2Y7AA

Crystal structure of unliganded gtb p156l
Total Genus 91
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
91
sequence length
284
structure length
277
Chain Sequence
FMVSLPRMVYPQPKVLTPCRKDVLVVTPWLAPIVWEGTFNIDILNEQFRLQNTTIGLTVFAIKKYVAFLKLFLETAEKHFMVGHRVHYYVFTDQLAAVPRVTLGTGRQLSVLEVGASMRRMEMISDFCERRFLSEVDYLVCVDVDMEFRDHVGVEILTPLFGTLHPSFYGSSREAFTYERRPQSQAYIPKDEGDFYYMGAFFGGSVQEVQRLTRACHQAMMVDQANGIEAVWHDESHLNKYLLRHKPTKVLSPEYLWDQQLLGWPAVLRKLRFTAVP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords ABO GLYCOSYLTRANSFERASE
publication title Structural and Biochemical Characterization of the Human Blood Group a and B Galactosyltransferases Possessing the Pro156Leu Mutation
rcsb
source organism Homo sapiens
total genus 91
structure length 277
sequence length 284
chains with identical sequence B, C, D
ec nomenclature ec 2.4.1.37: Fucosylgalactoside 3-alpha-galactosyltransferase.
pdb deposition date 2011-01-31
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.550.10 Alpha Beta Alpha-Beta Complex Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A 2y7aA00
4E1KA 5DDVA 1VH3A 2Q4JA 1LZ0A 4HO5A 4EEMA 1MP5A 2X5SA 1H5RB 1GA8A 4ZDQA 4Y7UA 1WT1A 1QGQA 2X65A 3CKVA 4KPXA 5C36A 5L6SA 1ZJ0A 1NMMB 1NHEB 4Y6NA 5C4DA 2RJ1A 5FV9A 1LZJA 4D0TA 3U0YA 4B4GA 3CKQA 1V83A 3SXCA 1ZJPA 1LL0A 3DK5A 4EEAA 5C1HA 4HO2A 1O7OA 2AH9A 3CKOA 1G23A 2Y4MA 1QGSA 4LW6A 4ARWA 2BO6A 1NKHB 2V0LA 1GQCA 2E3DA 3SXDA 2AECA 3V0NA 4FQWA 2XWMA 3EE5A 4Y62A 4C2SA 2VFZA 2X5ZA 3DJ4A 4EE3A 1ZI4A 3TZTA 3T7NA 1R80A 4ASJA 5CQMX 1H7LA 4B3UA 2V0JA 1NWGB 2FYAA 2JCJA 2YQSA 5C1GA 2GGOA 3SX3A 1ZJ3A 5AJPA 2V0IA 1ZCUA 1FRWA 3ZLLA 2YCMA 3BRKX 1JYKA 1TVYA 4HO3A 4KC2A 3I0FA 1GQ9A 5C4BA 2XMHA 3QVBA 2FFVA 4CJCA 2RJ9A 4D0ZA 4FRBA 5CQOA 1FO8A 4G3QA 3R3IA 1VGZA 2FYCB 1WT2A 1H5TB 4BQHA 4CJBA 2RJ4A 3USRA 2JCKA 3U2UA 2FYDB 1ZCTA 3R2WA 5C4EA 3PNNA 4Y7VA 1WT3A 4FRLA 5C48A 1K4VA 2JCLA 3BCVA 4P00A 2BO7A 3USQA 4B4BA 1HV9A 1EYRA 2YQCA 2ICXA 2ZU8A 5IDTA 4IRQA 4Y64A 1G93A 2XWLA 4HO9A 4KRVA 2WEEA 4KNXA 3Q7UA 1H5RA 2GGQA 3V90A 1JV3A 2V0HA 4KC4A 4FROA 3U2TA 1INJA 2P6WA 4B5BA 4AAWA 1YP4A 2VD4A 3D8VA 4G3SA 1ZI5A 5C38A 1H7TA 3I0JA 1JV1A 5FYEA 2AM5A 4KT7A 3SXEA 4B4MA 4FRAA 2FY7A 5CMGX 2MZBA 1INIA 1H4EA 3OKRA 4L41C 5C4CA 2Z87A 3E25A 4MNDA 3I0IX 5C3DA 2YC5A 4FCUA 2APCA 5JQQA 3OH3A 2VSIA 2AGDA 1FWYA 2JCOA 1HJJA 1S4PA 1FR9A 1TZFA 1VZTA 4Y7TA 2VS4A 3V0OA 4EEOA 2WE9A 4M4KA 4M2AA 4EE4A 2Y4JA 1H4DA 2RJ6A 3I0HA 4JISA 4Y9XA 5CQPA 5FTSA 1G2VA 3DUVA 3GUEA 5IFYA 1R81A 4ECMA 1IIMA 4Y6UA 2PGYA 2OI5A 2WVMA 4CVHA 1LL3A 4HO4A 1H4CA 2NXVA 1ZI3A 4D11C 2DPWA 2OEGA 2V0KA 3OGZA 1VZXA 4FRPA 3ZLKA 4D48A 4GBPA 3U0XA 2OEFA 2QKXA 3PKQA 4G87A 5C8RA 5AJOA 4Y63A 1G0RA 1H5TA 4HO0A 1LL2A 1R7XA 2I7BA 1XZ6A 1TW1A 1PZTA 1S4OA 3U2WA 5DDTA 2O1GA 1FXJA 2E8BA 2RIZA 3IOJA 1O0RA 2I5EA 5HS2A 2CU2A 2W0VA 2QH5A 4KPZA 2WVKA 2QGIA 2BO4A 1LVWA 3I0KA 4AC3A 2VXMA 5FU8A 1HM8A 1OQMB 1JVGA 3E26A 1EZIA 5I1FA 2AM4A 4Y7GA 5C4FA 3ZGFA 1O23B 1FGXA 2VSHA 1H7GA 3V8YA 4NANA 1FG5N 1G8OA 1VZUA 1I52A 4EE5A 1FGGA 1GX0A 4JD0A 1O7QA 4YS8A 5C49A 3OH0A 1ZJOA 2PA4A 1GWVA 4HOCA 1ZCYA 1LZIA 1GWWA 1H5SB 1HJLA 1W57A 2Z86A 1VGUA 4AYJA 3CKJA 1VGTA 1FR8A 3I0EA 2FFUA 3U2VA 1G95A 3IOIA 2YQJA 2O1FA 4KXOA 3I0LA 2RITA 5FTVA 1ZCVA 3CGXA 3CU0A 4FRQA 3OH2A 3LW6A 2YQHA 2AM3A 3OH1A 3POLA 3KIAA 3JTJA 1H5SC 1OMZA 4J18A 4D11A 5C1LA 1Z90A 2VS5A 1ZDFA 4HO6A 5CMFX 1QG8A 3I0CA 3JUKA 3FWWA 3N9WA 1ON8A 3I0GA 1MP4A 1XHBA 2Y4KA 1ZJ2A 4DECA 1YP2A 1YP3A 3FOQA 3U2XA 5CMHA 3ZGGA 1HM0A 1VGWA 2W0WA 1TW5A 2VS3A 3HL3A 1H7EA 3NGWA 2UX8A 3Q80A 4M28A 4UEGA 1H5SD 5CQNX 4HO8A 3SX5A 3V0MA 1R7UA 1SS9A 3T7OA 1ON6A 2XWNA 3RMVA 4B2WA 3F1CA 2RJ0A 3ST8A 5C3AA 1JYLA 4HG6A 5AJNA 1GX4A 2YC3A 4CJ8A 1MC3A 1R7TA 1FXOA 3JUJA 2Y7AA 3V8ZA 4BMAA 2FYBA 3RMWA 2AE7A 3TQDA 1W55A 3K8DA 1MP3A 3SXBA 3CKNA 3SXGA 1V84A 1H7QA 1ZJ1A 3D5NA 2Y4LA 4B2XA 1YROB 5C3BA 4DE7A 4KQLA 4DDZA 2ZU9A 1G3LA 2RJ7A 1VH1A 2ICYA 4HCQA 2D0JA 3PKPA 1WT0A 2YESA 1G97A 1ZDGA 1W77A 2OI7A 2OI6A 1WVCA 2A8WA 2PGVA 2WAWA 3OC9A 5BXCA 3SXAA 5IDSA 3SX7A 1VPAA 2RJ8A 3K8EA 1H7FA 4Y7FA 1VICA 3V0LA 5CMIA 4M2BA 1H5SA 4EEGA 4KNRA 1QWJA 4NAIA 2A8UA 4P02A 1FZWA 1ZI1A 4G3PA 3F1YA 1R82A 1G9RA 1H7HA 4AYLA 4FRMA 1ZIZA 4LW3A 3V0QA 2VXLA 1LZ7A 2XMEA 5FUHA 3O3PA 2RIYA 2WVLA 5FU0A 2Y6PA 1WSZA 3SX8A 3I0DA 2O1HA 1HM9A 1IINA 3Q4SA 2P72A 5CMJA 4FRDA 4NALA 3RSBA 4K6RA 5C47A 3SPTA 1PZYB 1FO9A 3V91A 1VM8A 1G1LA 2PX7A 2RIXA 4ASYA 3ZF8A 1NQIB 2RJ5A 3IOHA 4IRPA 1NF5B 1ZHJA 4FRHA 4B42A 2ZU7A 5J49A 1E5KA 2I5KA 2X60A 1R7VA 2WGZA 4XWIA 1R7YA 5EJ1A 2BO8A 4FCEA 2D7RA 3OAMA 4FREA 3V0PA 5CQLX 3OH4A 1OMXA 4R7PA 4EVWA 4MYBA 2D7IA 1FOAA 1KWSA 2P73A 1H3MA 3D98A 1JVDA 4KC1A 5EJZA 3T7MA 5EIYA 5L6VA 2AESA 1S4NA 1V82A 4NAKA
chains in the Genus database with same CATH superfamily
4E1KA 5DDVA 1VH3A 2Q4JA 1LZ0A 4HO5A 4EEMA 1MP5A 2X5SA 1H5RB 1GA8A 4ZDQA 4Y7UA 1WT1A 1QGQA 2X65A 3CKVA 4KPXA 5C36A 5L6SA 1ZJ0A 1NMMB 1NHEB 4Y6NA 5C4DA 2RJ1A 5FV9A 1LZJA 4D0TA 3U0YA 4B4GA 3CKQA 1V83A 3SXCA 1ZJPA 1LL0A 3DK5A 4EEAA 5C1HA 4HO2A 1O7OA 2AH9A 3CKOA 1G23A 2Y4MA 1QGSA 4LW6A 4ARWA 2BO6A 1NKHB 2V0LA 1GQCA 2E3DA 3SXDA 2AECA 3V0NA 4FQWA 2XWMA 3EE5A 4Y62A 4C2SA 2VFZA 2X5ZA 3DJ4A 4EE3A 1ZI4A 3TZTA 3T7NA 1R80A 4ASJA 5CQMX 1H7LA 4B3UA 2V0JA 1NWGB 5D92A 2FYAA 2JCJA 2YQSA 5C1GA 2GGOA 3SX3A 1ZJ3A 5AJPA 2V0IA 1ZCUA 1FRWA 3ZLLA 2YCMA 3BRKX 1JYKA 1TVYA 4HO3A 4KC2A 3I0FA 1GQ9A 5C4BA 2XMHA 3QVBA 2FFVA 4MIXA 4CJCA 2RJ9A 4D0ZA 4FRBA 5CQOA 1FO8A 4G3QA 3R3IA 1VGZA 2FYCB 1WT2A 1H5TB 4BQHA 4CJBA 2RJ4A 3USRA 2JCKA 3U2UA 2FYDB 1ZCTA 3R2WA 5C4EA 3PNNA 4Y7VA 1WT3A 4FRLA 5C48A 1K4VA 2JCLA 3BCVA 4P00A 2BO7A 3USQA 4B4BA 1HV9A 1EYRA 2YQCA 2ICXA 2ZU8A 5IDTA 4IRQA 4Y64A 1G93A 2XWLA 4HO9A 4KRVA 2WEEA 4KNXA 3Q7UA 1H5RA 2GGQA 3V90A 1JV3A 2V0HA 4KC4A 4FROA 3U2TA 1INJA 2P6WA 4B5BA 4AAWA 1YP4A 2VD4A 3D8VA 4G3SA 1ZI5A 5C38A 1H7TA 3I0JA 1JV1A 5FYEA 2AM5A 4KT7A 3SXEA 4B4MA 4Q7CA 4FRAA 2FY7A 5CMGX 2MZBA 1INIA 1H4EA 3OKRA 4L41C 5C4CA 2Z87A 3E25A 4MNDA 3I0IX 5C3DA 2YC5A 4FCUA 2APCA 5JQQA 3OH3A 2VSIA 4FIYA 2AGDA 1FWYA 2JCOA 1HJJA 1S4PA 1FR9A 1TZFA 1VZTA 4Y7TA 2VS4A 3V0OA 4EEOA 2WE9A 4M4KA 4M2AA 4EE4A 2Y4JA 1H4DA 2RJ6A 3I0HA 4JISA 4Y9XA 5CQPA 5FTSA 1G2VA 3DUVA 3GUEA 5IFYA 1R81A 4ECMA 1IIMA 4Y6UA 2PGYA 2OI5A 2WVMA 4CVHA 1LL3A 4HO4A 1H4CA 2NXVA 1ZI3A 4D11C 2DPWA 2OEGA 2V0KA 3OGZA 1VZXA 4FRPA 3ZLKA 4D48A 4GBPA 3U0XA 2OEFA 2QKXA 3PKQA 4G87A 5C8RA 5AJOA 4Y63A 1G0RA 1H5TA 4HO0A 1LL2A 1R7XA 2I7BA 1XZ6A 1TW1A 1PZTA 1S4OA 3U2WA 5DDTA 2O1GA 1FXJA 2E8BA 2RIZA 3IOJA 1O0RA 2I5EA 5HS2A 2CU2A 2W0VA 2QH5A 4KPZA 2WVKA 2QGIA 2C0NA 2BO4A 1LVWA 3I0KA 4AC3A 2VXMA 5FU8A 1HM8A 1OQMB 1JVGA 3E26A 1EZIA 5I1FA 2AM4A 4Y7GA 5C4FA 3ZGFA 1O23B 1FGXA 2VSHA 1H7GA 3V8YA 4NANA 1FG5N 1G8OA 1VZUA 1I52A 4EE5A 1FGGA 1GX0A 2J0BA 4JD0A 1O7QA 4YS8A 5C49A 3OH0A 1ZJOA 2PA4A 1GWVA 4HOCA 1ZCYA 1LZIA 5D91A 1GWWA 1H5SB 1HJLA 1W57A 2Z86A 1VGUA 4AYJA 3CKJA 1VGTA 1FR8A 3I0EA 2FFUA 3U2VA 1G95A 3IOIA 2YQJA 2O1FA 4KXOA 3I0LA 2RITA 5FTVA 1ZCVA 3CGXA 3CU0A 4FRQA 3OH2A 3LW6A 2YQHA 2AM3A 3OH1A 3POLA 3KIAA 3JTJA 1H5SC 1OMZA 4J18A 4D11A 5C1LA 1Z90A 2VS5A 1ZDFA 4HO6A 5CMFX 1QG8A 3I0CA 3JUKA 3FWWA 3N9WA 1ON8A 3I0GA 1MP4A 1XHBA 2Y4KA 1ZJ2A 4DECA 1YP2A 1YP3A 3FOQA 3U2XA 5CMHA 3ZGGA 1HM0A 1VGWA 2W0WA 1TW5A 2VS3A 3HL3A 1H7EA 3NGWA 2UX8A 3Q80A 4M28A 4UEGA 1H5SD 4O6MA 5CQNX 4HO8A 3SX5A 3V0MA 1R7UA 1SS9A 3T7OA 1ON6A 2XWNA 3RMVA 4B2WA 3F1CA 2RJ0A 3ST8A 5C3AA 1JYLA 2J0AA 4HG6A 5AJNA 1GX4A 2YC3A 4CJ8A 1MC3A 1R7TA 1FXOA 3JUJA 2Y7AA 3V8ZA 4BMAA 2FYBA 3RMWA 2AE7A 3TQDA 1W55A 3K8DA 1MP3A 2VK9A 3SXBA 3CKNA 3SXGA 1V84A 1H7QA 1ZJ1A 3D5NA 2Y4LA 4B2XA 1YROB 5C3BA 4DE7A 4KQLA 4DDZA 2ZU9A 1G3LA 2RJ7A 1VH1A 2ICYA 4HCQA 2D0JA 3PKPA 1WT0A 2YESA 1G97A 1ZDGA 1W77A 2OI7A 4O6NA 2OI6A 1WVCA 2A8WA 2PGVA 2WAWA 3OC9A 5BXCA 3SXAA 5IDSA 3SX7A 1VPAA 2RJ8A 3K8EA 1H7FA 4Y7FA 1VICA 3V0LA 5CMIA 4FIXA 4M2BA 1H5SA 4EEGA 4KNRA 1QWJA 4NAIA 2A8UA 4P02A 1FZWA 1ZI1A 4G3PA 3F1YA 1R82A 1G9RA 1H7HA 4AYLA 4FRMA 1ZIZA 4LW3A 3V0QA 2VXLA 1LZ7A 2XMEA 5FUHA 3O3PA 2RIYA 2WVLA 5FU0A 2Y6PA 1WSZA 3SX8A 3I0DA 2O1HA 1HM9A 1IINA 3Q4SA 2P72A 5CMJA 4FRDA 4NALA 3RSBA 4K6RA 5C47A 3SPTA 1PZYB 1FO9A 3V91A 1VM8A 1G1LA 2PX7A 2RIXA 4ASYA 3ZF8A 1NQIB 2RJ5A 3IOHA 4IRPA 1NF5B 1ZHJA 4FRHA 4B42A 2ZU7A 5J49A 1E5KA 2I5KA 2X60A 1R7VA 2WGZA 4XWIA 1R7YA 5EJ1A 2BO8A 4FCEA 2D7RA 3OAMA 4FREA 3V0PA 5CQLX 3OH4A 1OMXA 4R7PA 4EVWA 4MYBA 2D7IA 1FOAA 1KWSA 2P73A 1H3MA 3D98A 1JVDA 4KC1A 5EJZA 3T7MA 5EIYA 5L6VA 2AESA 1S4NA 1V82A 4NAKA
chains in the Genus database with same CATH topology
4E1KA 5DDVA 1VH3A 2Q4JA 1LZ0A 4HO5A 4EEMA 1MP5A 2X5SA 1H5RB 1GA8A 4ZDQA 4Y7UA 1WT1A 1QGQA 2X65A 3CKVA 4KPXA 5C36A 5L6SA 1ZJ0A 1NMMB 1NHEB 4Y6NA 5C4DA 2RJ1A 5FV9A 1LZJA 4D0TA 3U0YA 4B4GA 3CKQA 1V83A 3SXCA 1ZJPA 1LL0A 3DK5A 4EEAA 5C1HA 4HO2A 1O7OA 2AH9A 3CKOA 1G23A 2Y4MA 1QGSA 4LW6A 4ARWA 2BO6A 1NKHB 2V0LA 1GQCA 2E3DA 3SXDA 2AECA 3V0NA 4FQWA 2XWMA 3EE5A 4Y62A 4C2SA 2VFZA 2X5ZA 3DJ4A 4EE3A 1ZI4A 3TZTA 3T7NA 1R80A 4ASJA 5CQMX 1H7LA 4B3UA 2V0JA 1NWGB 5D92A 2FYAA 2JCJA 2YQSA 5C1GA 2GGOA 3SX3A 1ZJ3A 5AJPA 2V0IA 1ZCUA 1FRWA 3ZLLA 2YCMA 3BRKX 1JYKA 1TVYA 4HO3A 4KC2A 3I0FA 1GQ9A 5C4BA 2XMHA 3QVBA 2FFVA 4MIXA 4CJCA 2RJ9A 4D0ZA 4FRBA 5CQOA 1FO8A 4G3QA 3R3IA 1VGZA 2FYCB 1WT2A 1H5TB 4BQHA 4CJBA 2RJ4A 3USRA 2JCKA 3U2UA 2FYDB 1ZCTA 3R2WA 5C4EA 3PNNA 4Y7VA 1WT3A 4FRLA 5C48A 1K4VA 2JCLA 3BCVA 4P00A 2BO7A 3USQA 4B4BA 1HV9A 1EYRA 2YQCA 2ICXA 2ZU8A 5IDTA 4IRQA 4Y64A 1G93A 2XWLA 4HO9A 4KRVA 2WEEA 4KNXA 3Q7UA 1H5RA 2GGQA 3V90A 1JV3A 2V0HA 4KC4A 4FROA 3U2TA 1INJA 2P6WA 4B5BA 4AAWA 1YP4A 2VD4A 3D8VA 4G3SA 1ZI5A 5C38A 1H7TA 3I0JA 1JV1A 5FYEA 2AM5A 4KT7A 3SXEA 4B4MA 4Q7CA 4FRAA 2FY7A 5CMGX 2MZBA 1INIA 1H4EA 3OKRA 4L41C 5C4CA 2Z87A 3E25A 4MNDA 3I0IX 5C3DA 2YC5A 4FCUA 2APCA 5JQQA 3OH3A 2VSIA 4FIYA 2AGDA 1FWYA 2JCOA 1HJJA 1S4PA 1FR9A 1TZFA 1VZTA 4Y7TA 2VS4A 3V0OA 4EEOA 2WE9A 4M4KA 4M2AA 4EE4A 2Y4JA 1H4DA 2RJ6A 3I0HA 4JISA 4Y9XA 5CQPA 5FTSA 1G2VA 3DUVA 3GUEA 5IFYA 1R81A 4ECMA 1IIMA 4Y6UA 2PGYA 2OI5A 2WVMA 4CVHA 1LL3A 4HO4A 1H4CA 2NXVA 1ZI3A 4D11C 2DPWA 2OEGA 2V0KA 3OGZA 1VZXA 4FRPA 3ZLKA 4D48A 4GBPA 3U0XA 2OEFA 2QKXA 3PKQA 4G87A 5C8RA 5AJOA 4Y63A 1G0RA 1H5TA 4HO0A 1LL2A 1R7XA 2I7BA 1XZ6A 1TW1A 1PZTA 1S4OA 3U2WA 5DDTA 2O1GA 1FXJA 2E8BA 2RIZA 3IOJA 1O0RA 2I5EA 5HS2A 2CU2A 2W0VA 2QH5A 4KPZA 2WVKA 2QGIA 2C0NA 2BO4A 1LVWA 3I0KA 4AC3A 2VXMA 5FU8A 1HM8A 1OQMB 1JVGA 3E26A 1EZIA 5I1FA 2AM4A 4Y7GA 5C4FA 3ZGFA 1O23B 1FGXA 2VSHA 1H7GA 3V8YA 4NANA 1FG5N 1G8OA 1VZUA 1I52A 4EE5A 1FGGA 1GX0A 2J0BA 4JD0A 1O7QA 4YS8A 5C49A 3OH0A 1ZJOA 2PA4A 1GWVA 4HOCA 1ZCYA 1LZIA 5D91A 1GWWA 1H5SB 1HJLA 1W57A 2Z86A 1VGUA 4AYJA 3CKJA 1VGTA 1FR8A 3I0EA 2FFUA 3U2VA 1G95A 3IOIA 2YQJA 2O1FA 4KXOA 3I0LA 2RITA 5FTVA 1ZCVA 3CGXA 3CU0A 4FRQA 3OH2A 3LW6A 2YQHA 2AM3A 3OH1A 3POLA 3KIAA 3JTJA 1H5SC 1OMZA 4J18A 4D11A 5C1LA 1Z90A 2VS5A 1ZDFA 4HO6A 5CMFX 1QG8A 3I0CA 3JUKA 3FWWA 3N9WA 1ON8A 3I0GA 1MP4A 1XHBA 2Y4KA 1ZJ2A 4DECA 1YP2A 1YP3A 3FOQA 3U2XA 5CMHA 3ZGGA 1HM0A 1VGWA 2W0WA 1TW5A 2VS3A 3HL3A 1H7EA 3NGWA 2UX8A 3Q80A 4M28A 4UEGA 1H5SD 4O6MA 5CQNX 4HO8A 3SX5A 3V0MA 1R7UA 1SS9A 3T7OA 1ON6A 2XWNA 3RMVA 4B2WA 3F1CA 2RJ0A 3ST8A 5C3AA 1JYLA 2J0AA 4HG6A 5AJNA 1GX4A 2YC3A 4CJ8A 1MC3A 1R7TA 1FXOA 3JUJA 2Y7AA 3V8ZA 4BMAA 2FYBA 3RMWA 2AE7A 3TQDA 1W55A 3K8DA 1MP3A 2VK9A 3SXBA 3CKNA 3SXGA 1V84A 1H7QA 1ZJ1A 3D5NA 2Y4LA 4B2XA 1YROB 5C3BA 4DE7A 4KQLA 4DDZA 2ZU9A 1G3LA 2RJ7A 1VH1A 2ICYA 4HCQA 2D0JA 3PKPA 1WT0A 2YESA 1G97A 1ZDGA 1W77A 2OI7A 4O6NA 2OI6A 1WVCA 2A8WA 2PGVA 2WAWA 3OC9A 5BXCA 3SXAA 5IDSA 3SX7A 1VPAA 2RJ8A 3K8EA 1H7FA 4Y7FA 1VICA 3V0LA 5CMIA 4FIXA 4M2BA 1H5SA 4EEGA 4KNRA 1QWJA 4NAIA 2A8UA 4P02A 1FZWA 1ZI1A 4G3PA 3F1YA 1R82A 1G9RA 1H7HA 4AYLA 4FRMA 1ZIZA 4LW3A 3V0QA 2VXLA 1LZ7A 2XMEA 5FUHA 3O3PA 2RIYA 2WVLA 5FU0A 2Y6PA 1WSZA 3SX8A 3I0DA 2O1HA 1HM9A 1IINA 3Q4SA 2P72A 5CMJA 4FRDA 4NALA 3RSBA 4K6RA 5C47A 3SPTA 1PZYB 1FO9A 3V91A 1VM8A 1G1LA 2PX7A 2RIXA 4ASYA 3ZF8A 1NQIB 2RJ5A 3IOHA 4IRPA 1NF5B 1ZHJA 4FRHA 4B42A 2ZU7A 5J49A 1E5KA 2I5KA 2X60A 1R7VA 2WGZA 4XWIA 1R7YA 5EJ1A 2BO8A 4FCEA 2D7RA 3OAMA 4FREA 3V0PA 5CQLX 3OH4A 1OMXA 4R7PA 4EVWA 4MYBA 2D7IA 1FOAA 1KWSA 2P73A 1H3MA 3D98A 1JVDA 4KC1A 5EJZA 3T7MA 5EIYA 5L6VA 2AESA 1S4NA 1V82A 4NAKA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4E1K A;  5DDV A;  1VH3 A;  2Q4J A;  1LZ0 A;  4HO5 A;  4EEM A;  1MP5 A;  2X5S A;  1H5R B;  1GA8 A;  4ZDQ A;  4Y7U A;  1WT1 A;  1QGQ A;  2X65 A;  3CKV A;  4KPX A;  5C36 A;  5L6S A;  1ZJ0 A;  1NMM B;  1NHE B;  4Y6N A;  5C4D A;  2RJ1 A;  5FV9 A;  1LZJ A;  4D0T A;  3U0Y A;  4B4G A;  3CKQ A;  1V83 A;  3SXC A;  1ZJP A;  1LL0 A;  3DK5 A;  4EEA A;  5C1H A;  4HO2 A;  1O7O A;  2AH9 A;  3CKO A;  1G23 A;  2Y4M A;  1QGS A;  4LW6 A;  4ARW A;  2BO6 A;  1NKH B;  2V0L A;  1GQC A;  2E3D A;  3SXD A;  2AEC A;  3V0N A;  4FQW A;  2XWM A;  3EE5 A;  4Y62 A;  4C2S A;  2VFZ A;  2X5Z A;  3DJ4 A;  4EE3 A;  1ZI4 A;  3TZT A;  3T7N A;  1R80 A;  4ASJ A;  5CQM X;  1H7L A;  4B3U A;  2V0J A;  1NWG B;  2FYA A;  2JCJ A;  2YQS A;  5C1G A;  2GGO A;  3SX3 A;  1ZJ3 A;  5AJP A;  2V0I A;  1ZCU A;  1FRW A;  3ZLL A;  2YCM A;  3BRK X;  1JYK A;  1TVY A;  4HO3 A;  4KC2 A;  3I0F A;  1GQ9 A;  5C4B A;  2XMH A;  3QVB A;  2FFV A;  4CJC A;  2RJ9 A;  4D0Z A;  4FRB A;  5CQO A;  1FO8 A;  4G3Q A;  3R3I A;  1VGZ A;  2FYC B;  1WT2 A;  1H5T B;  4BQH A;  4CJB A;  2RJ4 A;  3USR A;  2JCK A;  3U2U A;  2FYD B;  1ZCT A;  3R2W A;  5C4E A;  3PNN A;  4Y7V A;  1WT3 A;  4FRL A;  5C48 A;  1K4V A;  2JCL A;  3BCV A;  4P00 A;  2BO7 A;  3USQ A;  4B4B A;  1HV9 A;  1EYR A;  2YQC A;  2ICX A;  2ZU8 A;  5IDT A;  4IRQ A;  4Y64 A;  1G93 A;  2XWL A;  4HO9 A;  4KRV A;  2WEE A;  4KNX A;  3Q7U A;  1H5R A;  2GGQ A;  3V90 A;  1JV3 A;  2V0H A;  4KC4 A;  4FRO A;  3U2T A;  1INJ A;  2P6W A;  4B5B A;  4AAW A;  1YP4 A;  2VD4 A;  3D8V A;  4G3S A;  1ZI5 A;  5C38 A;  1H7T A;  3I0J A;  1JV1 A;  5FYE A;  2AM5 A;  4KT7 A;  3SXE A;  4B4M A;  4FRA A;  2FY7 A;  5CMG X;  2MZB A;  1INI A;  1H4E A;  3OKR A;  4L41 C;  5C4C A;  2Z87 A;  3E25 A;  4MND A;  3I0I X;  5C3D A;  2YC5 A;  4FCU A;  2APC A;  5JQQ A;  3OH3 A;  2VSI A;  2AGD A;  1FWY A;  2JCO A;  1HJJ A;  1S4P A;  1FR9 A;  1TZF A;  1VZT A;  4Y7T A;  2VS4 A;  3V0O A;  4EEO A;  2WE9 A;  4M4K A;  4M2A A;  4EE4 A;  2Y4J A;  1H4D A;  2RJ6 A;  3I0H A;  4JIS A;  4Y9X A;  5CQP A;  5FTS A;  1G2V A;  3DUV A;  3GUE A;  5IFY A;  1R81 A;  4ECM A;  1IIM A;  4Y6U A;  2PGY A;  2OI5 A;  2WVM A;  4CVH A;  1LL3 A;  4HO4 A;  1H4C A;  2NXV A;  1ZI3 A;  4D11 C;  2DPW A;  2OEG A;  2V0K A;  3OGZ A;  1VZX A;  4FRP A;  3ZLK A;  4D48 A;  4GBP A;  3U0X A;  2OEF A;  2QKX A;  3PKQ A;  4G87 A;  5C8R A;  5AJO A;  4Y63 A;  1G0R A;  1H5T A;  4HO0 A;  1LL2 A;  1R7X A;  2I7B A;  1XZ6 A;  1TW1 A;  1PZT A;  1S4O A;  3U2W A;  5DDT A;  2O1G A;  1FXJ A;  2E8B A;  2RIZ A;  3IOJ A;  1O0R A;  2I5E A;  5HS2 A;  2CU2 A;  2W0V A;  2QH5 A;  4KPZ A;  2WVK A;  2QGI A;  2BO4 A;  1LVW A;  3I0K A;  4AC3 A;  2VXM A;  5FU8 A;  1HM8 A;  1OQM B;  1JVG A;  3E26 A;  1EZI A;  5I1F A;  2AM4 A;  4Y7G A;  5C4F A;  3ZGF A;  1O23 B;  1FGX A;  2VSH A;  1H7G A;  3V8Y A;  4NAN A;  1FG5 N;  1G8O A;  1VZU A;  1I52 A;  4EE5 A;  1FGG A;  1GX0 A;  4JD0 A;  1O7Q A;  4YS8 A;  5C49 A;  3OH0 A;  1ZJO A;  2PA4 A;  1GWV A;  4HOC A;  1ZCY A;  1LZI A;  1GWW A;  1H5S B;  1HJL A;  1W57 A;  2Z86 A;  1VGU A;  4AYJ A;  3CKJ A;  1VGT A;  1FR8 A;  3I0E A;  2FFU A;  3U2V A;  1G95 A;  3IOI A;  2YQJ A;  2O1F A;  4KXO A;  3I0L A;  2RIT A;  5FTV A;  1ZCV A;  3CGX A;  3CU0 A;  4FRQ A;  3OH2 A;  3LW6 A;  2YQH A;  2AM3 A;  3OH1 A;  3POL A;  3KIA A;  3JTJ A;  1H5S C;  1OMZ A;  4J18 A;  4D11 A;  5C1L A;  1Z90 A;  2VS5 A;  1ZDF A;  4HO6 A;  5CMF X;  1QG8 A;  3I0C A;  3JUK A;  3FWW A;  3N9W A;  1ON8 A;  3I0G A;  1MP4 A;  1XHB A;  2Y4K A;  1ZJ2 A;  4DEC A;  1YP2 A;  1YP3 A;  3FOQ A;  3U2X A;  5CMH A;  3ZGG A;  1HM0 A;  1VGW A;  2W0W A;  1TW5 A;  2VS3 A;  3HL3 A;  1H7E A;  3NGW A;  2UX8 A;  3Q80 A;  4M28 A;  4UEG A;  1H5S D;  5CQN X;  4HO8 A;  3SX5 A;  3V0M A;  1R7U A;  1SS9 A;  3T7O A;  1ON6 A;  2XWN A;  3RMV A;  4B2W A;  3F1C A;  2RJ0 A;  3ST8 A;  5C3A A;  1JYL A;  4HG6 A;  5AJN A;  1GX4 A;  2YC3 A;  4CJ8 A;  1MC3 A;  1R7T A;  1FXO A;  3JUJ A;  2Y7A A;  3V8Z A;  4BMA A;  2FYB A;  3RMW A;  2AE7 A;  3TQD A;  1W55 A;  3K8D A;  1MP3 A;  3SXB A;  3CKN A;  3SXG A;  1V84 A;  1H7Q A;  1ZJ1 A;  3D5N A;  2Y4L A;  4B2X A;  1YRO B;  5C3B A;  4DE7 A;  4KQL A;  4DDZ A;  2ZU9 A;  1G3L A;  2RJ7 A;  1VH1 A;  2ICY A;  4HCQ A;  2D0J A;  3PKP A;  1WT0 A;  2YES A;  1G97 A;  1ZDG A;  1W77 A;  2OI7 A;  2OI6 A;  1WVC A;  2A8W A;  2PGV A;  2WAW A;  3OC9 A;  5BXC A;  3SXA A;  5IDS A;  3SX7 A;  1VPA A;  2RJ8 A;  3K8E A;  1H7F A;  4Y7F A;  1VIC A;  3V0L A;  5CMI A;  4M2B A;  1H5S A;  4EEG A;  4KNR A;  1QWJ A;  4NAI A;  2A8U A;  4P02 A;  1FZW A;  1ZI1 A;  4G3P A;  3F1Y A;  1R82 A;  1G9R A;  1H7H A;  4AYL A;  4FRM A;  1ZIZ A;  4LW3 A;  3V0Q A;  2VXL A;  1LZ7 A;  2XME A;  5FUH A;  3O3P A;  2RIY A;  2WVL A;  5FU0 A;  2Y6P A;  1WSZ A;  3SX8 A;  3I0D A;  2O1H A;  1HM9 A;  1IIN A;  3Q4S A;  2P72 A;  5CMJ A;  4FRD A;  4NAL A;  3RSB A;  4K6R A;  5C47 A;  3SPT A;  1PZY B;  1FO9 A;  3V91 A;  1VM8 A;  1G1L A;  2PX7 A;  2RIX A;  4ASY A;  3ZF8 A;  1NQI B;  2RJ5 A;  3IOH A;  4IRP A;  1NF5 B;  1ZHJ A;  4FRH A;  4B42 A;  2ZU7 A;  5J49 A;  1E5K A;  2I5K A;  2X60 A;  1R7V A;  2WGZ A;  4XWI A;  1R7Y A;  5EJ1 A;  2BO8 A;  4FCE A;  2D7R A;  3OAM A;  4FRE A;  3V0P A;  5CQL X;  3OH4 A;  1OMX A;  4R7P A;  4EVW A;  4MYB A;  2D7I A;  1FOA A;  1KWS A;  2P73 A;  1H3M A;  3D98 A;  1JVD A;  4KC1 A;  5EJZ A;  3T7M A;  5EIY A;  5L6V A;  2AES A;  1S4N A;  1V82 A;  4NAK A; 
#chains in the Genus database with same CATH topology
 4E1K A;  5DDV A;  1VH3 A;  2Q4J A;  1LZ0 A;  4HO5 A;  4EEM A;  1MP5 A;  2X5S A;  1H5R B;  1GA8 A;  4ZDQ A;  4Y7U A;  1WT1 A;  1QGQ A;  2X65 A;  3CKV A;  4KPX A;  5C36 A;  5L6S A;  1ZJ0 A;  1NMM B;  1NHE B;  4Y6N A;  5C4D A;  2RJ1 A;  5FV9 A;  1LZJ A;  4D0T A;  3U0Y A;  4B4G A;  3CKQ A;  1V83 A;  3SXC A;  1ZJP A;  1LL0 A;  3DK5 A;  4EEA A;  5C1H A;  4HO2 A;  1O7O A;  2AH9 A;  3CKO A;  1G23 A;  2Y4M A;  1QGS A;  4LW6 A;  4ARW A;  2BO6 A;  1NKH B;  2V0L A;  1GQC A;  2E3D A;  3SXD A;  2AEC A;  3V0N A;  4FQW A;  2XWM A;  3EE5 A;  4Y62 A;  4C2S A;  2VFZ A;  2X5Z A;  3DJ4 A;  4EE3 A;  1ZI4 A;  3TZT A;  3T7N A;  1R80 A;  4ASJ A;  5CQM X;  1H7L A;  4B3U A;  2V0J A;  1NWG B;  5D92 A;  2FYA A;  2JCJ A;  2YQS A;  5C1G A;  2GGO A;  3SX3 A;  1ZJ3 A;  5AJP A;  2V0I A;  1ZCU A;  1FRW A;  3ZLL A;  2YCM A;  3BRK X;  1JYK A;  1TVY A;  4HO3 A;  4KC2 A;  3I0F A;  1GQ9 A;  5C4B A;  2XMH A;  3QVB A;  2FFV A;  4MIX A;  4CJC A;  2RJ9 A;  4D0Z A;  4FRB A;  5CQO A;  1FO8 A;  4G3Q A;  3R3I A;  1VGZ A;  2FYC B;  1WT2 A;  1H5T B;  4BQH A;  4CJB A;  2RJ4 A;  3USR A;  2JCK A;  3U2U A;  2FYD B;  1ZCT A;  3R2W A;  5C4E A;  3PNN A;  4Y7V A;  1WT3 A;  4FRL A;  5C48 A;  1K4V A;  2JCL A;  3BCV A;  4P00 A;  2BO7 A;  3USQ A;  4B4B A;  1HV9 A;  1EYR A;  2YQC A;  2ICX A;  2ZU8 A;  5IDT A;  4IRQ A;  4Y64 A;  1G93 A;  2XWL A;  4HO9 A;  4KRV A;  2WEE A;  4KNX A;  3Q7U A;  1H5R A;  2GGQ A;  3V90 A;  1JV3 A;  2V0H A;  4KC4 A;  4FRO A;  3U2T A;  1INJ A;  2P6W A;  4B5B A;  4AAW A;  1YP4 A;  2VD4 A;  3D8V A;  4G3S A;  1ZI5 A;  5C38 A;  1H7T A;  3I0J A;  1JV1 A;  5FYE A;  2AM5 A;  4KT7 A;  3SXE A;  4B4M A;  4Q7C A;  4FRA A;  2FY7 A;  5CMG X;  2MZB A;  1INI A;  1H4E A;  3OKR A;  4L41 C;  5C4C A;  2Z87 A;  3E25 A;  4MND A;  3I0I X;  5C3D A;  2YC5 A;  4FCU A;  2APC A;  5JQQ A;  3OH3 A;  2VSI A;  4FIY A;  2AGD A;  1FWY A;  2JCO A;  1HJJ A;  1S4P A;  1FR9 A;  1TZF A;  1VZT A;  4Y7T A;  2VS4 A;  3V0O A;  4EEO A;  2WE9 A;  4M4K A;  4M2A A;  4EE4 A;  2Y4J A;  1H4D A;  2RJ6 A;  3I0H A;  4JIS A;  4Y9X A;  5CQP A;  5FTS A;  1G2V A;  3DUV A;  3GUE A;  5IFY A;  1R81 A;  4ECM A;  1IIM A;  4Y6U A;  2PGY A;  2OI5 A;  2WVM A;  4CVH A;  1LL3 A;  4HO4 A;  1H4C A;  2NXV A;  1ZI3 A;  4D11 C;  2DPW A;  2OEG A;  2V0K A;  3OGZ A;  1VZX A;  4FRP A;  3ZLK A;  4D48 A;  4GBP A;  3U0X A;  2OEF A;  2QKX A;  3PKQ A;  4G87 A;  5C8R A;  5AJO A;  4Y63 A;  1G0R A;  1H5T A;  4HO0 A;  1LL2 A;  1R7X A;  2I7B A;  1XZ6 A;  1TW1 A;  1PZT A;  1S4O A;  3U2W A;  5DDT A;  2O1G A;  1FXJ A;  2E8B A;  2RIZ A;  3IOJ A;  1O0R A;  2I5E A;  5HS2 A;  2CU2 A;  2W0V A;  2QH5 A;  4KPZ A;  2WVK A;  2QGI A;  2C0N A;  2BO4 A;  1LVW A;  3I0K A;  4AC3 A;  2VXM A;  5FU8 A;  1HM8 A;  1OQM B;  1JVG A;  3E26 A;  1EZI A;  5I1F A;  2AM4 A;  4Y7G A;  5C4F A;  3ZGF A;  1O23 B;  1FGX A;  2VSH A;  1H7G A;  3V8Y A;  4NAN A;  1FG5 N;  1G8O A;  1VZU A;  1I52 A;  4EE5 A;  1FGG A;  1GX0 A;  2J0B A;  4JD0 A;  1O7Q A;  4YS8 A;  5C49 A;  3OH0 A;  1ZJO A;  2PA4 A;  1GWV A;  4HOC A;  1ZCY A;  1LZI A;  5D91 A;  1GWW A;  1H5S B;  1HJL A;  1W57 A;  2Z86 A;  1VGU A;  4AYJ A;  3CKJ A;  1VGT A;  1FR8 A;  3I0E A;  2FFU A;  3U2V A;  1G95 A;  3IOI A;  2YQJ A;  2O1F A;  4KXO A;  3I0L A;  2RIT A;  5FTV A;  1ZCV A;  3CGX A;  3CU0 A;  4FRQ A;  3OH2 A;  3LW6 A;  2YQH A;  2AM3 A;  3OH1 A;  3POL A;  3KIA A;  3JTJ A;  1H5S C;  1OMZ A;  4J18 A;  4D11 A;  5C1L A;  1Z90 A;  2VS5 A;  1ZDF A;  4HO6 A;  5CMF X;  1QG8 A;  3I0C A;  3JUK A;  3FWW A;  3N9W A;  1ON8 A;  3I0G A;  1MP4 A;  1XHB A;  2Y4K A;  1ZJ2 A;  4DEC A;  1YP2 A;  1YP3 A;  3FOQ A;  3U2X A;  5CMH A;  3ZGG A;  1HM0 A;  1VGW A;  2W0W A;  1TW5 A;  2VS3 A;  3HL3 A;  1H7E A;  3NGW A;  2UX8 A;  3Q80 A;  4M28 A;  4UEG A;  1H5S D;  4O6M A;  5CQN X;  4HO8 A;  3SX5 A;  3V0M A;  1R7U A;  1SS9 A;  3T7O A;  1ON6 A;  2XWN A;  3RMV A;  4B2W A;  3F1C A;  2RJ0 A;  3ST8 A;  5C3A A;  1JYL A;  2J0A A;  4HG6 A;  5AJN A;  1GX4 A;  2YC3 A;  4CJ8 A;  1MC3 A;  1R7T A;  1FXO A;  3JUJ A;  2Y7A A;  3V8Z A;  4BMA A;  2FYB A;  3RMW A;  2AE7 A;  3TQD A;  1W55 A;  3K8D A;  1MP3 A;  2VK9 A;  3SXB A;  3CKN A;  3SXG A;  1V84 A;  1H7Q A;  1ZJ1 A;  3D5N A;  2Y4L A;  4B2X A;  1YRO B;  5C3B A;  4DE7 A;  4KQL A;  4DDZ A;  2ZU9 A;  1G3L A;  2RJ7 A;  1VH1 A;  2ICY A;  4HCQ A;  2D0J A;  3PKP A;  1WT0 A;  2YES A;  1G97 A;  1ZDG A;  1W77 A;  2OI7 A;  4O6N A;  2OI6 A;  1WVC A;  2A8W A;  2PGV A;  2WAW A;  3OC9 A;  5BXC A;  3SXA A;  5IDS A;  3SX7 A;  1VPA A;  2RJ8 A;  3K8E A;  1H7F A;  4Y7F A;  1VIC A;  3V0L A;  5CMI A;  4FIX A;  4M2B A;  1H5S A;  4EEG A;  4KNR A;  1QWJ A;  4NAI A;  2A8U A;  4P02 A;  1FZW A;  1ZI1 A;  4G3P A;  3F1Y A;  1R82 A;  1G9R A;  1H7H A;  4AYL A;  4FRM A;  1ZIZ A;  4LW3 A;  3V0Q A;  2VXL A;  1LZ7 A;  2XME A;  5FUH A;  3O3P A;  2RIY A;  2WVL A;  5FU0 A;  2Y6P A;  1WSZ A;  3SX8 A;  3I0D A;  2O1H A;  1HM9 A;  1IIN A;  3Q4S A;  2P72 A;  5CMJ A;  4FRD A;  4NAL A;  3RSB A;  4K6R A;  5C47 A;  3SPT A;  1PZY B;  1FO9 A;  3V91 A;  1VM8 A;  1G1L A;  2PX7 A;  2RIX A;  4ASY A;  3ZF8 A;  1NQI B;  2RJ5 A;  3IOH A;  4IRP A;  1NF5 B;  1ZHJ A;  4FRH A;  4B42 A;  2ZU7 A;  5J49 A;  1E5K A;  2I5K A;  2X60 A;  1R7V A;  2WGZ A;  4XWI A;  1R7Y A;  5EJ1 A;  2BO8 A;  4FCE A;  2D7R A;  3OAM A;  4FRE A;  3V0P A;  5CQL X;  3OH4 A;  1OMX A;  4R7P A;  4EVW A;  4MYB A;  2D7I A;  1FOA A;  1KWS A;  2P73 A;  1H3M A;  3D98 A;  1JVD A;  4KC1 A;  5EJZ A;  3T7M A;  5EIY A;  5L6V A;  2AES A;  1S4N A;  1V82 A;  4NAK A; 
#chains in the Genus database with same CATH homology
 4E1K A;  5DDV A;  1VH3 A;  2Q4J A;  1LZ0 A;  4HO5 A;  4EEM A;  1MP5 A;  2X5S A;  1H5R B;  1GA8 A;  4ZDQ A;  4Y7U A;  1WT1 A;  1QGQ A;  2X65 A;  3CKV A;  4KPX A;  5C36 A;  5L6S A;  1ZJ0 A;  1NMM B;  1NHE B;  4Y6N A;  5C4D A;  2RJ1 A;  5FV9 A;  1LZJ A;  4D0T A;  3U0Y A;  4B4G A;  3CKQ A;  1V83 A;  3SXC A;  1ZJP A;  1LL0 A;  3DK5 A;  4EEA A;  5C1H A;  4HO2 A;  1O7O A;  2AH9 A;  3CKO A;  1G23 A;  2Y4M A;  1QGS A;  4LW6 A;  4ARW A;  2BO6 A;  1NKH B;  2V0L A;  1GQC A;  2E3D A;  3SXD A;  2AEC A;  3V0N A;  4FQW A;  2XWM A;  3EE5 A;  4Y62 A;  4C2S A;  2VFZ A;  2X5Z A;  3DJ4 A;  4EE3 A;  1ZI4 A;  3TZT A;  3T7N A;  1R80 A;  4ASJ A;  5CQM X;  1H7L A;  4B3U A;  2V0J A;  1NWG B;  5D92 A;  2FYA A;  2JCJ A;  2YQS A;  5C1G A;  2GGO A;  3SX3 A;  1ZJ3 A;  5AJP A;  2V0I A;  1ZCU A;  1FRW A;  3ZLL A;  2YCM A;  3BRK X;  1JYK A;  1TVY A;  4HO3 A;  4KC2 A;  3I0F A;  1GQ9 A;  5C4B A;  2XMH A;  3QVB A;  2FFV A;  4MIX A;  4CJC A;  2RJ9 A;  4D0Z A;  4FRB A;  5CQO A;  1FO8 A;  4G3Q A;  3R3I A;  1VGZ A;  2FYC B;  1WT2 A;  1H5T B;  4BQH A;  4CJB A;  2RJ4 A;  3USR A;  2JCK A;  3U2U A;  2FYD B;  1ZCT A;  3R2W A;  5C4E A;  3PNN A;  4Y7V A;  1WT3 A;  4FRL A;  5C48 A;  1K4V A;  2JCL A;  3BCV A;  4P00 A;  2BO7 A;  3USQ A;  4B4B A;  1HV9 A;  1EYR A;  2YQC A;  2ICX A;  2ZU8 A;  5IDT A;  4IRQ A;  4Y64 A;  1G93 A;  2XWL A;  4HO9 A;  4KRV A;  2WEE A;  4KNX A;  3Q7U A;  1H5R A;  2GGQ A;  3V90 A;  1JV3 A;  2V0H A;  4KC4 A;  4FRO A;  3U2T A;  1INJ A;  2P6W A;  4B5B A;  4AAW A;  1YP4 A;  2VD4 A;  3D8V A;  4G3S A;  1ZI5 A;  5C38 A;  1H7T A;  3I0J A;  1JV1 A;  5FYE A;  2AM5 A;  4KT7 A;  3SXE A;  4B4M A;  4Q7C A;  4FRA A;  2FY7 A;  5CMG X;  2MZB A;  1INI A;  1H4E A;  3OKR A;  4L41 C;  5C4C A;  2Z87 A;  3E25 A;  4MND A;  3I0I X;  5C3D A;  2YC5 A;  4FCU A;  2APC A;  5JQQ A;  3OH3 A;  2VSI A;  4FIY A;  2AGD A;  1FWY A;  2JCO A;  1HJJ A;  1S4P A;  1FR9 A;  1TZF A;  1VZT A;  4Y7T A;  2VS4 A;  3V0O A;  4EEO A;  2WE9 A;  4M4K A;  4M2A A;  4EE4 A;  2Y4J A;  1H4D A;  2RJ6 A;  3I0H A;  4JIS A;  4Y9X A;  5CQP A;  5FTS A;  1G2V A;  3DUV A;  3GUE A;  5IFY A;  1R81 A;  4ECM A;  1IIM A;  4Y6U A;  2PGY A;  2OI5 A;  2WVM A;  4CVH A;  1LL3 A;  4HO4 A;  1H4C A;  2NXV A;  1ZI3 A;  4D11 C;  2DPW A;  2OEG A;  2V0K A;  3OGZ A;  1VZX A;  4FRP A;  3ZLK A;  4D48 A;  4GBP A;  3U0X A;  2OEF A;  2QKX A;  3PKQ A;  4G87 A;  5C8R A;  5AJO A;  4Y63 A;  1G0R A;  1H5T A;  4HO0 A;  1LL2 A;  1R7X A;  2I7B A;  1XZ6 A;  1TW1 A;  1PZT A;  1S4O A;  3U2W A;  5DDT A;  2O1G A;  1FXJ A;  2E8B A;  2RIZ A;  3IOJ A;  1O0R A;  2I5E A;  5HS2 A;  2CU2 A;  2W0V A;  2QH5 A;  4KPZ A;  2WVK A;  2QGI A;  2C0N A;  2BO4 A;  1LVW A;  3I0K A;  4AC3 A;  2VXM A;  5FU8 A;  1HM8 A;  1OQM B;  1JVG A;  3E26 A;  1EZI A;  5I1F A;  2AM4 A;  4Y7G A;  5C4F A;  3ZGF A;  1O23 B;  1FGX A;  2VSH A;  1H7G A;  3V8Y A;  4NAN A;  1FG5 N;  1G8O A;  1VZU A;  1I52 A;  4EE5 A;  1FGG A;  1GX0 A;  2J0B A;  4JD0 A;  1O7Q A;  4YS8 A;  5C49 A;  3OH0 A;  1ZJO A;  2PA4 A;  1GWV A;  4HOC A;  1ZCY A;  1LZI A;  5D91 A;  1GWW A;  1H5S B;  1HJL A;  1W57 A;  2Z86 A;  1VGU A;  4AYJ A;  3CKJ A;  1VGT A;  1FR8 A;  3I0E A;  2FFU A;  3U2V A;  1G95 A;  3IOI A;  2YQJ A;  2O1F A;  4KXO A;  3I0L A;  2RIT A;  5FTV A;  1ZCV A;  3CGX A;  3CU0 A;  4FRQ A;  3OH2 A;  3LW6 A;  2YQH A;  2AM3 A;  3OH1 A;  3POL A;  3KIA A;  3JTJ A;  1H5S C;  1OMZ A;  4J18 A;  4D11 A;  5C1L A;  1Z90 A;  2VS5 A;  1ZDF A;  4HO6 A;  5CMF X;  1QG8 A;  3I0C A;  3JUK A;  3FWW A;  3N9W A;  1ON8 A;  3I0G A;  1MP4 A;  1XHB A;  2Y4K A;  1ZJ2 A;  4DEC A;  1YP2 A;  1YP3 A;  3FOQ A;  3U2X A;  5CMH A;  3ZGG A;  1HM0 A;  1VGW A;  2W0W A;  1TW5 A;  2VS3 A;  3HL3 A;  1H7E A;  3NGW A;  2UX8 A;  3Q80 A;  4M28 A;  4UEG A;  1H5S D;  4O6M A;  5CQN X;  4HO8 A;  3SX5 A;  3V0M A;  1R7U A;  1SS9 A;  3T7O A;  1ON6 A;  2XWN A;  3RMV A;  4B2W A;  3F1C A;  2RJ0 A;  3ST8 A;  5C3A A;  1JYL A;  2J0A A;  4HG6 A;  5AJN A;  1GX4 A;  2YC3 A;  4CJ8 A;  1MC3 A;  1R7T A;  1FXO A;  3JUJ A;  2Y7A A;  3V8Z A;  4BMA A;  2FYB A;  3RMW A;  2AE7 A;  3TQD A;  1W55 A;  3K8D A;  1MP3 A;  2VK9 A;  3SXB A;  3CKN A;  3SXG A;  1V84 A;  1H7Q A;  1ZJ1 A;  3D5N A;  2Y4L A;  4B2X A;  1YRO B;  5C3B A;  4DE7 A;  4KQL A;  4DDZ A;  2ZU9 A;  1G3L A;  2RJ7 A;  1VH1 A;  2ICY A;  4HCQ A;  2D0J A;  3PKP A;  1WT0 A;  2YES A;  1G97 A;  1ZDG A;  1W77 A;  2OI7 A;  4O6N A;  2OI6 A;  1WVC A;  2A8W A;  2PGV A;  2WAW A;  3OC9 A;  5BXC A;  3SXA A;  5IDS A;  3SX7 A;  1VPA A;  2RJ8 A;  3K8E A;  1H7F A;  4Y7F A;  1VIC A;  3V0L A;  5CMI A;  4FIX A;  4M2B A;  1H5S A;  4EEG A;  4KNR A;  1QWJ A;  4NAI A;  2A8U A;  4P02 A;  1FZW A;  1ZI1 A;  4G3P A;  3F1Y A;  1R82 A;  1G9R A;  1H7H A;  4AYL A;  4FRM A;  1ZIZ A;  4LW3 A;  3V0Q A;  2VXL A;  1LZ7 A;  2XME A;  5FUH A;  3O3P A;  2RIY A;  2WVL A;  5FU0 A;  2Y6P A;  1WSZ A;  3SX8 A;  3I0D A;  2O1H A;  1HM9 A;  1IIN A;  3Q4S A;  2P72 A;  5CMJ A;  4FRD A;  4NAL A;  3RSB A;  4K6R A;  5C47 A;  3SPT A;  1PZY B;  1FO9 A;  3V91 A;  1VM8 A;  1G1L A;  2PX7 A;  2RIX A;  4ASY A;  3ZF8 A;  1NQI B;  2RJ5 A;  3IOH A;  4IRP A;  1NF5 B;  1ZHJ A;  4FRH A;  4B42 A;  2ZU7 A;  5J49 A;  1E5K A;  2I5K A;  2X60 A;  1R7V A;  2WGZ A;  4XWI A;  1R7Y A;  5EJ1 A;  2BO8 A;  4FCE A;  2D7R A;  3OAM A;  4FRE A;  3V0P A;  5CQL X;  3OH4 A;  1OMX A;  4R7P A;  4EVW A;  4MYB A;  2D7I A;  1FOA A;  1KWS A;  2P73 A;  1H3M A;  3D98 A;  1JVD A;  4KC1 A;  5EJZ A;  3T7M A;  5EIY A;  5L6V A;  2AES A;  1S4N A;  1V82 A;  4NAK A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...