5CQLX

Gtb mutant with mercury - e303a
Total Genus 81
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
81
sequence length
282
structure length
261
Chain Sequence
VSLPRMVYPQPKVLTPCRKDVLVVTPWLAPIVWEGTFNIDILNEQFRLQNTTIGLTVFAIKKYVAFLKLFLETAEKHFMVGHRVHYYVFTDQPAAVPRVTLGTGRQLSVLEVCERRFLSEVDYLVCVDVDMEFRDHVGVEILTPLFGTLHPSFYGSSREAFTYERRPQSQAYIPKDEGDFYYMGAFFGGSVQEVQRLTRACHQAMMVDQANGIEVWHDASHLNKYLLRHKPTKVLSPEYLWDQQLLGWPAVLRKLRFTAVP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Histo-blood group ABO system transferase
publication title Glycosyltransfer in mutants of putative catalytic residue Glu303 of the human ABO(H) A and B blood group glycosyltransferases GTA and GTB proceeds through a labile active site.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 81
structure length 261
sequence length 282
ec nomenclature ec 2.4.1.37: Fucosylgalactoside 3-alpha-galactosyltransferase.
pdb deposition date 2015-07-22
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.550.10 Alpha Beta Alpha-Beta Complex Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A 5cqlX00
4FRLA 1H7EA 2Q4JA 2JCKA 5C36A 1E5KA 3EE5A 4KNXA 5C4DA 4Y7GA 5C4EA 1O23B 1MP3A 4ARWA 4K6RA 1O7QA 4D11C 3K8EA 3D8VA 1WT3A 4YS8A 3OH4A 1EZIA 4AC3A 4EEAA 2AH9A 2Y4KA 4KC1A 2RJ5A 2QKXA 4KNRA 1SS9A 1JV3A 1H4CA 4HO0A 2XWNA 2OI7A 2CU2A 4M2AA 4FRQA 3CKVA 1H5RA 1V82A 1R80A 4D0ZA 3JUKA 4FROA 1ZJ0A 1R82A 1H5RB 1O0RA 2UX8A 2DPWA 4KXOA 3DUVA 4FRMA 2O1GA 3OH1A 2O1FA 2WAWA 3BCVA 2VSHA 3I0EA 1QGQA 2AM3A 1MP5A 5FTVA 3SXDA 2W0VA 3FOQA 5AJNA 2RIYA 1GWVA 1VM8A 4HO8A 3OAMA 3SX3A 4B5BA 3BRKX 3CKJA 3QVBA 4HO6A 4Y9XA 2WVMA 3OH2A 2YESA 4HO9A 5AJPA 2VD4A 4ZDQA 5CQNX 4FRHA 2YQCA 4KPZA 1ZJ1A 4MNDA 1VICA 4Y7VA 2X5ZA 4ASYA 4MYBA 4FQWA 1MP4A 3T7NA 2FYCB 4HO3A 4CVHA 1H7GA 4HO4A 3V8ZA 5C4FA 3TZTA 3CKNA 1IIMA 4EVWA 3USRA 3CU0A 3V91A 1NKHB 1NHEB 1INIA 1JV1A 4EE4A 3RMVA 5EJZA 1ZDGA 1WT1A 2YQSA 3CKOA 4LW3A 1ZI3A 2BO8A 1ON8A 1FO8A 4BQHA 3I0JA 1S4NA 1R7TA 4B2XA 1ZJOA 1G95A 2JCLA 4FRBA 2E8BA 1OQMB 3U2VA 3I0IX 1G2VA 1WT0A 4KPXA 1R7YA 2WE9A 1FOAA 3U2XA 5CMHA 2D0JA 4B4MA 3V8YA 2BO7A 1HM9A 1NWGB 2AM4A 1G97A 5C1LA 4G87A 1LL0A 2Y7AA 1NMMB 1VZXA 3SXAA 1QG8A 1LZJA 2OEGA 3USQA 4EE5A 2FFUA 1ZCYA 2V0KA 1H7QA 3I0DA 1G3LA 2QGIA 5DDVA 3OGZA 5C8RA 1ZI1A 3KIAA 1QWJA 2FY7A 1TW5A 4FCEA 1WSZA 2Z87A 1LZIA 4NAIA 1ON6A 2YQJA 4Y7TA 1GX4A 3T7OA 3E26A 4ASJA 1R7XA 4P00A 2BO6A 2PX7A 2AGDA 4AYJA 4LW6A 5CMIA 3I0GA 1H3MA 2ICXA 3IOHA 3SX8A 4L41C 2RJ7A 3SXBA 4Y62A 2Y6PA 2XMEA 2WEEA 1LZ7A 2V0IA 5FU8A 1ZJ2A 1ZCVA 3OC9A 4HO5A 5JQQA 5L6VA 3V0NA 4ECMA 5FTSA 1VZTA 2E3DA 4AYLA 1H5SA 3F1YA 1OMZA 2GGOA 4KRVA 1H5SB 2RIXA 3ST8A 1G93A 2O1HA 3O3PA 1VGTA 2RJ9A 2XMHA 4EEOA 1FWYA 4IRQA 1FO9A 3DJ4A 2GGQA 2I5EA 4EEGA 3SX7A 2ZU7A 2RJ1A 1ZI5A 1R7UA 1EYRA 2VS5A 4CJBA 1XHBA 3SX5A 3U2WA 5L6SA 3U0XA 1HV9A 2I5KA 4DDZA 5C49A 3Q80A 3ZGGA 4CJ8A 5IFYA 3N9WA 1R7VA 2RIZA 2A8UA 1FR9A 4B3UA 1Z90A 2V0LA 3R2WA 3JUJA 2WVLA 2PA4A 3E25A 2VSIA 4GBPA 1G23A 1XZ6A 1TZFA 3PKQA 5C47A 3ZLKA 5FU0A 4IRPA 1OMXA 4Y6NA 1V83A 1S4PA 2RJ0A 2Z86A 1ZI4A 4KC2A 4FRDA 5FUHA 3SXGA 2A8WA 3D98A 1LZ0A 3LW6A 2QH5A 1H7FA 2D7RA 5J49A 2APCA 1JYLA 3CKQA 4NALA 1VGZA 4M4KA 1ZCTA 4AAWA 1ZJ3A 2RJ4A 2AESA 3D5NA 1LVWA 2AM5A 1H4DA 5C1GA 2JCJA 4D11A 2OI6A 4J18A 4KT7A 1H7TA 3I0LA 1G0RA 4D48A 1YROB 3Q4SA 2RITA 2YC3A 4R7PA 4G3QA 1W57A 4G3PA 4HCQA 1H7HA 1HJLA 3V0PA 5C3DA 2XWLA 3SXEA 3SXCA 2I7BA 1R81A 1YP3A 2VS4A 2ZU8A 4B42A 3SPTA 5AJOA 4EE3A 3I0HA 2PGVA 3NGWA 3V90A 3I0CA 2W0WA 1ZIZA 4Y6UA 3FWWA 2BO4A 2P72A 4B4BA 4G3SA 3ZGFA 1G8OA 5DDTA 4HOCA 3TQDA 1G1LA 1JYKA 5C1HA 3V0MA 3PNNA 3IOJA 1PZTA 1VGUA 1GQCA 4BMAA 3V0OA 2OI5A 5CMFX 4HG6A 3IOIA 3Q7UA 3GUEA 4B2WA 4FRPA 4Y7UA 1HJJA 4FREA 3U0YA 2VXMA 3OKRA 1H7LA 1YP4A 5HS2A 1FXJA 2YQHA 5CQPA 3POLA 2X60A 4CJCA 4P02A 4FCUA 1IINA 1VH1A 5BXCA 3T7MA 5I1FA 1FG5N 1INJA 4JISA 5C4CA 1FR8A 1H5TA 1W77A 4E1KA 4XWIA 1H5TB 2V0HA 3U2TA 1HM0A 4JD0A 2FYAA 5C48A 5FV9A 2X65A 2ZU9A 1VGWA 1PZYB 2VFZA 3F1CA 3OH3A 3PKPA 1FRWA 5FYEA 2FYDB 4Y63A 1GA8A 4DE7A 4Y64A 1VPAA 2FFVA 2MZBA 5EJ1A 1WT2A 1TW1A 1FGGA 4NANA 2P6WA 1H4EA 1FZWA 2OEFA 2XWMA 5CMGX 1ZDFA 1KWSA 2D7IA 2Y4MA 4HO2A 4EEMA 5C38A 1JVGA 1H5SC 3RSBA 2NXVA 1ZHJA 5CQLX 4C2SA 3RMWA 1JVDA 1GX0A 2AECA 4FRAA 4DECA 1VH3A 1S4OA 1O7OA 2RJ6A 1GWWA 1FGXA 2V0JA 4M2BA 3I0FA 2YC5A 2X5SA 4Y7FA 1K4VA 4UEGA 3DK5A 5EIYA 4KQLA 1H5SD 1YP2A 2Y4JA 3OH0A 5IDSA 2JCOA 2FYBA 3CGXA 4NAKA 2WVKA 5CMJA 4KC4A 3U2UA 2VXLA 3K8DA 1ZJPA 1V84A 5C3AA 3HL3A 1HM8A 1NQIB 1LL2A 1ZCUA 1QGSA 1I52A 2RJ8A 3I0KA 1WVCA 5CQOA 3V0LA 1VZUA 1MC3A 1NF5B 3ZF8A 1G9RA 1W55A 2VS3A 2WGZA 5CQMX 1LL3A 2ICYA 2YCMA 5C3BA 3R3IA 3JTJA 4M28A 1FXOA 2Y4LA 3ZLLA 5C4BA 2PGYA 1TVYA 4B4GA 5IDTA 2AE7A 2P73A 3V0QA 4D0TA 1GQ9A
chains in the Genus database with same CATH superfamily
4FRLA 1H7EA 2Q4JA 2JCKA 5C36A 1E5KA 3EE5A 4KNXA 5C4DA 4Y7GA 5C4EA 1O23B 1MP3A 4ARWA 4K6RA 1O7QA 4D11C 3K8EA 3D8VA 1WT3A 4YS8A 3OH4A 1EZIA 4AC3A 4EEAA 2AH9A 2Y4KA 4KC1A 2RJ5A 2QKXA 4KNRA 1SS9A 1JV3A 1H4CA 4HO0A 2XWNA 2OI7A 2CU2A 4M2AA 4FRQA 3CKVA 1H5RA 1V82A 1R80A 4D0ZA 3JUKA 4FROA 1ZJ0A 1R82A 1H5RB 1O0RA 2UX8A 2DPWA 4KXOA 3DUVA 4FRMA 2O1GA 3OH1A 2O1FA 2WAWA 3BCVA 2VSHA 3I0EA 1QGQA 2AM3A 1MP5A 5FTVA 3SXDA 2W0VA 3FOQA 5AJNA 2RIYA 1GWVA 1VM8A 4HO8A 3OAMA 3SX3A 4B5BA 3BRKX 3CKJA 3QVBA 4HO6A 4Y9XA 2WVMA 3OH2A 2YESA 4HO9A 5AJPA 2VD4A 4ZDQA 5CQNX 4FRHA 2YQCA 4KPZA 1ZJ1A 4MNDA 1VICA 4Y7VA 2X5ZA 4ASYA 4MYBA 4FQWA 1MP4A 3T7NA 2FYCB 4HO3A 4CVHA 1H7GA 4HO4A 3V8ZA 5C4FA 3TZTA 3CKNA 1IIMA 4EVWA 3USRA 3CU0A 3V91A 1NKHB 1NHEB 1INIA 1JV1A 4EE4A 3RMVA 5EJZA 1ZDGA 1WT1A 2YQSA 3CKOA 4LW3A 1ZI3A 2BO8A 1ON8A 1FO8A 4BQHA 3I0JA 1S4NA 1R7TA 4B2XA 1ZJOA 1G95A 2JCLA 2J0BA 4FRBA 2E8BA 1OQMB 3U2VA 3I0IX 1G2VA 1WT0A 4KPXA 1R7YA 2WE9A 1FOAA 3U2XA 5CMHA 2D0JA 4B4MA 3V8YA 2BO7A 1HM9A 1NWGB 2AM4A 1G97A 5C1LA 4G87A 1LL0A 2Y7AA 1NMMB 1VZXA 3SXAA 1QG8A 1LZJA 2OEGA 3USQA 4EE5A 2FFUA 1ZCYA 2V0KA 1H7QA 3I0DA 1G3LA 2QGIA 5DDVA 3OGZA 5C8RA 1ZI1A 3KIAA 1QWJA 2FY7A 1TW5A 4FCEA 1WSZA 2Z87A 1LZIA 4NAIA 1ON6A 2YQJA 4Y7TA 1GX4A 3T7OA 3E26A 4ASJA 1R7XA 4P00A 2BO6A 2PX7A 2AGDA 4AYJA 4LW6A 5CMIA 3I0GA 1H3MA 2ICXA 3IOHA 3SX8A 4L41C 2RJ7A 3SXBA 4Y62A 2Y6PA 2XMEA 2WEEA 1LZ7A 2V0IA 4Q7CA 5FU8A 1ZJ2A 1ZCVA 3OC9A 4HO5A 5JQQA 5L6VA 3V0NA 4ECMA 5FTSA 1VZTA 2E3DA 4AYLA 1H5SA 3F1YA 1OMZA 2GGOA 4KRVA 1H5SB 2RIXA 3ST8A 1G93A 2O1HA 3O3PA 1VGTA 2RJ9A 2XMHA 4EEOA 1FWYA 4IRQA 1FO9A 3DJ4A 4MIXA 2GGQA 2I5EA 4EEGA 3SX7A 2ZU7A 2RJ1A 1ZI5A 1R7UA 1EYRA 2VS5A 4CJBA 1XHBA 3SX5A 3U2WA 5L6SA 3U0XA 1HV9A 2I5KA 4DDZA 5C49A 3Q80A 3ZGGA 4CJ8A 5IFYA 3N9WA 1R7VA 2RIZA 2A8UA 1FR9A 4B3UA 1Z90A 2V0LA 3R2WA 3JUJA 2WVLA 2PA4A 3E25A 2VSIA 4GBPA 1G23A 1XZ6A 1TZFA 3PKQA 5C47A 3ZLKA 5FU0A 4IRPA 1OMXA 4Y6NA 1V83A 1S4PA 2RJ0A 2Z86A 1ZI4A 4KC2A 4FRDA 5FUHA 3SXGA 2A8WA 3D98A 1LZ0A 3LW6A 2QH5A 1H7FA 2D7RA 5J49A 2APCA 1JYLA 3CKQA 4NALA 1VGZA 4M4KA 1ZCTA 4AAWA 1ZJ3A 2RJ4A 2AESA 3D5NA 1LVWA 2AM5A 1H4DA 5C1GA 2JCJA 4D11A 2OI6A 4J18A 4KT7A 1H7TA 3I0LA 1G0RA 4D48A 1YROB 3Q4SA 2RITA 2YC3A 4R7PA 4G3QA 1W57A 4G3PA 4HCQA 1H7HA 1HJLA 3V0PA 5C3DA 2XWLA 3SXEA 3SXCA 2I7BA 1R81A 1YP3A 2VS4A 2ZU8A 4B42A 3SPTA 5AJOA 4EE3A 3I0HA 2PGVA 3NGWA 3V90A 3I0CA 2W0WA 1ZIZA 4Y6UA 3FWWA 2BO4A 2P72A 4B4BA 4G3SA 3ZGFA 1G8OA 5DDTA 4HOCA 3TQDA 1G1LA 5D92A 1JYKA 5C1HA 3V0MA 3PNNA 3IOJA 1PZTA 1VGUA 1GQCA 4BMAA 3V0OA 2J0AA 2OI5A 5CMFX 4HG6A 3IOIA 3Q7UA 3GUEA 4B2WA 4FRPA 4Y7UA 1HJJA 4FREA 3U0YA 2VXMA 3OKRA 1H7LA 1YP4A 5HS2A 4O6MA 1FXJA 2YQHA 2C0NA 5CQPA 3POLA 2X60A 4CJCA 4P02A 4FCUA 1IINA 1VH1A 5BXCA 3T7MA 5I1FA 1FG5N 1INJA 4JISA 5C4CA 1FR8A 1H5TA 1W77A 4E1KA 4XWIA 1H5TB 2V0HA 3U2TA 1HM0A 4JD0A 2FYAA 5C48A 5FV9A 2X65A 2ZU9A 1VGWA 2VK9A 1PZYB 2VFZA 3F1CA 3OH3A 3PKPA 1FRWA 5FYEA 2FYDB 4Y63A 1GA8A 4DE7A 4Y64A 1VPAA 2FFVA 2MZBA 5EJ1A 1WT2A 1TW1A 1FGGA 4NANA 2P6WA 1H4EA 1FZWA 2OEFA 2XWMA 5CMGX 1ZDFA 1KWSA 2D7IA 2Y4MA 4HO2A 4EEMA 5C38A 1JVGA 1H5SC 3RSBA 2NXVA 1ZHJA 5CQLX 4C2SA 3RMWA 1JVDA 1GX0A 2AECA 4FRAA 4DECA 4O6NA 1VH3A 1S4OA 1O7OA 2RJ6A 1GWWA 1FGXA 2V0JA 4M2BA 3I0FA 2YC5A 2X5SA 4Y7FA 1K4VA 4UEGA 3DK5A 5EIYA 4KQLA 1H5SD 1YP2A 2Y4JA 3OH0A 5IDSA 2JCOA 2FYBA 3CGXA 4NAKA 2WVKA 5CMJA 4KC4A 3U2UA 2VXLA 3K8DA 1ZJPA 1V84A 5C3AA 3HL3A 1HM8A 1NQIB 1LL2A 1ZCUA 1QGSA 1I52A 2RJ8A 3I0KA 1WVCA 5CQOA 3V0LA 1VZUA 1MC3A 1NF5B 3ZF8A 1G9RA 1W55A 2VS3A 2WGZA 5CQMX 1LL3A 2ICYA 2YCMA 5C3BA 3R3IA 4FIYA 3JTJA 4M28A 1FXOA 2Y4LA 3ZLLA 5C4BA 2PGYA 1TVYA 4B4GA 5IDTA 2AE7A 2P73A 3V0QA 4D0TA 4FIXA 5D91A 1GQ9A
chains in the Genus database with same CATH topology
4FRLA 1H7EA 2Q4JA 2JCKA 5C36A 1E5KA 3EE5A 4KNXA 5C4DA 4Y7GA 5C4EA 1O23B 1MP3A 4ARWA 4K6RA 1O7QA 4D11C 3K8EA 3D8VA 1WT3A 4YS8A 3OH4A 1EZIA 4AC3A 4EEAA 2AH9A 2Y4KA 4KC1A 2RJ5A 2QKXA 4KNRA 1SS9A 1JV3A 1H4CA 4HO0A 2XWNA 2OI7A 2CU2A 4M2AA 4FRQA 3CKVA 1H5RA 1V82A 1R80A 4D0ZA 3JUKA 4FROA 1ZJ0A 1R82A 1H5RB 1O0RA 2UX8A 2DPWA 4KXOA 3DUVA 4FRMA 2O1GA 3OH1A 2O1FA 2WAWA 3BCVA 2VSHA 3I0EA 1QGQA 2AM3A 1MP5A 5FTVA 3SXDA 2W0VA 3FOQA 5AJNA 2RIYA 1GWVA 1VM8A 4HO8A 3OAMA 3SX3A 4B5BA 3BRKX 3CKJA 3QVBA 4HO6A 4Y9XA 2WVMA 3OH2A 2YESA 4HO9A 5AJPA 2VD4A 4ZDQA 5CQNX 4FRHA 2YQCA 4KPZA 1ZJ1A 4MNDA 1VICA 4Y7VA 2X5ZA 4ASYA 4MYBA 4FQWA 1MP4A 3T7NA 2FYCB 4HO3A 4CVHA 1H7GA 4HO4A 3V8ZA 5C4FA 3TZTA 3CKNA 1IIMA 4EVWA 3USRA 3CU0A 3V91A 1NKHB 1NHEB 1INIA 1JV1A 4EE4A 3RMVA 5EJZA 1ZDGA 1WT1A 2YQSA 3CKOA 4LW3A 1ZI3A 2BO8A 1ON8A 1FO8A 4BQHA 3I0JA 1S4NA 1R7TA 4B2XA 1ZJOA 1G95A 2JCLA 2J0BA 4FRBA 2E8BA 1OQMB 3U2VA 3I0IX 1G2VA 1WT0A 4KPXA 1R7YA 2WE9A 1FOAA 3U2XA 5CMHA 2D0JA 4B4MA 3V8YA 2BO7A 1HM9A 1NWGB 2AM4A 1G97A 5C1LA 4G87A 1LL0A 2Y7AA 1NMMB 1VZXA 3SXAA 1QG8A 1LZJA 2OEGA 3USQA 4EE5A 2FFUA 1ZCYA 2V0KA 1H7QA 3I0DA 1G3LA 2QGIA 5DDVA 3OGZA 5C8RA 1ZI1A 3KIAA 1QWJA 2FY7A 1TW5A 4FCEA 1WSZA 2Z87A 1LZIA 4NAIA 1ON6A 2YQJA 4Y7TA 1GX4A 3T7OA 3E26A 4ASJA 1R7XA 4P00A 2BO6A 2PX7A 2AGDA 4AYJA 4LW6A 5CMIA 3I0GA 1H3MA 2ICXA 3IOHA 3SX8A 4L41C 2RJ7A 3SXBA 4Y62A 2Y6PA 2XMEA 2WEEA 1LZ7A 2V0IA 4Q7CA 5FU8A 1ZJ2A 1ZCVA 3OC9A 4HO5A 5JQQA 5L6VA 3V0NA 4ECMA 5FTSA 1VZTA 2E3DA 4AYLA 1H5SA 3F1YA 1OMZA 2GGOA 4KRVA 1H5SB 2RIXA 3ST8A 1G93A 2O1HA 3O3PA 1VGTA 2RJ9A 2XMHA 4EEOA 1FWYA 4IRQA 1FO9A 3DJ4A 4MIXA 2GGQA 2I5EA 4EEGA 3SX7A 2ZU7A 2RJ1A 1ZI5A 1R7UA 1EYRA 2VS5A 4CJBA 1XHBA 3SX5A 3U2WA 5L6SA 3U0XA 1HV9A 2I5KA 4DDZA 5C49A 3Q80A 3ZGGA 4CJ8A 5IFYA 3N9WA 1R7VA 2RIZA 2A8UA 1FR9A 4B3UA 1Z90A 2V0LA 3R2WA 3JUJA 2WVLA 2PA4A 3E25A 2VSIA 4GBPA 1G23A 1XZ6A 1TZFA 3PKQA 5C47A 3ZLKA 5FU0A 4IRPA 1OMXA 4Y6NA 1V83A 1S4PA 2RJ0A 2Z86A 1ZI4A 4KC2A 4FRDA 5FUHA 3SXGA 2A8WA 3D98A 1LZ0A 3LW6A 2QH5A 1H7FA 2D7RA 5J49A 2APCA 1JYLA 3CKQA 4NALA 1VGZA 4M4KA 1ZCTA 4AAWA 1ZJ3A 2RJ4A 2AESA 3D5NA 1LVWA 2AM5A 1H4DA 5C1GA 2JCJA 4D11A 2OI6A 4J18A 4KT7A 1H7TA 3I0LA 1G0RA 4D48A 1YROB 3Q4SA 2RITA 2YC3A 4R7PA 4G3QA 1W57A 4G3PA 4HCQA 1H7HA 1HJLA 3V0PA 5C3DA 2XWLA 3SXEA 3SXCA 2I7BA 1R81A 1YP3A 2VS4A 2ZU8A 4B42A 3SPTA 5AJOA 4EE3A 3I0HA 2PGVA 3NGWA 3V90A 3I0CA 2W0WA 1ZIZA 4Y6UA 3FWWA 2BO4A 2P72A 4B4BA 4G3SA 3ZGFA 1G8OA 5DDTA 4HOCA 3TQDA 1G1LA 5D92A 1JYKA 5C1HA 3V0MA 3PNNA 3IOJA 1PZTA 1VGUA 1GQCA 4BMAA 3V0OA 2J0AA 2OI5A 5CMFX 4HG6A 3IOIA 3Q7UA 3GUEA 4B2WA 4FRPA 4Y7UA 1HJJA 4FREA 3U0YA 2VXMA 3OKRA 1H7LA 1YP4A 5HS2A 4O6MA 1FXJA 2YQHA 2C0NA 5CQPA 3POLA 2X60A 4CJCA 4P02A 4FCUA 1IINA 1VH1A 5BXCA 3T7MA 5I1FA 1FG5N 1INJA 4JISA 5C4CA 1FR8A 1H5TA 1W77A 4E1KA 4XWIA 1H5TB 2V0HA 3U2TA 1HM0A 4JD0A 2FYAA 5C48A 5FV9A 2X65A 2ZU9A 1VGWA 2VK9A 1PZYB 2VFZA 3F1CA 3OH3A 3PKPA 1FRWA 5FYEA 2FYDB 4Y63A 1GA8A 4DE7A 4Y64A 1VPAA 2FFVA 2MZBA 5EJ1A 1WT2A 1TW1A 1FGGA 4NANA 2P6WA 1H4EA 1FZWA 2OEFA 2XWMA 5CMGX 1ZDFA 1KWSA 2D7IA 2Y4MA 4HO2A 4EEMA 5C38A 1JVGA 1H5SC 3RSBA 2NXVA 1ZHJA 5CQLX 4C2SA 3RMWA 1JVDA 1GX0A 2AECA 4FRAA 4DECA 4O6NA 1VH3A 1S4OA 1O7OA 2RJ6A 1GWWA 1FGXA 2V0JA 4M2BA 3I0FA 2YC5A 2X5SA 4Y7FA 1K4VA 4UEGA 3DK5A 5EIYA 4KQLA 1H5SD 1YP2A 2Y4JA 3OH0A 5IDSA 2JCOA 2FYBA 3CGXA 4NAKA 2WVKA 5CMJA 4KC4A 3U2UA 2VXLA 3K8DA 1ZJPA 1V84A 5C3AA 3HL3A 1HM8A 1NQIB 1LL2A 1ZCUA 1QGSA 1I52A 2RJ8A 3I0KA 1WVCA 5CQOA 3V0LA 1VZUA 1MC3A 1NF5B 3ZF8A 1G9RA 1W55A 2VS3A 2WGZA 5CQMX 1LL3A 2ICYA 2YCMA 5C3BA 3R3IA 4FIYA 3JTJA 4M28A 1FXOA 2Y4LA 3ZLLA 5C4BA 2PGYA 1TVYA 4B4GA 5IDTA 2AE7A 2P73A 3V0QA 4D0TA 4FIXA 5D91A 1GQ9A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4FRL A;  1H7E A;  2Q4J A;  2JCK A;  5C36 A;  1E5K A;  3EE5 A;  4KNX A;  5C4D A;  4Y7G A;  5C4E A;  1O23 B;  1MP3 A;  4ARW A;  4K6R A;  1O7Q A;  4D11 C;  3K8E A;  3D8V A;  1WT3 A;  4YS8 A;  3OH4 A;  1EZI A;  4AC3 A;  4EEA A;  2AH9 A;  2Y4K A;  4KC1 A;  2RJ5 A;  2QKX A;  4KNR A;  1SS9 A;  1JV3 A;  1H4C A;  4HO0 A;  2XWN A;  2OI7 A;  2CU2 A;  4M2A A;  4FRQ A;  3CKV A;  1H5R A;  1V82 A;  1R80 A;  4D0Z A;  3JUK A;  4FRO A;  1ZJ0 A;  1R82 A;  1H5R B;  1O0R A;  2UX8 A;  2DPW A;  4KXO A;  3DUV A;  4FRM A;  2O1G A;  3OH1 A;  2O1F A;  2WAW A;  3BCV A;  2VSH A;  3I0E A;  1QGQ A;  2AM3 A;  1MP5 A;  5FTV A;  3SXD A;  2W0V A;  3FOQ A;  5AJN A;  2RIY A;  1GWV A;  1VM8 A;  4HO8 A;  3OAM A;  3SX3 A;  4B5B A;  3BRK X;  3CKJ A;  3QVB A;  4HO6 A;  4Y9X A;  2WVM A;  3OH2 A;  2YES A;  4HO9 A;  5AJP A;  2VD4 A;  4ZDQ A;  5CQN X;  4FRH A;  2YQC A;  4KPZ A;  1ZJ1 A;  4MND A;  1VIC A;  4Y7V A;  2X5Z A;  4ASY A;  4MYB A;  4FQW A;  1MP4 A;  3T7N A;  2FYC B;  4HO3 A;  4CVH A;  1H7G A;  4HO4 A;  3V8Z A;  5C4F A;  3TZT A;  3CKN A;  1IIM A;  4EVW A;  3USR A;  3CU0 A;  3V91 A;  1NKH B;  1NHE B;  1INI A;  1JV1 A;  4EE4 A;  3RMV A;  5EJZ A;  1ZDG A;  1WT1 A;  2YQS A;  3CKO A;  4LW3 A;  1ZI3 A;  2BO8 A;  1ON8 A;  1FO8 A;  4BQH A;  3I0J A;  1S4N A;  1R7T A;  4B2X A;  1ZJO A;  1G95 A;  2JCL A;  4FRB A;  2E8B A;  1OQM B;  3U2V A;  3I0I X;  1G2V A;  1WT0 A;  4KPX A;  1R7Y A;  2WE9 A;  1FOA A;  3U2X A;  5CMH A;  2D0J A;  4B4M A;  3V8Y A;  2BO7 A;  1HM9 A;  1NWG B;  2AM4 A;  1G97 A;  5C1L A;  4G87 A;  1LL0 A;  2Y7A A;  1NMM B;  1VZX A;  3SXA A;  1QG8 A;  1LZJ A;  2OEG A;  3USQ A;  4EE5 A;  2FFU A;  1ZCY A;  2V0K A;  1H7Q A;  3I0D A;  1G3L A;  2QGI A;  5DDV A;  3OGZ A;  5C8R A;  1ZI1 A;  3KIA A;  1QWJ A;  2FY7 A;  1TW5 A;  4FCE A;  1WSZ A;  2Z87 A;  1LZI A;  4NAI A;  1ON6 A;  2YQJ A;  4Y7T A;  1GX4 A;  3T7O A;  3E26 A;  4ASJ A;  1R7X A;  4P00 A;  2BO6 A;  2PX7 A;  2AGD A;  4AYJ A;  4LW6 A;  5CMI A;  3I0G A;  1H3M A;  2ICX A;  3IOH A;  3SX8 A;  4L41 C;  2RJ7 A;  3SXB A;  4Y62 A;  2Y6P A;  2XME A;  2WEE A;  1LZ7 A;  2V0I A;  5FU8 A;  1ZJ2 A;  1ZCV A;  3OC9 A;  4HO5 A;  5JQQ A;  5L6V A;  3V0N A;  4ECM A;  5FTS A;  1VZT A;  2E3D A;  4AYL A;  1H5S A;  3F1Y A;  1OMZ A;  2GGO A;  4KRV A;  1H5S B;  2RIX A;  3ST8 A;  1G93 A;  2O1H A;  3O3P A;  1VGT A;  2RJ9 A;  2XMH A;  4EEO A;  1FWY A;  4IRQ A;  1FO9 A;  3DJ4 A;  2GGQ A;  2I5E A;  4EEG A;  3SX7 A;  2ZU7 A;  2RJ1 A;  1ZI5 A;  1R7U A;  1EYR A;  2VS5 A;  4CJB A;  1XHB A;  3SX5 A;  3U2W A;  5L6S A;  3U0X A;  1HV9 A;  2I5K A;  4DDZ A;  5C49 A;  3Q80 A;  3ZGG A;  4CJ8 A;  5IFY A;  3N9W A;  1R7V A;  2RIZ A;  2A8U A;  1FR9 A;  4B3U A;  1Z90 A;  2V0L A;  3R2W A;  3JUJ A;  2WVL A;  2PA4 A;  3E25 A;  2VSI A;  4GBP A;  1G23 A;  1XZ6 A;  1TZF A;  3PKQ A;  5C47 A;  3ZLK A;  5FU0 A;  4IRP A;  1OMX A;  4Y6N A;  1V83 A;  1S4P A;  2RJ0 A;  2Z86 A;  1ZI4 A;  4KC2 A;  4FRD A;  5FUH A;  3SXG A;  2A8W A;  3D98 A;  1LZ0 A;  3LW6 A;  2QH5 A;  1H7F A;  2D7R A;  5J49 A;  2APC A;  1JYL A;  3CKQ A;  4NAL A;  1VGZ A;  4M4K A;  1ZCT A;  4AAW A;  1ZJ3 A;  2RJ4 A;  2AES A;  3D5N A;  1LVW A;  2AM5 A;  1H4D A;  5C1G A;  2JCJ A;  4D11 A;  2OI6 A;  4J18 A;  4KT7 A;  1H7T A;  3I0L A;  1G0R A;  4D48 A;  1YRO B;  3Q4S A;  2RIT A;  2YC3 A;  4R7P A;  4G3Q A;  1W57 A;  4G3P A;  4HCQ A;  1H7H A;  1HJL A;  3V0P A;  5C3D A;  2XWL A;  3SXE A;  3SXC A;  2I7B A;  1R81 A;  1YP3 A;  2VS4 A;  2ZU8 A;  4B42 A;  3SPT A;  5AJO A;  4EE3 A;  3I0H A;  2PGV A;  3NGW A;  3V90 A;  3I0C A;  2W0W A;  1ZIZ A;  4Y6U A;  3FWW A;  2BO4 A;  2P72 A;  4B4B A;  4G3S A;  3ZGF A;  1G8O A;  5DDT A;  4HOC A;  3TQD A;  1G1L A;  1JYK A;  5C1H A;  3V0M A;  3PNN A;  3IOJ A;  1PZT A;  1VGU A;  1GQC A;  4BMA A;  3V0O A;  2OI5 A;  5CMF X;  4HG6 A;  3IOI A;  3Q7U A;  3GUE A;  4B2W A;  4FRP A;  4Y7U A;  1HJJ A;  4FRE A;  3U0Y A;  2VXM A;  3OKR A;  1H7L A;  1YP4 A;  5HS2 A;  1FXJ A;  2YQH A;  5CQP A;  3POL A;  2X60 A;  4CJC A;  4P02 A;  4FCU A;  1IIN A;  1VH1 A;  5BXC A;  3T7M A;  5I1F A;  1FG5 N;  1INJ A;  4JIS A;  5C4C A;  1FR8 A;  1H5T A;  1W77 A;  4E1K A;  4XWI A;  1H5T B;  2V0H A;  3U2T A;  1HM0 A;  4JD0 A;  2FYA A;  5C48 A;  5FV9 A;  2X65 A;  2ZU9 A;  1VGW A;  1PZY B;  2VFZ A;  3F1C A;  3OH3 A;  3PKP A;  1FRW A;  5FYE A;  2FYD B;  4Y63 A;  1GA8 A;  4DE7 A;  4Y64 A;  1VPA A;  2FFV A;  2MZB A;  5EJ1 A;  1WT2 A;  1TW1 A;  1FGG A;  4NAN A;  2P6W A;  1H4E A;  1FZW A;  2OEF A;  2XWM A;  5CMG X;  1ZDF A;  1KWS A;  2D7I A;  2Y4M A;  4HO2 A;  4EEM A;  5C38 A;  1JVG A;  1H5S C;  3RSB A;  2NXV A;  1ZHJ A;  5CQL X;  4C2S A;  3RMW A;  1JVD A;  1GX0 A;  2AEC A;  4FRA A;  4DEC A;  1VH3 A;  1S4O A;  1O7O A;  2RJ6 A;  1GWW A;  1FGX A;  2V0J A;  4M2B A;  3I0F A;  2YC5 A;  2X5S A;  4Y7F A;  1K4V A;  4UEG A;  3DK5 A;  5EIY A;  4KQL A;  1H5S D;  1YP2 A;  2Y4J A;  3OH0 A;  5IDS A;  2JCO A;  2FYB A;  3CGX A;  4NAK A;  2WVK A;  5CMJ A;  4KC4 A;  3U2U A;  2VXL A;  3K8D A;  1ZJP A;  1V84 A;  5C3A A;  3HL3 A;  1HM8 A;  1NQI B;  1LL2 A;  1ZCU A;  1QGS A;  1I52 A;  2RJ8 A;  3I0K A;  1WVC A;  5CQO A;  3V0L A;  1VZU A;  1MC3 A;  1NF5 B;  3ZF8 A;  1G9R A;  1W55 A;  2VS3 A;  2WGZ A;  5CQM X;  1LL3 A;  2ICY A;  2YCM A;  5C3B A;  3R3I A;  3JTJ A;  4M28 A;  1FXO A;  2Y4L A;  3ZLL A;  5C4B A;  2PGY A;  1TVY A;  4B4G A;  5IDT A;  2AE7 A;  2P73 A;  3V0Q A;  4D0T A;  1GQ9 A; 
#chains in the Genus database with same CATH topology
 4FRL A;  1H7E A;  2Q4J A;  2JCK A;  5C36 A;  1E5K A;  3EE5 A;  4KNX A;  5C4D A;  4Y7G A;  5C4E A;  1O23 B;  1MP3 A;  4ARW A;  4K6R A;  1O7Q A;  4D11 C;  3K8E A;  3D8V A;  1WT3 A;  4YS8 A;  3OH4 A;  1EZI A;  4AC3 A;  4EEA A;  2AH9 A;  2Y4K A;  4KC1 A;  2RJ5 A;  2QKX A;  4KNR A;  1SS9 A;  1JV3 A;  1H4C A;  4HO0 A;  2XWN A;  2OI7 A;  2CU2 A;  4M2A A;  4FRQ A;  3CKV A;  1H5R A;  1V82 A;  1R80 A;  4D0Z A;  3JUK A;  4FRO A;  1ZJ0 A;  1R82 A;  1H5R B;  1O0R A;  2UX8 A;  2DPW A;  4KXO A;  3DUV A;  4FRM A;  2O1G A;  3OH1 A;  2O1F A;  2WAW A;  3BCV A;  2VSH A;  3I0E A;  1QGQ A;  2AM3 A;  1MP5 A;  5FTV A;  3SXD A;  2W0V A;  3FOQ A;  5AJN A;  2RIY A;  1GWV A;  1VM8 A;  4HO8 A;  3OAM A;  3SX3 A;  4B5B A;  3BRK X;  3CKJ A;  3QVB A;  4HO6 A;  4Y9X A;  2WVM A;  3OH2 A;  2YES A;  4HO9 A;  5AJP A;  2VD4 A;  4ZDQ A;  5CQN X;  4FRH A;  2YQC A;  4KPZ A;  1ZJ1 A;  4MND A;  1VIC A;  4Y7V A;  2X5Z A;  4ASY A;  4MYB A;  4FQW A;  1MP4 A;  3T7N A;  2FYC B;  4HO3 A;  4CVH A;  1H7G A;  4HO4 A;  3V8Z A;  5C4F A;  3TZT A;  3CKN A;  1IIM A;  4EVW A;  3USR A;  3CU0 A;  3V91 A;  1NKH B;  1NHE B;  1INI A;  1JV1 A;  4EE4 A;  3RMV A;  5EJZ A;  1ZDG A;  1WT1 A;  2YQS A;  3CKO A;  4LW3 A;  1ZI3 A;  2BO8 A;  1ON8 A;  1FO8 A;  4BQH A;  3I0J A;  1S4N A;  1R7T A;  4B2X A;  1ZJO A;  1G95 A;  2JCL A;  2J0B A;  4FRB A;  2E8B A;  1OQM B;  3U2V A;  3I0I X;  1G2V A;  1WT0 A;  4KPX A;  1R7Y A;  2WE9 A;  1FOA A;  3U2X A;  5CMH A;  2D0J A;  4B4M A;  3V8Y A;  2BO7 A;  1HM9 A;  1NWG B;  2AM4 A;  1G97 A;  5C1L A;  4G87 A;  1LL0 A;  2Y7A A;  1NMM B;  1VZX A;  3SXA A;  1QG8 A;  1LZJ A;  2OEG A;  3USQ A;  4EE5 A;  2FFU A;  1ZCY A;  2V0K A;  1H7Q A;  3I0D A;  1G3L A;  2QGI A;  5DDV A;  3OGZ A;  5C8R A;  1ZI1 A;  3KIA A;  1QWJ A;  2FY7 A;  1TW5 A;  4FCE A;  1WSZ A;  2Z87 A;  1LZI A;  4NAI A;  1ON6 A;  2YQJ A;  4Y7T A;  1GX4 A;  3T7O A;  3E26 A;  4ASJ A;  1R7X A;  4P00 A;  2BO6 A;  2PX7 A;  2AGD A;  4AYJ A;  4LW6 A;  5CMI A;  3I0G A;  1H3M A;  2ICX A;  3IOH A;  3SX8 A;  4L41 C;  2RJ7 A;  3SXB A;  4Y62 A;  2Y6P A;  2XME A;  2WEE A;  1LZ7 A;  2V0I A;  4Q7C A;  5FU8 A;  1ZJ2 A;  1ZCV A;  3OC9 A;  4HO5 A;  5JQQ A;  5L6V A;  3V0N A;  4ECM A;  5FTS A;  1VZT A;  2E3D A;  4AYL A;  1H5S A;  3F1Y A;  1OMZ A;  2GGO A;  4KRV A;  1H5S B;  2RIX A;  3ST8 A;  1G93 A;  2O1H A;  3O3P A;  1VGT A;  2RJ9 A;  2XMH A;  4EEO A;  1FWY A;  4IRQ A;  1FO9 A;  3DJ4 A;  4MIX A;  2GGQ A;  2I5E A;  4EEG A;  3SX7 A;  2ZU7 A;  2RJ1 A;  1ZI5 A;  1R7U A;  1EYR A;  2VS5 A;  4CJB A;  1XHB A;  3SX5 A;  3U2W A;  5L6S A;  3U0X A;  1HV9 A;  2I5K A;  4DDZ A;  5C49 A;  3Q80 A;  3ZGG A;  4CJ8 A;  5IFY A;  3N9W A;  1R7V A;  2RIZ A;  2A8U A;  1FR9 A;  4B3U A;  1Z90 A;  2V0L A;  3R2W A;  3JUJ A;  2WVL A;  2PA4 A;  3E25 A;  2VSI A;  4GBP A;  1G23 A;  1XZ6 A;  1TZF A;  3PKQ A;  5C47 A;  3ZLK A;  5FU0 A;  4IRP A;  1OMX A;  4Y6N A;  1V83 A;  1S4P A;  2RJ0 A;  2Z86 A;  1ZI4 A;  4KC2 A;  4FRD A;  5FUH A;  3SXG A;  2A8W A;  3D98 A;  1LZ0 A;  3LW6 A;  2QH5 A;  1H7F A;  2D7R A;  5J49 A;  2APC A;  1JYL A;  3CKQ A;  4NAL A;  1VGZ A;  4M4K A;  1ZCT A;  4AAW A;  1ZJ3 A;  2RJ4 A;  2AES A;  3D5N A;  1LVW A;  2AM5 A;  1H4D A;  5C1G A;  2JCJ A;  4D11 A;  2OI6 A;  4J18 A;  4KT7 A;  1H7T A;  3I0L A;  1G0R A;  4D48 A;  1YRO B;  3Q4S A;  2RIT A;  2YC3 A;  4R7P A;  4G3Q A;  1W57 A;  4G3P A;  4HCQ A;  1H7H A;  1HJL A;  3V0P A;  5C3D A;  2XWL A;  3SXE A;  3SXC A;  2I7B A;  1R81 A;  1YP3 A;  2VS4 A;  2ZU8 A;  4B42 A;  3SPT A;  5AJO A;  4EE3 A;  3I0H A;  2PGV A;  3NGW A;  3V90 A;  3I0C A;  2W0W A;  1ZIZ A;  4Y6U A;  3FWW A;  2BO4 A;  2P72 A;  4B4B A;  4G3S A;  3ZGF A;  1G8O A;  5DDT A;  4HOC A;  3TQD A;  1G1L A;  5D92 A;  1JYK A;  5C1H A;  3V0M A;  3PNN A;  3IOJ A;  1PZT A;  1VGU A;  1GQC A;  4BMA A;  3V0O A;  2J0A A;  2OI5 A;  5CMF X;  4HG6 A;  3IOI A;  3Q7U A;  3GUE A;  4B2W A;  4FRP A;  4Y7U A;  1HJJ A;  4FRE A;  3U0Y A;  2VXM A;  3OKR A;  1H7L A;  1YP4 A;  5HS2 A;  4O6M A;  1FXJ A;  2YQH A;  2C0N A;  5CQP A;  3POL A;  2X60 A;  4CJC A;  4P02 A;  4FCU A;  1IIN A;  1VH1 A;  5BXC A;  3T7M A;  5I1F A;  1FG5 N;  1INJ A;  4JIS A;  5C4C A;  1FR8 A;  1H5T A;  1W77 A;  4E1K A;  4XWI A;  1H5T B;  2V0H A;  3U2T A;  1HM0 A;  4JD0 A;  2FYA A;  5C48 A;  5FV9 A;  2X65 A;  2ZU9 A;  1VGW A;  2VK9 A;  1PZY B;  2VFZ A;  3F1C A;  3OH3 A;  3PKP A;  1FRW A;  5FYE A;  2FYD B;  4Y63 A;  1GA8 A;  4DE7 A;  4Y64 A;  1VPA A;  2FFV A;  2MZB A;  5EJ1 A;  1WT2 A;  1TW1 A;  1FGG A;  4NAN A;  2P6W A;  1H4E A;  1FZW A;  2OEF A;  2XWM A;  5CMG X;  1ZDF A;  1KWS A;  2D7I A;  2Y4M A;  4HO2 A;  4EEM A;  5C38 A;  1JVG A;  1H5S C;  3RSB A;  2NXV A;  1ZHJ A;  5CQL X;  4C2S A;  3RMW A;  1JVD A;  1GX0 A;  2AEC A;  4FRA A;  4DEC A;  4O6N A;  1VH3 A;  1S4O A;  1O7O A;  2RJ6 A;  1GWW A;  1FGX A;  2V0J A;  4M2B A;  3I0F A;  2YC5 A;  2X5S A;  4Y7F A;  1K4V A;  4UEG A;  3DK5 A;  5EIY A;  4KQL A;  1H5S D;  1YP2 A;  2Y4J A;  3OH0 A;  5IDS A;  2JCO A;  2FYB A;  3CGX A;  4NAK A;  2WVK A;  5CMJ A;  4KC4 A;  3U2U A;  2VXL A;  3K8D A;  1ZJP A;  1V84 A;  5C3A A;  3HL3 A;  1HM8 A;  1NQI B;  1LL2 A;  1ZCU A;  1QGS A;  1I52 A;  2RJ8 A;  3I0K A;  1WVC A;  5CQO A;  3V0L A;  1VZU A;  1MC3 A;  1NF5 B;  3ZF8 A;  1G9R A;  1W55 A;  2VS3 A;  2WGZ A;  5CQM X;  1LL3 A;  2ICY A;  2YCM A;  5C3B A;  3R3I A;  4FIY A;  3JTJ A;  4M28 A;  1FXO A;  2Y4L A;  3ZLL A;  5C4B A;  2PGY A;  1TVY A;  4B4G A;  5IDT A;  2AE7 A;  2P73 A;  3V0Q A;  4D0T A;  4FIX A;  5D91 A;  1GQ9 A; 
#chains in the Genus database with same CATH homology
 4FRL A;  1H7E A;  2Q4J A;  2JCK A;  5C36 A;  1E5K A;  3EE5 A;  4KNX A;  5C4D A;  4Y7G A;  5C4E A;  1O23 B;  1MP3 A;  4ARW A;  4K6R A;  1O7Q A;  4D11 C;  3K8E A;  3D8V A;  1WT3 A;  4YS8 A;  3OH4 A;  1EZI A;  4AC3 A;  4EEA A;  2AH9 A;  2Y4K A;  4KC1 A;  2RJ5 A;  2QKX A;  4KNR A;  1SS9 A;  1JV3 A;  1H4C A;  4HO0 A;  2XWN A;  2OI7 A;  2CU2 A;  4M2A A;  4FRQ A;  3CKV A;  1H5R A;  1V82 A;  1R80 A;  4D0Z A;  3JUK A;  4FRO A;  1ZJ0 A;  1R82 A;  1H5R B;  1O0R A;  2UX8 A;  2DPW A;  4KXO A;  3DUV A;  4FRM A;  2O1G A;  3OH1 A;  2O1F A;  2WAW A;  3BCV A;  2VSH A;  3I0E A;  1QGQ A;  2AM3 A;  1MP5 A;  5FTV A;  3SXD A;  2W0V A;  3FOQ A;  5AJN A;  2RIY A;  1GWV A;  1VM8 A;  4HO8 A;  3OAM A;  3SX3 A;  4B5B A;  3BRK X;  3CKJ A;  3QVB A;  4HO6 A;  4Y9X A;  2WVM A;  3OH2 A;  2YES A;  4HO9 A;  5AJP A;  2VD4 A;  4ZDQ A;  5CQN X;  4FRH A;  2YQC A;  4KPZ A;  1ZJ1 A;  4MND A;  1VIC A;  4Y7V A;  2X5Z A;  4ASY A;  4MYB A;  4FQW A;  1MP4 A;  3T7N A;  2FYC B;  4HO3 A;  4CVH A;  1H7G A;  4HO4 A;  3V8Z A;  5C4F A;  3TZT A;  3CKN A;  1IIM A;  4EVW A;  3USR A;  3CU0 A;  3V91 A;  1NKH B;  1NHE B;  1INI A;  1JV1 A;  4EE4 A;  3RMV A;  5EJZ A;  1ZDG A;  1WT1 A;  2YQS A;  3CKO A;  4LW3 A;  1ZI3 A;  2BO8 A;  1ON8 A;  1FO8 A;  4BQH A;  3I0J A;  1S4N A;  1R7T A;  4B2X A;  1ZJO A;  1G95 A;  2JCL A;  2J0B A;  4FRB A;  2E8B A;  1OQM B;  3U2V A;  3I0I X;  1G2V A;  1WT0 A;  4KPX A;  1R7Y A;  2WE9 A;  1FOA A;  3U2X A;  5CMH A;  2D0J A;  4B4M A;  3V8Y A;  2BO7 A;  1HM9 A;  1NWG B;  2AM4 A;  1G97 A;  5C1L A;  4G87 A;  1LL0 A;  2Y7A A;  1NMM B;  1VZX A;  3SXA A;  1QG8 A;  1LZJ A;  2OEG A;  3USQ A;  4EE5 A;  2FFU A;  1ZCY A;  2V0K A;  1H7Q A;  3I0D A;  1G3L A;  2QGI A;  5DDV A;  3OGZ A;  5C8R A;  1ZI1 A;  3KIA A;  1QWJ A;  2FY7 A;  1TW5 A;  4FCE A;  1WSZ A;  2Z87 A;  1LZI A;  4NAI A;  1ON6 A;  2YQJ A;  4Y7T A;  1GX4 A;  3T7O A;  3E26 A;  4ASJ A;  1R7X A;  4P00 A;  2BO6 A;  2PX7 A;  2AGD A;  4AYJ A;  4LW6 A;  5CMI A;  3I0G A;  1H3M A;  2ICX A;  3IOH A;  3SX8 A;  4L41 C;  2RJ7 A;  3SXB A;  4Y62 A;  2Y6P A;  2XME A;  2WEE A;  1LZ7 A;  2V0I A;  4Q7C A;  5FU8 A;  1ZJ2 A;  1ZCV A;  3OC9 A;  4HO5 A;  5JQQ A;  5L6V A;  3V0N A;  4ECM A;  5FTS A;  1VZT A;  2E3D A;  4AYL A;  1H5S A;  3F1Y A;  1OMZ A;  2GGO A;  4KRV A;  1H5S B;  2RIX A;  3ST8 A;  1G93 A;  2O1H A;  3O3P A;  1VGT A;  2RJ9 A;  2XMH A;  4EEO A;  1FWY A;  4IRQ A;  1FO9 A;  3DJ4 A;  4MIX A;  2GGQ A;  2I5E A;  4EEG A;  3SX7 A;  2ZU7 A;  2RJ1 A;  1ZI5 A;  1R7U A;  1EYR A;  2VS5 A;  4CJB A;  1XHB A;  3SX5 A;  3U2W A;  5L6S A;  3U0X A;  1HV9 A;  2I5K A;  4DDZ A;  5C49 A;  3Q80 A;  3ZGG A;  4CJ8 A;  5IFY A;  3N9W A;  1R7V A;  2RIZ A;  2A8U A;  1FR9 A;  4B3U A;  1Z90 A;  2V0L A;  3R2W A;  3JUJ A;  2WVL A;  2PA4 A;  3E25 A;  2VSI A;  4GBP A;  1G23 A;  1XZ6 A;  1TZF A;  3PKQ A;  5C47 A;  3ZLK A;  5FU0 A;  4IRP A;  1OMX A;  4Y6N A;  1V83 A;  1S4P A;  2RJ0 A;  2Z86 A;  1ZI4 A;  4KC2 A;  4FRD A;  5FUH A;  3SXG A;  2A8W A;  3D98 A;  1LZ0 A;  3LW6 A;  2QH5 A;  1H7F A;  2D7R A;  5J49 A;  2APC A;  1JYL A;  3CKQ A;  4NAL A;  1VGZ A;  4M4K A;  1ZCT A;  4AAW A;  1ZJ3 A;  2RJ4 A;  2AES A;  3D5N A;  1LVW A;  2AM5 A;  1H4D A;  5C1G A;  2JCJ A;  4D11 A;  2OI6 A;  4J18 A;  4KT7 A;  1H7T A;  3I0L A;  1G0R A;  4D48 A;  1YRO B;  3Q4S A;  2RIT A;  2YC3 A;  4R7P A;  4G3Q A;  1W57 A;  4G3P A;  4HCQ A;  1H7H A;  1HJL A;  3V0P A;  5C3D A;  2XWL A;  3SXE A;  3SXC A;  2I7B A;  1R81 A;  1YP3 A;  2VS4 A;  2ZU8 A;  4B42 A;  3SPT A;  5AJO A;  4EE3 A;  3I0H A;  2PGV A;  3NGW A;  3V90 A;  3I0C A;  2W0W A;  1ZIZ A;  4Y6U A;  3FWW A;  2BO4 A;  2P72 A;  4B4B A;  4G3S A;  3ZGF A;  1G8O A;  5DDT A;  4HOC A;  3TQD A;  1G1L A;  5D92 A;  1JYK A;  5C1H A;  3V0M A;  3PNN A;  3IOJ A;  1PZT A;  1VGU A;  1GQC A;  4BMA A;  3V0O A;  2J0A A;  2OI5 A;  5CMF X;  4HG6 A;  3IOI A;  3Q7U A;  3GUE A;  4B2W A;  4FRP A;  4Y7U A;  1HJJ A;  4FRE A;  3U0Y A;  2VXM A;  3OKR A;  1H7L A;  1YP4 A;  5HS2 A;  4O6M A;  1FXJ A;  2YQH A;  2C0N A;  5CQP A;  3POL A;  2X60 A;  4CJC A;  4P02 A;  4FCU A;  1IIN A;  1VH1 A;  5BXC A;  3T7M A;  5I1F A;  1FG5 N;  1INJ A;  4JIS A;  5C4C A;  1FR8 A;  1H5T A;  1W77 A;  4E1K A;  4XWI A;  1H5T B;  2V0H A;  3U2T A;  1HM0 A;  4JD0 A;  2FYA A;  5C48 A;  5FV9 A;  2X65 A;  2ZU9 A;  1VGW A;  2VK9 A;  1PZY B;  2VFZ A;  3F1C A;  3OH3 A;  3PKP A;  1FRW A;  5FYE A;  2FYD B;  4Y63 A;  1GA8 A;  4DE7 A;  4Y64 A;  1VPA A;  2FFV A;  2MZB A;  5EJ1 A;  1WT2 A;  1TW1 A;  1FGG A;  4NAN A;  2P6W A;  1H4E A;  1FZW A;  2OEF A;  2XWM A;  5CMG X;  1ZDF A;  1KWS A;  2D7I A;  2Y4M A;  4HO2 A;  4EEM A;  5C38 A;  1JVG A;  1H5S C;  3RSB A;  2NXV A;  1ZHJ A;  5CQL X;  4C2S A;  3RMW A;  1JVD A;  1GX0 A;  2AEC A;  4FRA A;  4DEC A;  4O6N A;  1VH3 A;  1S4O A;  1O7O A;  2RJ6 A;  1GWW A;  1FGX A;  2V0J A;  4M2B A;  3I0F A;  2YC5 A;  2X5S A;  4Y7F A;  1K4V A;  4UEG A;  3DK5 A;  5EIY A;  4KQL A;  1H5S D;  1YP2 A;  2Y4J A;  3OH0 A;  5IDS A;  2JCO A;  2FYB A;  3CGX A;  4NAK A;  2WVK A;  5CMJ A;  4KC4 A;  3U2U A;  2VXL A;  3K8D A;  1ZJP A;  1V84 A;  5C3A A;  3HL3 A;  1HM8 A;  1NQI B;  1LL2 A;  1ZCU A;  1QGS A;  1I52 A;  2RJ8 A;  3I0K A;  1WVC A;  5CQO A;  3V0L A;  1VZU A;  1MC3 A;  1NF5 B;  3ZF8 A;  1G9R A;  1W55 A;  2VS3 A;  2WGZ A;  5CQM X;  1LL3 A;  2ICY A;  2YCM A;  5C3B A;  3R3I A;  4FIY A;  3JTJ A;  4M28 A;  1FXO A;  2Y4L A;  3ZLL A;  5C4B A;  2PGY A;  1TVY A;  4B4G A;  5IDT A;  2AE7 A;  2P73 A;  3V0Q A;  4D0T A;  4FIX A;  5D91 A;  1GQ9 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...