4DDZA

Crystal structure of glucosyl-3-phosphoglycerate synthase from mycobacterium tuberculosis
Total Genus 95
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
95
sequence length
299
structure length
276
Chain Sequence
TTWHRPGWTIGELEAAKAGRTISVVLPALNEEATIESVIDSISPLVDGLVDELIVLDSGSTDDTEIRAIASGARVVSREQALPEVPVRPGKGEALWRSLAATSGDIVVFIDSDLINPHPLFVPWLVGPLLTGEGIQLVKSFYRGGRVTELVARPLLAALRPELGCVLQPLSGEYAASRELLTSLPFAPGYGVEIGLLIDTFDRLGLDAIAQVNLGVRAHRNRPLDELGAMSRQVIATLLSRCGIPDSGVGLTQFLDYTRHTWPVSLVDRPPMKVMR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords GLUCOSYL-3-PHOSPHOGLYCERATE SYNTHASE (GpgS)
publication title Mechanistic insights into the retaining glucosyl-3-phosphoglycerate synthase from mycobacteria.
pubmed doi rcsb
source organism Mycobacterium tuberculosis
total genus 95
structure length 276
sequence length 299
ec nomenclature ec 2.4.1.266: Glucosyl-3-phosphoglycerate synthase.
pdb deposition date 2012-01-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00535 Glycos_transf_2 Glycosyl transferase family 2
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.550.10 Alpha Beta Alpha-Beta Complex Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A 4ddzA00
2QKXA 4D0ZA 2BO6A 4BQHA 4J18A 4HCQA 1SS9A 4HO6A 5FYEA 3SXBA 1R7TA 2P73A 1NQIB 1FGXA 4XWIA 2GGQA 4IRQA 2VS5A 1YP2A 2XMHA 1WT0A 2YCMA 5HS2A 4FRDA 3CU0A 3EE5A 2YQCA 4HO5A 4AC3A 2V0HA 1H5SB 4EEGA 2Y6PA 2Y7AA 4R7PA 1FG5N 1NKHB 1XZ6A 4B4BA 1O7OA 3D8VA 4LW3A 1ZIZA 3U2VA 1G0RA 3U2UA 1JV1A 3T7OA 4M2AA 3SPTA 1H5TB 4B5BA 5CQLX 3I0HA 1IINA 2AM4A 1S4NA 1VGTA 4HO2A 4AAWA 4Y9XA 1ZJ3A 1LZ0A 2VS4A 2RJ7A 4NAKA 3V90A 4B2WA 5EJZA 1OQMB 2E8BA 2X60A 4KNXA 3ST8A 2V0KA 2XMEA 4CJ8A 4EE4A 4EE3A 4AYJA 2ICYA 4DE7A 3IOHA 1TVYA 2W0WA 3V0PA 2FYBA 4MYBA 1VZTA 2QH5A 1H7TA 1H4DA 3PNNA 4FCUA 2MZBA 1ZDFA 2AE7A 4FRLA 3V0QA 1PZTA 1LL3A 1R7UA 4ARWA 1FXJA 1H4CA 1VH1A 5C1GA 2PA4A 2JCOA 4Y6UA 1EYRA 1MP3A 1G8OA 1WT3A 4B2XA 3SXGA 1ZJPA 2OEFA 1GX0A 1ZCTA 3PKPA 1ZI1A 4Y7VA 2Q4JA 1JYKA 1FR9A 1G23A 3SX3A 1V82A 2PGYA 2YQHA 4D0TA 4G3PA 5J49A 4G3QA 3POLA 1H5RB 1ZCUA 1NMMB 4LW6A 4EEOA 2V0JA 2O1FA 3V0MA 3Q80A 4FCEA 1MP4A 1VZUA 1GQCA 1H7HA 2AECA 5L6SA 3BRKX 4DECA 4MNDA 1HV9A 3IOJA 3PKQA 3RMWA 3RSBA 3ZLKA 3NGWA 4FRBA 1PZYB 4Y62A 1QG8A 3OH3A 5CQMX 1VGWA 5C48A 3IOIA 5CMHA 3U2WA 1WT2A 5CMIA 2O1HA 1ON6A 2I7BA 3V0LA 1FOAA 5AJPA 4B42A 1EZIA 3JTJA 2JCJA 5CQPA 3SXCA 2XWLA 2RITA 4FROA 1ZI3A 4UEGA 2RJ4A 2E3DA 1FR8A 1VICA 4Y7FA 4C2SA 2RJ6A 5DDVA 1JYLA 4JD0A 2RJ0A 5CMGX 1GA8A 1JV3A 1LVWA 1ZI4A 1TZFA 4D11A 2D0JA 4P02A 1TW1A 2X5SA 1OMZA 2V0LA 3U0XA 1FGGA 1FXOA 4BMAA 1KWSA 1HM9A 3OC9A 2FYAA 5CMFX 1VH3A 3OAMA 1HM8A 3I0IX 1NWGB 1OMXA 1NF5B 2NXVA 3I0DA 4YS8A 2ZU7A 3U2TA 1HJJA 1H7LA 3DK5A 4KPZA 2D7RA 1JVGA 1INJA 4M2BA 2AH9A 1W55A 2I5EA 3I0JA 4HG6A 2PX7A 3KIAA 5C36A 4KC4A 1TW5A 2DPWA 3JUJA 2OI5A 3TZTA 1GWWA 1G97A 4L41C 1ON8A 1H7QA 1R81A 4HO4A 3RMVA 4ASYA 5AJNA 1VM8A 1ZJOA 4CJCA 1G2VA 2AGDA 2VXLA 3USRA 4P00A 3FWWA 1G95A 4Y63A 5IFYA 2BO7A 5C4CA 3R3IA 2FFUA 5JQQA 4NANA 4D11C 4B4MA 5FV9A 4M4KA 1LZIA 1JVDA 3I0EA 5C38A 3SXAA 1H7EA 3V0OA 3V8ZA 5IDSA 3SX5A 1R7YA 2P72A 2I5KA 2X5ZA 3QVBA 4FRPA 1G1LA 4CJBA 2BO8A 1R80A 2VSIA 4Y64A 1H5TA 4NALA 1Z90A 1FWYA 3ZGGA 2VSHA 5C1LA 2JCLA 2YQSA 4KXOA 4NAIA 4HO0A 2Z86A 1R7VA 2WGZA 3GUEA 1MP5A 1ZJ0A 2Z87A 3R2WA 3O3PA 1FZWA 1H3MA 5FU0A 3ZLLA 2FYCB 1YROB 1V83A 3D5NA 3Q7UA 5DDTA 2Y4LA 2FFVA 3OH0A 4EE5A 1VZXA 4KNRA 2OEGA 3BCVA 3E25A 5FU8A 3FOQA 5EIYA 3U0YA 3CKJA 1H5SC 5FTSA 2V0IA 3T7MA 3CKQA 2RIXA 1LL2A 3SXEA 1E5KA 4KC1A 4FQWA 2AM5A 1ZHJA 4Y7GA 5C3DA 1O0RA 1H5SD 3SXDA 1XHBA 2VD4A 3TQDA 2W0VA 4FRAA 3CKOA 1WT1A 2YC5A 1H7FA 1O23B 5FTVA 2X65A 2AESA 2Y4KA 1O7QA 1H5RA 2WVMA 4EVWA 1WSZA 1I52A 5C4FA 3K8DA 2OI6A 5CQNX 2RJ9A 1QGSA 2JCKA 3LW6A 1G3LA 2PGVA 1G93A 2FY7A 2A8WA 5AJOA 4B3UA 4E1KA 2BO4A 4FRMA 3CKVA 4KQLA 2GGOA 3V91A 2WEEA 5C4DA 5C4EA 5C1HA 2A8UA 1HJLA 4KPXA 3USQA 3ZF8A 4HO8A 1H4EA 1ZCYA 3D98A 1GWVA 3T7NA 1YP3A 1NHEB 2RIZA 1FO8A 1LL0A 4FRQA 4JISA 2RIYA 2XWMA 4Y7TA 5FUHA 2WE9A 2WVLA 2ZU9A 2Y4MA 2YESA 4HO9A 4DDZA 4IRPA 2WVKA 4G87A 1WVCA 1ZDGA 3OH2A 4CVHA 2RJ1A 2UX8A 5I1FA 3V8YA 4Y6NA 4M28A 5CMJA 1ZJ2A 1H5SA 1GQ9A 3CKNA 1GX4A 3CGXA 3F1YA 5C8RA 5C47A 2P6WA 3DJ4A 3I0LA 2O1GA 3F1CA 1IIMA 2QGIA 1R7XA 4EEMA 2ICXA 3V0NA 2YC3A 3I0CA 3JUKA 3Q4SA 2AM3A 4K6RA 4D48A 3I0KA 1QWJA 2XWNA 4KRVA 1MC3A 3OKRA 1QGQA 3HL3A 4HOCA 4AYLA 2CU2A 1ZI5A 4ZDQA 4KT7A 3SX7A 3OH4A 1LZ7A 1S4OA 1K4VA 2APCA 5C3AA 3U2XA 1LZJA 1VPAA 4KC2A 2VXMA 5BXCA 5C4BA 1W77A 2VFZA 1VGUA 4Y7UA 2YQJA 5C3BA 2OI7A 1S4PA 3ZGFA 4G3SA 3I0GA 1FRWA 4GBPA 1V84A 4HO3A 1G9RA 5IDTA 3K8EA 1YP4A 4FRHA 1FO9A 2Y4JA 5CQOA 2WAWA 2RJ5A 1H7GA 4EEAA 3N9WA 1HM0A 5L6VA 4B4GA 3OH1A 3DUVA 3OGZA 1VGZA 1ZJ1A 1W57A 2VS3A 1ZCVA 5EJ1A 3E26A 1R82A 2RJ8A 2D7IA 2ZU8A 4ECMA 2FYDB 4ASJA 4FREA 5C49A 3I0FA 3SX8A 1INIA
chains in the Genus database with same CATH superfamily
2QKXA 4D0ZA 2BO6A 4BQHA 4J18A 4HCQA 1SS9A 4HO6A 5FYEA 3SXBA 1R7TA 2P73A 1NQIB 1FGXA 4XWIA 2GGQA 4IRQA 2VS5A 1YP2A 2XMHA 1WT0A 2YCMA 5HS2A 4FRDA 3CU0A 3EE5A 2YQCA 4HO5A 4AC3A 2V0HA 1H5SB 4O6MA 4EEGA 2Y6PA 2Y7AA 4R7PA 1FG5N 1NKHB 1XZ6A 4B4BA 1O7OA 3D8VA 4LW3A 1ZIZA 3U2VA 1G0RA 3U2UA 1JV1A 3T7OA 4M2AA 3SPTA 1H5TB 4B5BA 5CQLX 3I0HA 1IINA 2AM4A 1S4NA 1VGTA 4HO2A 4AAWA 4Y9XA 1ZJ3A 1LZ0A 2VS4A 2RJ7A 4NAKA 3V90A 4B2WA 5EJZA 1OQMB 2E8BA 2X60A 4FIXA 4KNXA 3ST8A 2V0KA 2XMEA 4CJ8A 4EE4A 4EE3A 4AYJA 2ICYA 4DE7A 3IOHA 1TVYA 2W0WA 3V0PA 2FYBA 4MYBA 1VZTA 2QH5A 1H7TA 1H4DA 3PNNA 4FCUA 2MZBA 1ZDFA 2AE7A 4FRLA 5D91A 3V0QA 1PZTA 1LL3A 1R7UA 4ARWA 1FXJA 1H4CA 1VH1A 5C1GA 2PA4A 2JCOA 4Y6UA 1EYRA 1MP3A 1G8OA 1WT3A 4B2XA 3SXGA 1ZJPA 2OEFA 1GX0A 1ZCTA 3PKPA 1ZI1A 4Y7VA 2Q4JA 1JYKA 1FR9A 1G23A 3SX3A 1V82A 2PGYA 2YQHA 4D0TA 4G3PA 5J49A 4G3QA 3POLA 1H5RB 1ZCUA 1NMMB 4LW6A 4EEOA 2V0JA 2O1FA 3V0MA 3Q80A 4FCEA 1MP4A 1VZUA 1GQCA 1H7HA 2AECA 5L6SA 3BRKX 4DECA 4MNDA 1HV9A 3IOJA 3PKQA 3RMWA 3RSBA 3ZLKA 3NGWA 4FRBA 1PZYB 4Y62A 1QG8A 3OH3A 5CQMX 1VGWA 5C48A 3IOIA 5CMHA 3U2WA 1WT2A 5CMIA 2O1HA 1ON6A 2I7BA 3V0LA 1FOAA 5AJPA 4B42A 1EZIA 3JTJA 2JCJA 5CQPA 3SXCA 2XWLA 2RITA 4FROA 1ZI3A 4UEGA 2RJ4A 2E3DA 1FR8A 1VICA 4Y7FA 4C2SA 2RJ6A 5DDVA 1JYLA 4JD0A 2J0AA 2RJ0A 5CMGX 1GA8A 1JV3A 1LVWA 1ZI4A 1TZFA 4D11A 2D0JA 4P02A 1TW1A 2X5SA 1OMZA 2V0LA 3U0XA 1FGGA 1FXOA 4BMAA 1KWSA 1HM9A 3OC9A 2FYAA 5CMFX 1VH3A 3OAMA 1HM8A 4FIYA 3I0IX 1NWGB 1OMXA 1NF5B 2NXVA 3I0DA 4YS8A 2ZU7A 3U2TA 1HJJA 1H7LA 3DK5A 4KPZA 2D7RA 1JVGA 1INJA 4M2BA 2AH9A 1W55A 2I5EA 3I0JA 4HG6A 2PX7A 3KIAA 5C36A 4KC4A 1TW5A 2DPWA 3JUJA 2OI5A 3TZTA 1GWWA 1G97A 4L41C 1ON8A 1H7QA 1R81A 4HO4A 3RMVA 4ASYA 5AJNA 1VM8A 1ZJOA 4CJCA 1G2VA 2AGDA 2VXLA 3USRA 4P00A 2C0NA 3FWWA 1G95A 4Y63A 5IFYA 2BO7A 5C4CA 3R3IA 2FFUA 5JQQA 4NANA 4D11C 4B4MA 5FV9A 4M4KA 1LZIA 1JVDA 3I0EA 5C38A 3SXAA 1H7EA 3V0OA 3V8ZA 5IDSA 3SX5A 1R7YA 2P72A 2I5KA 2X5ZA 3QVBA 4FRPA 1G1LA 4CJBA 2BO8A 1R80A 2VSIA 4Y64A 1H5TA 4NALA 1Z90A 1FWYA 3ZGGA 2VSHA 5C1LA 2JCLA 2YQSA 4KXOA 4NAIA 4HO0A 2Z86A 1R7VA 2WGZA 3GUEA 1MP5A 1ZJ0A 2Z87A 3R2WA 3O3PA 1FZWA 1H3MA 5FU0A 3ZLLA 2FYCB 1YROB 1V83A 3D5NA 3Q7UA 5DDTA 2Y4LA 2FFVA 3OH0A 4EE5A 1VZXA 4KNRA 2OEGA 3BCVA 3E25A 5FU8A 3FOQA 5EIYA 3U0YA 3CKJA 1H5SC 5FTSA 2V0IA 3T7MA 3CKQA 2RIXA 1LL2A 3SXEA 1E5KA 4KC1A 4FQWA 2AM5A 1ZHJA 4Y7GA 5C3DA 1O0RA 1H5SD 3SXDA 1XHBA 2VD4A 3TQDA 2W0VA 4FRAA 3CKOA 4O6NA 4MIXA 1WT1A 2YC5A 1H7FA 1O23B 5FTVA 2X65A 2AESA 2Y4KA 1O7QA 1H5RA 2WVMA 4EVWA 1WSZA 1I52A 5C4FA 3K8DA 2OI6A 5CQNX 2RJ9A 1QGSA 2JCKA 3LW6A 1G3LA 2PGVA 1G93A 2FY7A 2A8WA 5AJOA 4B3UA 4E1KA 2BO4A 4FRMA 3CKVA 4KQLA 2GGOA 3V91A 2WEEA 5C4DA 5C4EA 5C1HA 2A8UA 1HJLA 4KPXA 3USQA 3ZF8A 4HO8A 1H4EA 1ZCYA 3D98A 1GWVA 3T7NA 1YP3A 1NHEB 2RIZA 1FO8A 1LL0A 4FRQA 4JISA 2RIYA 2XWMA 4Y7TA 5FUHA 2WE9A 2WVLA 2ZU9A 2Y4MA 2YESA 4HO9A 4DDZA 4IRPA 2WVKA 4G87A 1WVCA 1ZDGA 3OH2A 4CVHA 2RJ1A 2UX8A 5I1FA 3V8YA 4Y6NA 4M28A 5CMJA 1ZJ2A 1H5SA 1GQ9A 3CKNA 1GX4A 3CGXA 3F1YA 5C8RA 5C47A 2P6WA 3DJ4A 3I0LA 2O1GA 3F1CA 1IIMA 2QGIA 1R7XA 4EEMA 2ICXA 3V0NA 2YC3A 3I0CA 3JUKA 3Q4SA 2AM3A 4K6RA 4D48A 3I0KA 1QWJA 2XWNA 4KRVA 1MC3A 3OKRA 1QGQA 3HL3A 4HOCA 4AYLA 2CU2A 1ZI5A 4ZDQA 4KT7A 3SX7A 3OH4A 1LZ7A 1S4OA 1K4VA 2APCA 5D92A 5C3AA 1LZJA 3U2XA 2J0BA 1VPAA 4KC2A 2VXMA 5BXCA 5C4BA 1W77A 2VFZA 1VGUA 4Q7CA 4Y7UA 2YQJA 2VK9A 5C3BA 2OI7A 1S4PA 3ZGFA 4G3SA 3I0GA 1FRWA 4GBPA 1V84A 4HO3A 1G9RA 5IDTA 3K8EA 1YP4A 4FRHA 1FO9A 2Y4JA 5CQOA 2WAWA 2RJ5A 1H7GA 4EEAA 3N9WA 1HM0A 5L6VA 4B4GA 3OH1A 3DUVA 3OGZA 1VGZA 1ZJ1A 1W57A 2VS3A 1ZCVA 5EJ1A 3E26A 1R82A 2RJ8A 2D7IA 2ZU8A 4ECMA 2FYDB 4ASJA 4FREA 5C49A 3I0FA 3SX8A 1INIA
chains in the Genus database with same CATH topology
2QKXA 4D0ZA 2BO6A 4BQHA 4J18A 4HCQA 1SS9A 4HO6A 5FYEA 3SXBA 1R7TA 2P73A 1NQIB 1FGXA 4XWIA 2GGQA 4IRQA 2VS5A 1YP2A 2XMHA 1WT0A 2YCMA 5HS2A 4FRDA 3CU0A 3EE5A 2YQCA 4HO5A 4AC3A 2V0HA 1H5SB 4O6MA 4EEGA 2Y6PA 2Y7AA 4R7PA 1FG5N 1NKHB 1XZ6A 4B4BA 1O7OA 3D8VA 4LW3A 1ZIZA 3U2VA 1G0RA 3U2UA 1JV1A 3T7OA 4M2AA 3SPTA 1H5TB 4B5BA 5CQLX 3I0HA 1IINA 2AM4A 1S4NA 1VGTA 4HO2A 4AAWA 4Y9XA 1ZJ3A 1LZ0A 2VS4A 2RJ7A 4NAKA 3V90A 4B2WA 5EJZA 1OQMB 2E8BA 2X60A 4FIXA 4KNXA 3ST8A 2V0KA 2XMEA 4CJ8A 4EE4A 4EE3A 4AYJA 2ICYA 4DE7A 3IOHA 1TVYA 2W0WA 3V0PA 2FYBA 4MYBA 1VZTA 2QH5A 1H7TA 1H4DA 3PNNA 4FCUA 2MZBA 1ZDFA 2AE7A 4FRLA 5D91A 3V0QA 1PZTA 1LL3A 1R7UA 4ARWA 1FXJA 1H4CA 1VH1A 5C1GA 2PA4A 2JCOA 4Y6UA 1EYRA 1MP3A 1G8OA 1WT3A 4B2XA 3SXGA 1ZJPA 2OEFA 1GX0A 1ZCTA 3PKPA 1ZI1A 4Y7VA 2Q4JA 1JYKA 1FR9A 1G23A 3SX3A 1V82A 2PGYA 2YQHA 4D0TA 4G3PA 5J49A 4G3QA 3POLA 1H5RB 1ZCUA 1NMMB 4LW6A 4EEOA 2V0JA 2O1FA 3V0MA 3Q80A 4FCEA 1MP4A 1VZUA 1GQCA 1H7HA 2AECA 5L6SA 3BRKX 4DECA 4MNDA 1HV9A 3IOJA 3PKQA 3RMWA 3RSBA 3ZLKA 3NGWA 4FRBA 1PZYB 4Y62A 1QG8A 3OH3A 5CQMX 1VGWA 5C48A 3IOIA 5CMHA 3U2WA 1WT2A 5CMIA 2O1HA 1ON6A 2I7BA 3V0LA 1FOAA 5AJPA 4B42A 1EZIA 3JTJA 2JCJA 5CQPA 3SXCA 2XWLA 2RITA 4FROA 1ZI3A 4UEGA 2RJ4A 2E3DA 1FR8A 1VICA 4Y7FA 4C2SA 2RJ6A 5DDVA 1JYLA 4JD0A 2J0AA 2RJ0A 5CMGX 1GA8A 1JV3A 1LVWA 1ZI4A 1TZFA 4D11A 2D0JA 4P02A 1TW1A 2X5SA 1OMZA 2V0LA 3U0XA 1FGGA 1FXOA 4BMAA 1KWSA 1HM9A 3OC9A 2FYAA 5CMFX 1VH3A 3OAMA 1HM8A 4FIYA 3I0IX 1NWGB 1OMXA 1NF5B 2NXVA 3I0DA 4YS8A 2ZU7A 3U2TA 1HJJA 1H7LA 3DK5A 4KPZA 2D7RA 1JVGA 1INJA 4M2BA 2AH9A 1W55A 2I5EA 3I0JA 4HG6A 2PX7A 3KIAA 5C36A 4KC4A 1TW5A 2DPWA 3JUJA 2OI5A 3TZTA 1GWWA 1G97A 4L41C 1ON8A 1H7QA 1R81A 4HO4A 3RMVA 4ASYA 5AJNA 1VM8A 1ZJOA 4CJCA 1G2VA 2AGDA 2VXLA 3USRA 4P00A 2C0NA 3FWWA 1G95A 4Y63A 5IFYA 2BO7A 5C4CA 3R3IA 2FFUA 5JQQA 4NANA 4D11C 4B4MA 5FV9A 4M4KA 1LZIA 1JVDA 3I0EA 5C38A 3SXAA 1H7EA 3V0OA 3V8ZA 5IDSA 3SX5A 1R7YA 2P72A 2I5KA 2X5ZA 3QVBA 4FRPA 1G1LA 4CJBA 2BO8A 1R80A 2VSIA 4Y64A 1H5TA 4NALA 1Z90A 1FWYA 3ZGGA 2VSHA 5C1LA 2JCLA 2YQSA 4KXOA 4NAIA 4HO0A 2Z86A 1R7VA 2WGZA 3GUEA 1MP5A 1ZJ0A 2Z87A 3R2WA 3O3PA 1FZWA 1H3MA 5FU0A 3ZLLA 2FYCB 1YROB 1V83A 3D5NA 3Q7UA 5DDTA 2Y4LA 2FFVA 3OH0A 4EE5A 1VZXA 4KNRA 2OEGA 3BCVA 3E25A 5FU8A 3FOQA 5EIYA 3U0YA 3CKJA 1H5SC 5FTSA 2V0IA 3T7MA 3CKQA 2RIXA 1LL2A 3SXEA 1E5KA 4KC1A 4FQWA 2AM5A 1ZHJA 4Y7GA 5C3DA 1O0RA 1H5SD 3SXDA 1XHBA 2VD4A 3TQDA 2W0VA 4FRAA 3CKOA 4O6NA 4MIXA 1WT1A 2YC5A 1H7FA 1O23B 5FTVA 2X65A 2AESA 2Y4KA 1O7QA 1H5RA 2WVMA 4EVWA 1WSZA 1I52A 5C4FA 3K8DA 2OI6A 5CQNX 2RJ9A 1QGSA 2JCKA 3LW6A 1G3LA 2PGVA 1G93A 2FY7A 2A8WA 5AJOA 4B3UA 4E1KA 2BO4A 4FRMA 3CKVA 4KQLA 2GGOA 3V91A 2WEEA 5C4DA 5C4EA 5C1HA 2A8UA 1HJLA 4KPXA 3USQA 3ZF8A 4HO8A 1H4EA 1ZCYA 3D98A 1GWVA 3T7NA 1YP3A 1NHEB 2RIZA 1FO8A 1LL0A 4FRQA 4JISA 2RIYA 2XWMA 4Y7TA 5FUHA 2WE9A 2WVLA 2ZU9A 2Y4MA 2YESA 4HO9A 4DDZA 4IRPA 2WVKA 4G87A 1WVCA 1ZDGA 3OH2A 4CVHA 2RJ1A 2UX8A 5I1FA 3V8YA 4Y6NA 4M28A 5CMJA 1ZJ2A 1H5SA 1GQ9A 3CKNA 1GX4A 3CGXA 3F1YA 5C8RA 5C47A 2P6WA 3DJ4A 3I0LA 2O1GA 3F1CA 1IIMA 2QGIA 1R7XA 4EEMA 2ICXA 3V0NA 2YC3A 3I0CA 3JUKA 3Q4SA 2AM3A 4K6RA 4D48A 3I0KA 1QWJA 2XWNA 4KRVA 1MC3A 3OKRA 1QGQA 3HL3A 4HOCA 4AYLA 2CU2A 1ZI5A 4ZDQA 4KT7A 3SX7A 3OH4A 1LZ7A 1S4OA 1K4VA 2APCA 5D92A 5C3AA 1LZJA 3U2XA 2J0BA 1VPAA 4KC2A 2VXMA 5BXCA 5C4BA 1W77A 2VFZA 1VGUA 4Q7CA 4Y7UA 2YQJA 2VK9A 5C3BA 2OI7A 1S4PA 3ZGFA 4G3SA 3I0GA 1FRWA 4GBPA 1V84A 4HO3A 1G9RA 5IDTA 3K8EA 1YP4A 4FRHA 1FO9A 2Y4JA 5CQOA 2WAWA 2RJ5A 1H7GA 4EEAA 3N9WA 1HM0A 5L6VA 4B4GA 3OH1A 3DUVA 3OGZA 1VGZA 1ZJ1A 1W57A 2VS3A 1ZCVA 5EJ1A 3E26A 1R82A 2RJ8A 2D7IA 2ZU8A 4ECMA 2FYDB 4ASJA 4FREA 5C49A 3I0FA 3SX8A 1INIA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2QKX A;  4D0Z A;  2BO6 A;  4BQH A;  4J18 A;  4HCQ A;  1SS9 A;  4HO6 A;  5FYE A;  3SXB A;  1R7T A;  2P73 A;  1NQI B;  1FGX A;  4XWI A;  2GGQ A;  4IRQ A;  2VS5 A;  1YP2 A;  2XMH A;  1WT0 A;  2YCM A;  5HS2 A;  4FRD A;  3CU0 A;  3EE5 A;  2YQC A;  4HO5 A;  4AC3 A;  2V0H A;  1H5S B;  4EEG A;  2Y6P A;  2Y7A A;  4R7P A;  1FG5 N;  1NKH B;  1XZ6 A;  4B4B A;  1O7O A;  3D8V A;  4LW3 A;  1ZIZ A;  3U2V A;  1G0R A;  3U2U A;  1JV1 A;  3T7O A;  4M2A A;  3SPT A;  1H5T B;  4B5B A;  5CQL X;  3I0H A;  1IIN A;  2AM4 A;  1S4N A;  1VGT A;  4HO2 A;  4AAW A;  4Y9X A;  1ZJ3 A;  1LZ0 A;  2VS4 A;  2RJ7 A;  4NAK A;  3V90 A;  4B2W A;  5EJZ A;  1OQM B;  2E8B A;  2X60 A;  4KNX A;  3ST8 A;  2V0K A;  2XME A;  4CJ8 A;  4EE4 A;  4EE3 A;  4AYJ A;  2ICY A;  4DE7 A;  3IOH A;  1TVY A;  2W0W A;  3V0P A;  2FYB A;  4MYB A;  1VZT A;  2QH5 A;  1H7T A;  1H4D A;  3PNN A;  4FCU A;  2MZB A;  1ZDF A;  2AE7 A;  4FRL A;  3V0Q A;  1PZT A;  1LL3 A;  1R7U A;  4ARW A;  1FXJ A;  1H4C A;  1VH1 A;  5C1G A;  2PA4 A;  2JCO A;  4Y6U A;  1EYR A;  1MP3 A;  1G8O A;  1WT3 A;  4B2X A;  3SXG A;  1ZJP A;  2OEF A;  1GX0 A;  1ZCT A;  3PKP A;  1ZI1 A;  4Y7V A;  2Q4J A;  1JYK A;  1FR9 A;  1G23 A;  3SX3 A;  1V82 A;  2PGY A;  2YQH A;  4D0T A;  4G3P A;  5J49 A;  4G3Q A;  3POL A;  1H5R B;  1ZCU A;  1NMM B;  4LW6 A;  4EEO A;  2V0J A;  2O1F A;  3V0M A;  3Q80 A;  4FCE A;  1MP4 A;  1VZU A;  1GQC A;  1H7H A;  2AEC A;  5L6S A;  3BRK X;  4DEC A;  4MND A;  1HV9 A;  3IOJ A;  3PKQ A;  3RMW A;  3RSB A;  3ZLK A;  3NGW A;  4FRB A;  1PZY B;  4Y62 A;  1QG8 A;  3OH3 A;  5CQM X;  1VGW A;  5C48 A;  3IOI A;  5CMH A;  3U2W A;  1WT2 A;  5CMI A;  2O1H A;  1ON6 A;  2I7B A;  3V0L A;  1FOA A;  5AJP A;  4B42 A;  1EZI A;  3JTJ A;  2JCJ A;  5CQP A;  3SXC A;  2XWL A;  2RIT A;  4FRO A;  1ZI3 A;  4UEG A;  2RJ4 A;  2E3D A;  1FR8 A;  1VIC A;  4Y7F A;  4C2S A;  2RJ6 A;  5DDV A;  1JYL A;  4JD0 A;  2RJ0 A;  5CMG X;  1GA8 A;  1JV3 A;  1LVW A;  1ZI4 A;  1TZF A;  4D11 A;  2D0J A;  4P02 A;  1TW1 A;  2X5S A;  1OMZ A;  2V0L A;  3U0X A;  1FGG A;  1FXO A;  4BMA A;  1KWS A;  1HM9 A;  3OC9 A;  2FYA A;  5CMF X;  1VH3 A;  3OAM A;  1HM8 A;  3I0I X;  1NWG B;  1OMX A;  1NF5 B;  2NXV A;  3I0D A;  4YS8 A;  2ZU7 A;  3U2T A;  1HJJ A;  1H7L A;  3DK5 A;  4KPZ A;  2D7R A;  1JVG A;  1INJ A;  4M2B A;  2AH9 A;  1W55 A;  2I5E A;  3I0J A;  4HG6 A;  2PX7 A;  3KIA A;  5C36 A;  4KC4 A;  1TW5 A;  2DPW A;  3JUJ A;  2OI5 A;  3TZT A;  1GWW A;  1G97 A;  4L41 C;  1ON8 A;  1H7Q A;  1R81 A;  4HO4 A;  3RMV A;  4ASY A;  5AJN A;  1VM8 A;  1ZJO A;  4CJC A;  1G2V A;  2AGD A;  2VXL A;  3USR A;  4P00 A;  3FWW A;  1G95 A;  4Y63 A;  5IFY A;  2BO7 A;  5C4C A;  3R3I A;  2FFU A;  5JQQ A;  4NAN A;  4D11 C;  4B4M A;  5FV9 A;  4M4K A;  1LZI A;  1JVD A;  3I0E A;  5C38 A;  3SXA A;  1H7E A;  3V0O A;  3V8Z A;  5IDS A;  3SX5 A;  1R7Y A;  2P72 A;  2I5K A;  2X5Z A;  3QVB A;  4FRP A;  1G1L A;  4CJB A;  2BO8 A;  1R80 A;  2VSI A;  4Y64 A;  1H5T A;  4NAL A;  1Z90 A;  1FWY A;  3ZGG A;  2VSH A;  5C1L A;  2JCL A;  2YQS A;  4KXO A;  4NAI A;  4HO0 A;  2Z86 A;  1R7V A;  2WGZ A;  3GUE A;  1MP5 A;  1ZJ0 A;  2Z87 A;  3R2W A;  3O3P A;  1FZW A;  1H3M A;  5FU0 A;  3ZLL A;  2FYC B;  1YRO B;  1V83 A;  3D5N A;  3Q7U A;  5DDT A;  2Y4L A;  2FFV A;  3OH0 A;  4EE5 A;  1VZX A;  4KNR A;  2OEG A;  3BCV A;  3E25 A;  5FU8 A;  3FOQ A;  5EIY A;  3U0Y A;  3CKJ A;  1H5S C;  5FTS A;  2V0I A;  3T7M A;  3CKQ A;  2RIX A;  1LL2 A;  3SXE A;  1E5K A;  4KC1 A;  4FQW A;  2AM5 A;  1ZHJ A;  4Y7G A;  5C3D A;  1O0R A;  1H5S D;  3SXD A;  1XHB A;  2VD4 A;  3TQD A;  2W0V A;  4FRA A;  3CKO A;  1WT1 A;  2YC5 A;  1H7F A;  1O23 B;  5FTV A;  2X65 A;  2AES A;  2Y4K A;  1O7Q A;  1H5R A;  2WVM A;  4EVW A;  1WSZ A;  1I52 A;  5C4F A;  3K8D A;  2OI6 A;  5CQN X;  2RJ9 A;  1QGS A;  2JCK A;  3LW6 A;  1G3L A;  2PGV A;  1G93 A;  2FY7 A;  2A8W A;  5AJO A;  4B3U A;  4E1K A;  2BO4 A;  4FRM A;  3CKV A;  4KQL A;  2GGO A;  3V91 A;  2WEE A;  5C4D A;  5C4E A;  5C1H A;  2A8U A;  1HJL A;  4KPX A;  3USQ A;  3ZF8 A;  4HO8 A;  1H4E A;  1ZCY A;  3D98 A;  1GWV A;  3T7N A;  1YP3 A;  1NHE B;  2RIZ A;  1FO8 A;  1LL0 A;  4FRQ A;  4JIS A;  2RIY A;  2XWM A;  4Y7T A;  5FUH A;  2WE9 A;  2WVL A;  2ZU9 A;  2Y4M A;  2YES A;  4HO9 A;  4DDZ A;  4IRP A;  2WVK A;  4G87 A;  1WVC A;  1ZDG A;  3OH2 A;  4CVH A;  2RJ1 A;  2UX8 A;  5I1F A;  3V8Y A;  4Y6N A;  4M28 A;  5CMJ A;  1ZJ2 A;  1H5S A;  1GQ9 A;  3CKN A;  1GX4 A;  3CGX A;  3F1Y A;  5C8R A;  5C47 A;  2P6W A;  3DJ4 A;  3I0L A;  2O1G A;  3F1C A;  1IIM A;  2QGI A;  1R7X A;  4EEM A;  2ICX A;  3V0N A;  2YC3 A;  3I0C A;  3JUK A;  3Q4S A;  2AM3 A;  4K6R A;  4D48 A;  3I0K A;  1QWJ A;  2XWN A;  4KRV A;  1MC3 A;  3OKR A;  1QGQ A;  3HL3 A;  4HOC A;  4AYL A;  2CU2 A;  1ZI5 A;  4ZDQ A;  4KT7 A;  3SX7 A;  3OH4 A;  1LZ7 A;  1S4O A;  1K4V A;  2APC A;  5C3A A;  3U2X A;  1LZJ A;  1VPA A;  4KC2 A;  2VXM A;  5BXC A;  5C4B A;  1W77 A;  2VFZ A;  1VGU A;  4Y7U A;  2YQJ A;  5C3B A;  2OI7 A;  1S4P A;  3ZGF A;  4G3S A;  3I0G A;  1FRW A;  4GBP A;  1V84 A;  4HO3 A;  1G9R A;  5IDT A;  3K8E A;  1YP4 A;  4FRH A;  1FO9 A;  2Y4J A;  5CQO A;  2WAW A;  2RJ5 A;  1H7G A;  4EEA A;  3N9W A;  1HM0 A;  5L6V A;  4B4G A;  3OH1 A;  3DUV A;  3OGZ A;  1VGZ A;  1ZJ1 A;  1W57 A;  2VS3 A;  1ZCV A;  5EJ1 A;  3E26 A;  1R82 A;  2RJ8 A;  2D7I A;  2ZU8 A;  4ECM A;  2FYD B;  4ASJ A;  4FRE A;  5C49 A;  3I0F A;  3SX8 A;  1INI A; 
#chains in the Genus database with same CATH topology
 2QKX A;  4D0Z A;  2BO6 A;  4BQH A;  4J18 A;  4HCQ A;  1SS9 A;  4HO6 A;  5FYE A;  3SXB A;  1R7T A;  2P73 A;  1NQI B;  1FGX A;  4XWI A;  2GGQ A;  4IRQ A;  2VS5 A;  1YP2 A;  2XMH A;  1WT0 A;  2YCM A;  5HS2 A;  4FRD A;  3CU0 A;  3EE5 A;  2YQC A;  4HO5 A;  4AC3 A;  2V0H A;  1H5S B;  4O6M A;  4EEG A;  2Y6P A;  2Y7A A;  4R7P A;  1FG5 N;  1NKH B;  1XZ6 A;  4B4B A;  1O7O A;  3D8V A;  4LW3 A;  1ZIZ A;  3U2V A;  1G0R A;  3U2U A;  1JV1 A;  3T7O A;  4M2A A;  3SPT A;  1H5T B;  4B5B A;  5CQL X;  3I0H A;  1IIN A;  2AM4 A;  1S4N A;  1VGT A;  4HO2 A;  4AAW A;  4Y9X A;  1ZJ3 A;  1LZ0 A;  2VS4 A;  2RJ7 A;  4NAK A;  3V90 A;  4B2W A;  5EJZ A;  1OQM B;  2E8B A;  2X60 A;  4FIX A;  4KNX A;  3ST8 A;  2V0K A;  2XME A;  4CJ8 A;  4EE4 A;  4EE3 A;  4AYJ A;  2ICY A;  4DE7 A;  3IOH A;  1TVY A;  2W0W A;  3V0P A;  2FYB A;  4MYB A;  1VZT A;  2QH5 A;  1H7T A;  1H4D A;  3PNN A;  4FCU A;  2MZB A;  1ZDF A;  2AE7 A;  4FRL A;  5D91 A;  3V0Q A;  1PZT A;  1LL3 A;  1R7U A;  4ARW A;  1FXJ A;  1H4C A;  1VH1 A;  5C1G A;  2PA4 A;  2JCO A;  4Y6U A;  1EYR A;  1MP3 A;  1G8O A;  1WT3 A;  4B2X A;  3SXG A;  1ZJP A;  2OEF A;  1GX0 A;  1ZCT A;  3PKP A;  1ZI1 A;  4Y7V A;  2Q4J A;  1JYK A;  1FR9 A;  1G23 A;  3SX3 A;  1V82 A;  2PGY A;  2YQH A;  4D0T A;  4G3P A;  5J49 A;  4G3Q A;  3POL A;  1H5R B;  1ZCU A;  1NMM B;  4LW6 A;  4EEO A;  2V0J A;  2O1F A;  3V0M A;  3Q80 A;  4FCE A;  1MP4 A;  1VZU A;  1GQC A;  1H7H A;  2AEC A;  5L6S A;  3BRK X;  4DEC A;  4MND A;  1HV9 A;  3IOJ A;  3PKQ A;  3RMW A;  3RSB A;  3ZLK A;  3NGW A;  4FRB A;  1PZY B;  4Y62 A;  1QG8 A;  3OH3 A;  5CQM X;  1VGW A;  5C48 A;  3IOI A;  5CMH A;  3U2W A;  1WT2 A;  5CMI A;  2O1H A;  1ON6 A;  2I7B A;  3V0L A;  1FOA A;  5AJP A;  4B42 A;  1EZI A;  3JTJ A;  2JCJ A;  5CQP A;  3SXC A;  2XWL A;  2RIT A;  4FRO A;  1ZI3 A;  4UEG A;  2RJ4 A;  2E3D A;  1FR8 A;  1VIC A;  4Y7F A;  4C2S A;  2RJ6 A;  5DDV A;  1JYL A;  4JD0 A;  2J0A A;  2RJ0 A;  5CMG X;  1GA8 A;  1JV3 A;  1LVW A;  1ZI4 A;  1TZF A;  4D11 A;  2D0J A;  4P02 A;  1TW1 A;  2X5S A;  1OMZ A;  2V0L A;  3U0X A;  1FGG A;  1FXO A;  4BMA A;  1KWS A;  1HM9 A;  3OC9 A;  2FYA A;  5CMF X;  1VH3 A;  3OAM A;  1HM8 A;  4FIY A;  3I0I X;  1NWG B;  1OMX A;  1NF5 B;  2NXV A;  3I0D A;  4YS8 A;  2ZU7 A;  3U2T A;  1HJJ A;  1H7L A;  3DK5 A;  4KPZ A;  2D7R A;  1JVG A;  1INJ A;  4M2B A;  2AH9 A;  1W55 A;  2I5E A;  3I0J A;  4HG6 A;  2PX7 A;  3KIA A;  5C36 A;  4KC4 A;  1TW5 A;  2DPW A;  3JUJ A;  2OI5 A;  3TZT A;  1GWW A;  1G97 A;  4L41 C;  1ON8 A;  1H7Q A;  1R81 A;  4HO4 A;  3RMV A;  4ASY A;  5AJN A;  1VM8 A;  1ZJO A;  4CJC A;  1G2V A;  2AGD A;  2VXL A;  3USR A;  4P00 A;  2C0N A;  3FWW A;  1G95 A;  4Y63 A;  5IFY A;  2BO7 A;  5C4C A;  3R3I A;  2FFU A;  5JQQ A;  4NAN A;  4D11 C;  4B4M A;  5FV9 A;  4M4K A;  1LZI A;  1JVD A;  3I0E A;  5C38 A;  3SXA A;  1H7E A;  3V0O A;  3V8Z A;  5IDS A;  3SX5 A;  1R7Y A;  2P72 A;  2I5K A;  2X5Z A;  3QVB A;  4FRP A;  1G1L A;  4CJB A;  2BO8 A;  1R80 A;  2VSI A;  4Y64 A;  1H5T A;  4NAL A;  1Z90 A;  1FWY A;  3ZGG A;  2VSH A;  5C1L A;  2JCL A;  2YQS A;  4KXO A;  4NAI A;  4HO0 A;  2Z86 A;  1R7V A;  2WGZ A;  3GUE A;  1MP5 A;  1ZJ0 A;  2Z87 A;  3R2W A;  3O3P A;  1FZW A;  1H3M A;  5FU0 A;  3ZLL A;  2FYC B;  1YRO B;  1V83 A;  3D5N A;  3Q7U A;  5DDT A;  2Y4L A;  2FFV A;  3OH0 A;  4EE5 A;  1VZX A;  4KNR A;  2OEG A;  3BCV A;  3E25 A;  5FU8 A;  3FOQ A;  5EIY A;  3U0Y A;  3CKJ A;  1H5S C;  5FTS A;  2V0I A;  3T7M A;  3CKQ A;  2RIX A;  1LL2 A;  3SXE A;  1E5K A;  4KC1 A;  4FQW A;  2AM5 A;  1ZHJ A;  4Y7G A;  5C3D A;  1O0R A;  1H5S D;  3SXD A;  1XHB A;  2VD4 A;  3TQD A;  2W0V A;  4FRA A;  3CKO A;  4O6N A;  4MIX A;  1WT1 A;  2YC5 A;  1H7F A;  1O23 B;  5FTV A;  2X65 A;  2AES A;  2Y4K A;  1O7Q A;  1H5R A;  2WVM A;  4EVW A;  1WSZ A;  1I52 A;  5C4F A;  3K8D A;  2OI6 A;  5CQN X;  2RJ9 A;  1QGS A;  2JCK A;  3LW6 A;  1G3L A;  2PGV A;  1G93 A;  2FY7 A;  2A8W A;  5AJO A;  4B3U A;  4E1K A;  2BO4 A;  4FRM A;  3CKV A;  4KQL A;  2GGO A;  3V91 A;  2WEE A;  5C4D A;  5C4E A;  5C1H A;  2A8U A;  1HJL A;  4KPX A;  3USQ A;  3ZF8 A;  4HO8 A;  1H4E A;  1ZCY A;  3D98 A;  1GWV A;  3T7N A;  1YP3 A;  1NHE B;  2RIZ A;  1FO8 A;  1LL0 A;  4FRQ A;  4JIS A;  2RIY A;  2XWM A;  4Y7T A;  5FUH A;  2WE9 A;  2WVL A;  2ZU9 A;  2Y4M A;  2YES A;  4HO9 A;  4DDZ A;  4IRP A;  2WVK A;  4G87 A;  1WVC A;  1ZDG A;  3OH2 A;  4CVH A;  2RJ1 A;  2UX8 A;  5I1F A;  3V8Y A;  4Y6N A;  4M28 A;  5CMJ A;  1ZJ2 A;  1H5S A;  1GQ9 A;  3CKN A;  1GX4 A;  3CGX A;  3F1Y A;  5C8R A;  5C47 A;  2P6W A;  3DJ4 A;  3I0L A;  2O1G A;  3F1C A;  1IIM A;  2QGI A;  1R7X A;  4EEM A;  2ICX A;  3V0N A;  2YC3 A;  3I0C A;  3JUK A;  3Q4S A;  2AM3 A;  4K6R A;  4D48 A;  3I0K A;  1QWJ A;  2XWN A;  4KRV A;  1MC3 A;  3OKR A;  1QGQ A;  3HL3 A;  4HOC A;  4AYL A;  2CU2 A;  1ZI5 A;  4ZDQ A;  4KT7 A;  3SX7 A;  3OH4 A;  1LZ7 A;  1S4O A;  1K4V A;  2APC A;  5D92 A;  5C3A A;  1LZJ A;  3U2X A;  2J0B A;  1VPA A;  4KC2 A;  2VXM A;  5BXC A;  5C4B A;  1W77 A;  2VFZ A;  1VGU A;  4Q7C A;  4Y7U A;  2YQJ A;  2VK9 A;  5C3B A;  2OI7 A;  1S4P A;  3ZGF A;  4G3S A;  3I0G A;  1FRW A;  4GBP A;  1V84 A;  4HO3 A;  1G9R A;  5IDT A;  3K8E A;  1YP4 A;  4FRH A;  1FO9 A;  2Y4J A;  5CQO A;  2WAW A;  2RJ5 A;  1H7G A;  4EEA A;  3N9W A;  1HM0 A;  5L6V A;  4B4G A;  3OH1 A;  3DUV A;  3OGZ A;  1VGZ A;  1ZJ1 A;  1W57 A;  2VS3 A;  1ZCV A;  5EJ1 A;  3E26 A;  1R82 A;  2RJ8 A;  2D7I A;  2ZU8 A;  4ECM A;  2FYD B;  4ASJ A;  4FRE A;  5C49 A;  3I0F A;  3SX8 A;  1INI A; 
#chains in the Genus database with same CATH homology
 2QKX A;  4D0Z A;  2BO6 A;  4BQH A;  4J18 A;  4HCQ A;  1SS9 A;  4HO6 A;  5FYE A;  3SXB A;  1R7T A;  2P73 A;  1NQI B;  1FGX A;  4XWI A;  2GGQ A;  4IRQ A;  2VS5 A;  1YP2 A;  2XMH A;  1WT0 A;  2YCM A;  5HS2 A;  4FRD A;  3CU0 A;  3EE5 A;  2YQC A;  4HO5 A;  4AC3 A;  2V0H A;  1H5S B;  4O6M A;  4EEG A;  2Y6P A;  2Y7A A;  4R7P A;  1FG5 N;  1NKH B;  1XZ6 A;  4B4B A;  1O7O A;  3D8V A;  4LW3 A;  1ZIZ A;  3U2V A;  1G0R A;  3U2U A;  1JV1 A;  3T7O A;  4M2A A;  3SPT A;  1H5T B;  4B5B A;  5CQL X;  3I0H A;  1IIN A;  2AM4 A;  1S4N A;  1VGT A;  4HO2 A;  4AAW A;  4Y9X A;  1ZJ3 A;  1LZ0 A;  2VS4 A;  2RJ7 A;  4NAK A;  3V90 A;  4B2W A;  5EJZ A;  1OQM B;  2E8B A;  2X60 A;  4FIX A;  4KNX A;  3ST8 A;  2V0K A;  2XME A;  4CJ8 A;  4EE4 A;  4EE3 A;  4AYJ A;  2ICY A;  4DE7 A;  3IOH A;  1TVY A;  2W0W A;  3V0P A;  2FYB A;  4MYB A;  1VZT A;  2QH5 A;  1H7T A;  1H4D A;  3PNN A;  4FCU A;  2MZB A;  1ZDF A;  2AE7 A;  4FRL A;  5D91 A;  3V0Q A;  1PZT A;  1LL3 A;  1R7U A;  4ARW A;  1FXJ A;  1H4C A;  1VH1 A;  5C1G A;  2PA4 A;  2JCO A;  4Y6U A;  1EYR A;  1MP3 A;  1G8O A;  1WT3 A;  4B2X A;  3SXG A;  1ZJP A;  2OEF A;  1GX0 A;  1ZCT A;  3PKP A;  1ZI1 A;  4Y7V A;  2Q4J A;  1JYK A;  1FR9 A;  1G23 A;  3SX3 A;  1V82 A;  2PGY A;  2YQH A;  4D0T A;  4G3P A;  5J49 A;  4G3Q A;  3POL A;  1H5R B;  1ZCU A;  1NMM B;  4LW6 A;  4EEO A;  2V0J A;  2O1F A;  3V0M A;  3Q80 A;  4FCE A;  1MP4 A;  1VZU A;  1GQC A;  1H7H A;  2AEC A;  5L6S A;  3BRK X;  4DEC A;  4MND A;  1HV9 A;  3IOJ A;  3PKQ A;  3RMW A;  3RSB A;  3ZLK A;  3NGW A;  4FRB A;  1PZY B;  4Y62 A;  1QG8 A;  3OH3 A;  5CQM X;  1VGW A;  5C48 A;  3IOI A;  5CMH A;  3U2W A;  1WT2 A;  5CMI A;  2O1H A;  1ON6 A;  2I7B A;  3V0L A;  1FOA A;  5AJP A;  4B42 A;  1EZI A;  3JTJ A;  2JCJ A;  5CQP A;  3SXC A;  2XWL A;  2RIT A;  4FRO A;  1ZI3 A;  4UEG A;  2RJ4 A;  2E3D A;  1FR8 A;  1VIC A;  4Y7F A;  4C2S A;  2RJ6 A;  5DDV A;  1JYL A;  4JD0 A;  2J0A A;  2RJ0 A;  5CMG X;  1GA8 A;  1JV3 A;  1LVW A;  1ZI4 A;  1TZF A;  4D11 A;  2D0J A;  4P02 A;  1TW1 A;  2X5S A;  1OMZ A;  2V0L A;  3U0X A;  1FGG A;  1FXO A;  4BMA A;  1KWS A;  1HM9 A;  3OC9 A;  2FYA A;  5CMF X;  1VH3 A;  3OAM A;  1HM8 A;  4FIY A;  3I0I X;  1NWG B;  1OMX A;  1NF5 B;  2NXV A;  3I0D A;  4YS8 A;  2ZU7 A;  3U2T A;  1HJJ A;  1H7L A;  3DK5 A;  4KPZ A;  2D7R A;  1JVG A;  1INJ A;  4M2B A;  2AH9 A;  1W55 A;  2I5E A;  3I0J A;  4HG6 A;  2PX7 A;  3KIA A;  5C36 A;  4KC4 A;  1TW5 A;  2DPW A;  3JUJ A;  2OI5 A;  3TZT A;  1GWW A;  1G97 A;  4L41 C;  1ON8 A;  1H7Q A;  1R81 A;  4HO4 A;  3RMV A;  4ASY A;  5AJN A;  1VM8 A;  1ZJO A;  4CJC A;  1G2V A;  2AGD A;  2VXL A;  3USR A;  4P00 A;  2C0N A;  3FWW A;  1G95 A;  4Y63 A;  5IFY A;  2BO7 A;  5C4C A;  3R3I A;  2FFU A;  5JQQ A;  4NAN A;  4D11 C;  4B4M A;  5FV9 A;  4M4K A;  1LZI A;  1JVD A;  3I0E A;  5C38 A;  3SXA A;  1H7E A;  3V0O A;  3V8Z A;  5IDS A;  3SX5 A;  1R7Y A;  2P72 A;  2I5K A;  2X5Z A;  3QVB A;  4FRP A;  1G1L A;  4CJB A;  2BO8 A;  1R80 A;  2VSI A;  4Y64 A;  1H5T A;  4NAL A;  1Z90 A;  1FWY A;  3ZGG A;  2VSH A;  5C1L A;  2JCL A;  2YQS A;  4KXO A;  4NAI A;  4HO0 A;  2Z86 A;  1R7V A;  2WGZ A;  3GUE A;  1MP5 A;  1ZJ0 A;  2Z87 A;  3R2W A;  3O3P A;  1FZW A;  1H3M A;  5FU0 A;  3ZLL A;  2FYC B;  1YRO B;  1V83 A;  3D5N A;  3Q7U A;  5DDT A;  2Y4L A;  2FFV A;  3OH0 A;  4EE5 A;  1VZX A;  4KNR A;  2OEG A;  3BCV A;  3E25 A;  5FU8 A;  3FOQ A;  5EIY A;  3U0Y A;  3CKJ A;  1H5S C;  5FTS A;  2V0I A;  3T7M A;  3CKQ A;  2RIX A;  1LL2 A;  3SXE A;  1E5K A;  4KC1 A;  4FQW A;  2AM5 A;  1ZHJ A;  4Y7G A;  5C3D A;  1O0R A;  1H5S D;  3SXD A;  1XHB A;  2VD4 A;  3TQD A;  2W0V A;  4FRA A;  3CKO A;  4O6N A;  4MIX A;  1WT1 A;  2YC5 A;  1H7F A;  1O23 B;  5FTV A;  2X65 A;  2AES A;  2Y4K A;  1O7Q A;  1H5R A;  2WVM A;  4EVW A;  1WSZ A;  1I52 A;  5C4F A;  3K8D A;  2OI6 A;  5CQN X;  2RJ9 A;  1QGS A;  2JCK A;  3LW6 A;  1G3L A;  2PGV A;  1G93 A;  2FY7 A;  2A8W A;  5AJO A;  4B3U A;  4E1K A;  2BO4 A;  4FRM A;  3CKV A;  4KQL A;  2GGO A;  3V91 A;  2WEE A;  5C4D A;  5C4E A;  5C1H A;  2A8U A;  1HJL A;  4KPX A;  3USQ A;  3ZF8 A;  4HO8 A;  1H4E A;  1ZCY A;  3D98 A;  1GWV A;  3T7N A;  1YP3 A;  1NHE B;  2RIZ A;  1FO8 A;  1LL0 A;  4FRQ A;  4JIS A;  2RIY A;  2XWM A;  4Y7T A;  5FUH A;  2WE9 A;  2WVL A;  2ZU9 A;  2Y4M A;  2YES A;  4HO9 A;  4DDZ A;  4IRP A;  2WVK A;  4G87 A;  1WVC A;  1ZDG A;  3OH2 A;  4CVH A;  2RJ1 A;  2UX8 A;  5I1F A;  3V8Y A;  4Y6N A;  4M28 A;  5CMJ A;  1ZJ2 A;  1H5S A;  1GQ9 A;  3CKN A;  1GX4 A;  3CGX A;  3F1Y A;  5C8R A;  5C47 A;  2P6W A;  3DJ4 A;  3I0L A;  2O1G A;  3F1C A;  1IIM A;  2QGI A;  1R7X A;  4EEM A;  2ICX A;  3V0N A;  2YC3 A;  3I0C A;  3JUK A;  3Q4S A;  2AM3 A;  4K6R A;  4D48 A;  3I0K A;  1QWJ A;  2XWN A;  4KRV A;  1MC3 A;  3OKR A;  1QGQ A;  3HL3 A;  4HOC A;  4AYL A;  2CU2 A;  1ZI5 A;  4ZDQ A;  4KT7 A;  3SX7 A;  3OH4 A;  1LZ7 A;  1S4O A;  1K4V A;  2APC A;  5D92 A;  5C3A A;  1LZJ A;  3U2X A;  2J0B A;  1VPA A;  4KC2 A;  2VXM A;  5BXC A;  5C4B A;  1W77 A;  2VFZ A;  1VGU A;  4Q7C A;  4Y7U A;  2YQJ A;  2VK9 A;  5C3B A;  2OI7 A;  1S4P A;  3ZGF A;  4G3S A;  3I0G A;  1FRW A;  4GBP A;  1V84 A;  4HO3 A;  1G9R A;  5IDT A;  3K8E A;  1YP4 A;  4FRH A;  1FO9 A;  2Y4J A;  5CQO A;  2WAW A;  2RJ5 A;  1H7G A;  4EEA A;  3N9W A;  1HM0 A;  5L6V A;  4B4G A;  3OH1 A;  3DUV A;  3OGZ A;  1VGZ A;  1ZJ1 A;  1W57 A;  2VS3 A;  1ZCV A;  5EJ1 A;  3E26 A;  1R82 A;  2RJ8 A;  2D7I A;  2ZU8 A;  4ECM A;  2FYD B;  4ASJ A;  4FRE A;  5C49 A;  3I0F A;  3SX8 A;  1INI A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...