T A;  5C8R A;  3OC9 A;  4FRQ A;  3V8Y A;  3O3P A;  1JVG A;  2X5Z A;  5FTS A;  1V82 A;  5AJP A;  3Q80 A;  2BO4 A;  3PKQ A;  4ASJ A;  3F1Y A;  1FXO A;  4EE5 A;  4P00 A;  3R3I A;  2VS3 A;  4FQW A;  2UX8 A;  1MP5 A;  4DE7 A;  1INI A;  1R7Y A;  2P72 A;  1QGQ A;  2PA4 A;  2JCK A;  2O1H A;  3ZF8 A;  2OI6 A;  3I0J A;  1H7L A;  2BO7 A;  4KPZ A;  3F1C A;  1INJ A;  1KWS A;  3U2X A;  4G3Q A;  5C38 A;  1I52 A;  2AH9 A;  2X65 A;  1H5T B;  4JIS A;  2E3D A;  4FCE A;  1LZ7 A;  1ZJ3 A;  1FGG A;  3T7M A;  2AM4 A;  1HM9 A;  2GGQ A;  2I5K A;  3GUE A;  1R7T A;  2AM5 A;  2WGZ A;  5C49 A;  4IRQ A;  5C3B A;  4D0T A;  1TW5 A;  1ZCY A;  1HJJ A;  2AEC A;  1FG5 N;  1NF5 B;  1EYR A;  1V84 A;  1XHB A;  3JUJ A;  2PX7 A;  2WVL A;  5I1F A;  5CQP A;  3V90 A;  2DPW A;  4DDZ A;  4R7P A;  1LZJ A;  1R7V A;  5DDV A;  1NMM B;  3N9W A;  3V0Q A;  5EJ1 A;  5C3A A;  1G95 A;  1WT1 A;  3V0P A;  4M2B A;  1H4D A;  1LL3 A;  1FOA A;  3V0L A;  1MC3 A;  1G1L A;  4Y9X A;  1FR8 A;  4MIX A;  3CKQ A;  1EZI A;  4KC4 A;  4KNX A;  5EIY A;  2VSH A;  2VFZ A;  4K6R A;  1WT0 A;  2RJ8 A;  1YP3 A;  1ZDG A;  4O6M A;  1LL2 A;  2JCL A;  4HO6 A;  1LL0 A;  1H5R B;  2V0I A;  4KXO A;  2ICY A;  1VZU A;  3Q4S A;  2ZU9 A;  2VS5 A;  4Y7U A;  5C48 A;  2FYD B;  4AYL A;  3V0N A;  4B4M A;  3I0L A;  2V0L A;  4AC3 A;  2XWN A;  2FFU A; 
#chains in the Genus database with same CATH homology
 2YQJ A;  4D0Z A;  1H5S C;  3SPT A;  2YQC A;  3PKP A;  3OGZ A;  1VH1 A;  4HOC A;  2JCO A;  2VSI A;  3BCV A;  4JD0 A;  3USQ A;  4C2S A;  1HM8 A;  1G93 A;  2RJ6 A;  2A8W A;  4Y7F A;  1V83 A;  3PNN A;  1HM0 A;  3D98 A;  3HL3 A;  2W0W A;  4D11 C;  2Z87 A;  1H7E A;  1WT3 A;  1VM8 A;  1WT2 A;  2QGI A;  2Y4K A;  4HO5 A;  4Y6U A;  2AGD A;  4Y7G A;  1W57 A;  1O0R A;  1ZJP A;  2CU2 A;  3E25 A;  5C4C A;  1G3L A;  2D7R A;  2VXM A;  4KT7 A;  5CMJ A;  2RJ0 A;  1R80 A;  4Y7T A;  4ZDQ A;  3SX8 A;  1OQM B;  1VPA A;  3U2T A;  4FRA A;  1GQ9 A;  2YC5 A;  1TW1 A;  5C4E A;  4NAN A;  4Y64 A;  2X5S A;  5C1H A;  3I0C A;  3KIA A;  3OH0 A;  5D92 A;  3CKV A;  4G87 A;  1FXJ A;  1VIC A;  2QKX A;  4EE4 A;  5FU0 A;  3U0Y A;  1S4P A;  4ECM A;  2NXV A;  1GQC A;  4B42 A;  4YS8 A;  1FZW A;  3OH1 A;  5C4D A;  1NHE B;  1ZI3 A;  4NAI A;  4KNR A;  1H5S A;  3U2U A;  2P73 A;  4BQH A;  1YRO B;  4DEC A;  5IDT A;  2JCJ A;  4EEM A;  4IRP A;  3ZLK A;  3SX3 A;  4B3U A;  2Q4J A;  1ZI5 A;  4GBP A;  1VZX A;  1TZF A;  1LVW A;  1MP3 A;  2PGV A;  5BXC A;  2XMH A;  1ZI1 A;  2Y4M A;  2YQH A;  4CVH A;  3ZGG A;  5DDT A;  3RMW A;  2Y7A A;  2AM3 A;  2A8U A;  1NWG B;  5C4F A;  4FIX A;  3V91 A;  1PZT A;  4KRV A;  5L6S A;  2Y4J A;  5CQN X;  1H7H A;  4P02 A;  1TVY A;  4B5B A;  3TQD A;  4FRO A;  4LW3 A;  1H4E A;  1H7T A;  1ZJ0 A;  1R7U A;  5AJO A;  4B4G A;  3OAM A;  2WAW A;  2BO6 A;  3V8Z A;  2APC A;  4M4K A;  1ZHJ A;  1VGT A;  2FYB A;  4NAK A;  2VXL A;  3I0K A;  3SXD A;  1LZI A;  2E8B A;  1G8O A;  4B2W A;  3TZT A;  1R7X A;  1H4C A;  4EE3 A;  2I7B A;  1W55 A;  2RIY A;  5D91 A;  4EEO A;  1JYK A;  2XWM A;  3DUV A;  5CMI A;  2BO8 A;  1XZ6 A;  3ST8 A;  1ZJ2 A;  5AJN A;  4B4B A;  3SXC A;  3OH4 A;  3I0E A;  4EEA A;  3K8D A;  3K8E A;  1NKH B;  4EEG A;  1MP4 A;  4M28 A;  4NAL A;  3T7O A;  3BRK X;  5IDS A;  1E5K A;  3I0I X;  5C36 A;  1FO8 A;  2OEF A;  2RJ9 A;  1YP2 A;  2V0K A;  4G3P A;  3R2W A;  4FRH A;  4CJ8 A;  3SX7 A;  1ZDF A;  5C4B A;  4CJB A;  1GWW A;  2RIT A;  1S4N A;  2Y4L A;  2W0V A;  2QH5 A;  3USR A;  2O1G A;  1W77 A;  1HJL A;  2ZU8 A;  1ZJ1 A;  3E26 A;  1YP4 A;  2MZB A;  3FOQ A;  3I0D A;  5L6V A;  1GWV A;  3NGW A;  5FTV A;  4FRM A;  5FU8 A;  1G2V A;  2GGO A;  3SXE A;  5CQL X;  3CKJ A;  2V0J A;  1VGW A;  3IOJ A;  5EJZ A;  3SXB A;  2OI5 A;  1FGX A;  2RIX A;  2VD4 A;  4B2X A;  2D7I A;  4E1K A;  4CJC A;  1VZT A;  3I0H A;  5CQO A;  1JVD A;  4Y63 A;  3V0M A;  4AAW A;  2PGY A;  3LW6 A;  4HG6 A;  5FYE A;  1H7Q A;  2XME A;  5CMH A;  3RMV A;  5C47 A;  3OKR A;  5CQM X;  2YC3 A;  4D11 A;  1FR9 A;  1G0R A;  1WSZ A;  3I0F A;  3JTJ A;  4KC1 A;  1ZCT A;  4L41 C;  2X60 A;  4HO9 A;  3D5N A;  3FWW A;  1ZI4 A;  4FRD A;  5C3D A;  1K4V A;  1R82 A;  2WVM A;  1QGS A;  2OEG A;  3CKN A;  1SS9 A;  1QG8 A;  2ZU7 A;  2V0H A;  2FFV A;  1GA8 A;  3I0G A;  1GX0 A;  4J18 A;  4O6N A;  2VK9 A;  5CMG X;  1ZJO A;  1S4O A;  1NQI B;  2RJ4 A;  1FO9 A;  3POL A;  1JV3 A;  1GX4 A;  3D8V A;  4ASY A;  4Y7V A;  1ZCU A;  1OMX A;  1FWY A;  1H5S B;  1H5R A;  2J0A A;  3ZGF A;  2I5E A;  4HO3 A;  1R81 A;  1JV1 A;  2J0B A;  5C1L A;  4KPX A;  1H3M A;  1ON6 A;  2D0J A;  3CGX A;  3CU0 A;  4MND A;  5JQQ A;  2RJ5 A;  3SX5 A;  4ARW A;  1IIM A;  4G3S A;  1OMZ A;  3SXA A;  2FY7 A;  4LW6 A;  3QVB A;  2OI7 A;  1WVC A;  3RSB A;  2AES A;  1G9R A;  3Q7U A;  1VGU A;  1VGZ A;  3U2V A;  4HO8 A;  4FRE A;  5IFY A;  4UEG A;  1O7Q A;  5FV9 A;  3U2W A;  1PZY B;  3JUK A;  1FRW A;  4HO4 A;  3DK5 A;  5C1G A;  2Z86 A;  4HO0 A;  3V0O A;  1H5S D;  1IIN A;  2C0N A;  4FRP A;  1Z90 A;  3T7N A;  3EE5 A;  5HS2 A;  1ZCV A;  4KC2 A;  2P6W A;  1H7F A;  1VH3 A;  1QWJ A;  3OH3 A;  5J49 A;  2RIZ A;  2YCM A;  4Y62 A;  1H7G A;  5FUH A;  2FYA A;  2VS4 A;  4MYB A;  4Q7C A;  2O1F A;  1ON8 A;  4FIY A;  4FRB A;  4BMA A;  2AE7 A;  1HV9 A;  1JYL A;  3IOI A;  3ZLL A;  2RJ1 A;  1LZ0 A;  4XWI A;  3OH2 A;  4HCQ A;  5CMF X;  4AYJ A;  2WVK A;  3U0X A;  4FCU A;  4Y6N A;  1ZIZ A;  3DJ4 A;  3IOH A;  1O7O A;  4KQL A;  2WE9 A;  3CKO A;  2XWL A;  2RJ7 A;  1G97 A;  2ICX A;  2YES A;  4D48 A;  2Y6P A;  4FRL A;  2WEE A;  4M2A A;  1O23 B;  4HO2 A;  3SXG A;  4EVW A;  1G23 A;  2FYC B;  2YQS A;  1H5T A;  5C8R A;  3OC9 A;  4FRQ A;  3V8Y A;  3O3P A;  1JVG A;  2X5Z A;  5FTS A;  1V82 A;  5AJP A;  3Q80 A;  2BO4 A;  3PKQ A;  4ASJ A;  3F1Y A;  1FXO A;  4EE5 A;  4P00 A;  3R3I A;  2VS3 A;  4FQW A;  2UX8 A;  1MP5 A;  4DE7 A;  1INI A;  1R7Y A;  2P72 A;  1QGQ A;  2PA4 A;  2JCK A;  2O1H A;  3ZF8 A;  2OI6 A;  3I0J A;  1H7L A;  2BO7 A;  4KPZ A;  3F1C A;  1INJ A;  1KWS A;  3U2X A;  4G3Q A;  5C38 A;  1I52 A;  2AH9 A;  2X65 A;  1H5T B;  4JIS A;  2E3D A;  4FCE A;  1LZ7 A;  1ZJ3 A;  1FGG A;  3T7M A;  2AM4 A;  1HM9 A;  2GGQ A;  2I5K A;  3GUE A;  1R7T A;  2AM5 A;  2WGZ A;  5C49 A;  4IRQ A;  5C3B A;  4D0T A;  1TW5 A;  1ZCY A;  1HJJ A;  2AEC A;  1FG5 N;  1NF5 B;  1EYR A;  1V84 A;  1XHB A;  3JUJ A;  2PX7 A;  2WVL A;  5I1F A;  5CQP A;  3V90 A;  2DPW A;  4DDZ A;  4R7P A;  1LZJ A;  1R7V A;  5DDV A;  1NMM B;  3N9W A;  3V0Q A;  5EJ1 A;  5C3A A;  1G95 A;  1WT1 A;  3V0P A;  4M2B A;  1H4D A;  1LL3 A;  1FOA A;  3V0L A;  1MC3 A;  1G1L A;  4Y9X A;  1FR8 A;  4MIX A;  3CKQ A;  1EZI A;  4KC4 A;  4KNX A;  5EIY A;  2VSH A;  2VFZ A;  4K6R A;  1WT0 A;  2RJ8 A;  1YP3 A;  1ZDG A;  4O6M A;  1LL2 A;  2JCL A;  4HO6 A;  1LL0 A;  1H5R B;  2V0I A;  4KXO A;  2ICY A;  1VZU A;  3Q4S A;  2ZU9 A;  2VS5 A;  4Y7U A;  5C48 A;  2FYD B;  4AYL A;  3V0N A;  4B4M A;  3I0L A;  2V0L A;  4AC3 A;  2XWN A;  2FFU A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...