2Y7AA

Crystal structure of unliganded gtb p156l
Total Genus 91
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
91
sequence length
284
structure length
277
Chain Sequence
FMVSLPRMVYPQPKVLTPCRKDVLVVTPWLAPIVWEGTFNIDILNEQFRLQNTTIGLTVFAIKKYVAFLKLFLETAEKHFMVGHRVHYYVFTDQLAAVPRVTLGTGRQLSVLEVGASMRRMEMISDFCERRFLSEVDYLVCVDVDMEFRDHVGVEILTPLFGTLHPSFYGSSREAFTYERRPQSQAYIPKDEGDFYYMGAFFGGSVQEVQRLTRACHQAMMVDQANGIEAVWHDESHLNKYLLRHKPTKVLSPEYLWDQQLLGWPAVLRKLRFTAVP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ABO GLYCOSYLTRANSFERASE
publication title Structural and Biochemical Characterization of the Human Blood Group a and B Galactosyltransferases Possessing the Pro156Leu Mutation
rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 91
structure length 277
sequence length 284
chains with identical sequence B, C, D
ec nomenclature ec 2.4.1.37: Fucosylgalactoside 3-alpha-galactosyltransferase.
pdb deposition date 2011-01-31
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.550.10 Alpha Beta Alpha-Beta Complex Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A 2y7aA00
1G95A 1GQ9A 4CJ8A 3T7OA 1LL3A 1HM8A 4FRBA 1FXOA 1WVCA 2Y6PA 4LW6A 4C2SA 4Y64A 3V90A 1ZIZA 1R7XA 2XWLA 1H5SD 4D11C 2PGYA 1H3MA 4HO2A 4DE7A 3F1YA 4D0ZA 1S4NA 3OH2A 4D48A 2YCMA 3I0JA 2A8WA 3R3IA 1V84A 3TZTA 3D8VA 4Y7GA 4KC4A 1QGQA 1QWJA 5CMIA 1VPAA 2ZU8A 4Y62A 1JYKA 2JCJA 1H7GA 5DDTA 2O1GA 5CQNX 3V0LA 5CQPA 5FTSA 4EE5A 3BRKX 3I0DA 1HJJA 1O7OA 2WE9A 4IRPA 4IRQA 2ZU7A 1ZDGA 1HM9A 4LW3A 1NF5B 5IFYA 1HM0A 1ZI4A 1V83A 2OEGA 3PKQA 4G87A 2FYAA 4ZDQA 3ZF8A 1R7YA 3U2VA 2XMEA 1WT1A 2BO7A 4KPZA 2GGOA 3OH0A 4EE4A 4HCQA 2MZBA 3O3PA 4AAWA 5FV9A 3SXEA 1KWSA 2PX7A 2YC3A 1ZJ3A 3CKJA 4HO3A 5CMFX 1ON6A 2V0LA 4D11A 2OEFA 5FU8A 1JVDA 3CGXA 2GGQA 2V0JA 3CKQA 3SX7A 2VS4A 5C47A 3U0XA 4NAIA 1QGSA 2W0WA 1IINA 4JD0A 3SX5A 4HG6A 3PKPA 4FCEA 3V91A 3V0MA 1TW5A 1FO8A 4ASJA 3HL3A 1G3LA 1VGUA 1H7LA 3ST8A 2X65A 5CMHA 2RIXA 1ZJPA 2Q4JA 1W55A 2ICYA 3SPTA 2PGVA 3DUVA 3OGZA 4EEGA 2VXMA 4EEOA 3V0PA 2RJ8A 1R7TA 2RIZA 4XWIA 2D7RA 1HJLA 1LZJA 2YQSA 1OMXA 2D0JA 4M2BA 4Y7VA 1MP3A 4K6RA 4KQLA 1G97A 3GUEA 5EJ1A 3SXGA 3JTJA 3Q7UA 4M28A 4B4BA 1VGWA 3ZLKA 4B2XA 5C4DA 2YESA 1OMZA 1WSZA 3E26A 2YQCA 1H5SC 3JUJA 5CMJA 4G3SA 3ZGGA 4EVWA 4NAKA 3TQDA 1Z90A 1FG5N 1H7QA 2XMHA 3CU0A 5C3BA 2Z86A 1H4DA 1VZUA 1O0RA 1ZI5A 1XHBA 5CQLX 1H5SB 2JCLA 4FREA 3OKRA 2DPWA 4AC3A 4GBPA 5C4BA 1TZFA 5IDTA 1V82A 1GX4A 1VM8A 2V0IA 3IOIA 5C3AA 5C4FA 3D5NA 3U2XA 3I0GA 5FUHA 1FR8A 2APCA 3IOHA 1HV9A 1FGXA 1ZCYA 3SX3A 2W0VA 1NMMB 2CU2A 4HO5A 5FYEA 1H5TB 5I1FA 1ZJOA 1PZTA 1G2VA 1LL0A 4G3PA 1INIA 2O1FA 5C36A 1ZCVA 2V0HA 4FRLA 4HOCA 1FR9A 3I0EA 4Y7FA 1G1LA 2YQHA 2UX8A 4HO9A 3FWWA 2WGZA 1GWWA 4Y7TA 1H7EA 3CKNA 1NHEB 1S4OA 1WT2A 2FFUA 4KT7A 3SXDA 3OH4A 1YP2A 1OQMB 2X5SA 1H5SA 1H4EA 3V0QA 2P6WA 2X5ZA 1MC3A 3I0LA 4KRVA 3RMVA 4CJBA 2WEEA 1NQIB 5EIYA 1FXJA 5C1LA 5C1GA 1NWGB 4E1KA 2E3DA 1R7UA 4NALA 2Z87A 2YC5A 2RJ1A 4MNDA 2VS5A 5HS2A 1FZWA 2VSIA 1G8OA 3NGWA 5C1HA 3OH1A 3CKVA 1H5TA 3ZGFA 2VSHA 2JCOA 5CQOA 1R82A 1INJA 2I5KA 4B4MA 2RIYA 3T7NA 2QH5A 3U2UA 1FRWA 3SXBA 2Y4JA 5AJPA 4D0TA 4M4KA 4DDZA 1FWYA 2Y4MA 2FY7A 2I7BA 3I0IX 2AESA 3KIAA 1ZI1A 2QGIA 4B3UA 3SXAA 4Y6NA 1GA8A 1LL2A 1H7TA 2Y7AA 3FOQA 1H7FA 4YS8A 1LZ7A 5IDSA 3I0KA 3SXCA 5C3DA 1YP4A 4KC2A 4B2WA 4BMAA 4FRMA 2Y4KA 1YP3A 1QG8A 1MP4A 1ZCUA 5EJZA 4B42A 3DJ4A 4ARWA 1R81A 1YROB 3V0NA 2QKXA 2FFVA 5CMGX 3T7MA 2RJ6A 5L6VA 2WVMA 3RMWA 2WVLA 3Q80A 1EZIA 4FRPA 1G0RA 2VS3A 4ASYA 1H5RB 1FOAA 1IIMA 2AM3A 1ZI3A 3U2WA 5C48A 2A8UA 1VZXA 3POLA 3USQA 5AJOA 5FU0A 1XZ6A 2RITA 3N9WA 2I5EA 3D98A 3PNNA 4FRDA 3OC9A 2AH9A 2NXVA 4P02A 3V8ZA 1O7QA 1WT3A 2AGDA 1LVWA 1R80A 3I0FA 1MP5A 1I52A 3K8EA 4AYJA 4FRAA 2XWNA 2FYCB 2FYDB 2V0KA 2RJ4A 3OAMA 2OI5A 2WAWA 1NKHB 2AE7A 2X60A 1E5KA 2ZU9A 3USRA 1VICA 2O1HA 4KPXA 3IOJA 4L41C 4P00A 4UEGA 1H5RA 3EE5A 1W77A 5AJNA 1ZCTA 1G93A 4Y63A 2ICXA 2WVKA 3K8DA 2P73A 2YQJA 3I0HA 4MYBA 4Y7UA 2BO6A 1TVYA 4KNRA 1FO9A 2VXLA 4J18A 5C8RA 1JV1A 3V0OA 2BO8A 1ZDFA 4ECMA 1TW1A 4KNXA 1EYRA 1GQCA 3JUKA 3U0YA 2FYBA 1ON8A 5C49A 5BXCA 4KC1A 1R7VA 1VH1A 4NANA 5FTVA 1G9RA 2AM5A 3BCVA 4B4GA 5C4CA 1VH3A 5CQMX 2OI7A 1GX0A 3QVBA 1H4CA 5DDVA 4B5BA 2AM4A 1LZIA 1VZTA 3I0CA 4Y9XA 1JYLA 5L6SA 2OI6A 2RJ5A 5JQQA 2RJ0A 2BO4A 1S4PA 4EEAA 5C4EA 3ZLLA 2RJ9A 1FGGA 4FQWA 1H7HA 1ZJ1A 4Y6UA 3V8YA 2XWMA 3OH3A 2VD4A 1GWVA 4FRQA 1ZJ0A 1SS9A 3CKOA 4M2AA 1ZHJA 3SX8A 1PZYB 1W57A 3U2TA 4CVHA 4HO0A 1ZJ2A 5C38A 1JVGA 5J49A 4DECA 4EEMA 3E25A 1G23A 2RJ7A 4FCUA 2JCKA 2PA4A 3Q4SA 4CJCA 1K4VA 1JV3A 2P72A 4HO4A 1WT0A 4R7PA 2AECA 1LZ0A 3DK5A 3RSBA 4HO8A 4EE3A 1VGZA 4FRHA 4HO6A 4BQHA 3F1CA 1O23B 4G3QA 2VFZA 2E8BA 2D7IA 4FROA 2Y4LA 4JISA 4KXOA 3LW6A 3R2WA 1VGTA 4AYLA
chains in the Genus database with same CATH superfamily
1G95A 1GQ9A 4CJ8A 3T7OA 1LL3A 1HM8A 4FRBA 1FXOA 1WVCA 2Y6PA 4LW6A 4C2SA 4Y64A 3V90A 1ZIZA 1R7XA 2XWLA 1H5SD 4D11C 2PGYA 1H3MA 4HO2A 4DE7A 3F1YA 4D0ZA 1S4NA 3OH2A 4D48A 2YCMA 3I0JA 2A8WA 3R3IA 1V84A 3TZTA 3D8VA 4Y7GA 4KC4A 1QGQA 1QWJA 5CMIA 1VPAA 5D91A 2ZU8A 4Y62A 1JYKA 2JCJA 1H7GA 5DDTA 2O1GA 5CQNX 3V0LA 5CQPA 5FTSA 4EE5A 3BRKX 3I0DA 1HJJA 1O7OA 2WE9A 4IRPA 4IRQA 2ZU7A 1ZDGA 1HM9A 4LW3A 1NF5B 5IFYA 1HM0A 1ZI4A 1V83A 2OEGA 3PKQA 4G87A 2FYAA 4ZDQA 3ZF8A 1R7YA 3U2VA 2XMEA 1WT1A 2BO7A 4KPZA 2GGOA 3OH0A 4EE4A 4HCQA 2MZBA 3O3PA 4AAWA 5FV9A 3SXEA 1KWSA 2PX7A 2YC3A 1ZJ3A 3CKJA 4HO3A 5CMFX 1ON6A 2V0LA 4D11A 2OEFA 5FU8A 1JVDA 4O6NA 3CGXA 2GGQA 2V0JA 3CKQA 3SX7A 2VS4A 5C47A 3U0XA 4NAIA 1QGSA 2W0WA 1IINA 4JD0A 3SX5A 4HG6A 3PKPA 4FCEA 3V91A 3V0MA 1TW5A 1FO8A 4ASJA 3HL3A 1G3LA 1VGUA 1H7LA 3ST8A 2X65A 5CMHA 2RIXA 1ZJPA 2Q4JA 1W55A 2ICYA 3SPTA 2PGVA 3DUVA 3OGZA 4EEGA 2VXMA 4EEOA 3V0PA 2RJ8A 1R7TA 2RIZA 4XWIA 2D7RA 1HJLA 1LZJA 2YQSA 1OMXA 2D0JA 4M2BA 4Y7VA 1MP3A 4K6RA 4KQLA 2C0NA 1G97A 3GUEA 5EJ1A 3SXGA 3JTJA 3Q7UA 4M28A 4B4BA 1VGWA 4Q7CA 3ZLKA 4B2XA 5C4DA 2YESA 1OMZA 1WSZA 3E26A 2YQCA 1H5SC 3JUJA 5CMJA 4G3SA 3ZGGA 4EVWA 4NAKA 3TQDA 1Z90A 1FG5N 1H7QA 2XMHA 3CU0A 5C3BA 2Z86A 1H4DA 1VZUA 1O0RA 1ZI5A 1XHBA 5CQLX 1H5SB 2JCLA 4FREA 3OKRA 2DPWA 2VK9A 4AC3A 4GBPA 5C4BA 1TZFA 5IDTA 1V82A 1GX4A 1VM8A 2V0IA 3IOIA 5C3AA 5C4FA 3D5NA 3U2XA 3I0GA 5FUHA 1FR8A 2APCA 3IOHA 1HV9A 1FGXA 1ZCYA 3SX3A 2W0VA 1NMMB 2CU2A 4HO5A 5FYEA 1H5TB 5I1FA 1ZJOA 1PZTA 1G2VA 1LL0A 4G3PA 1INIA 2O1FA 5C36A 1ZCVA 2V0HA 4FRLA 4HOCA 1FR9A 3I0EA 4Y7FA 1G1LA 2YQHA 2UX8A 4HO9A 3FWWA 2WGZA 1GWWA 4Y7TA 1H7EA 3CKNA 1NHEB 1S4OA 1WT2A 2FFUA 4KT7A 3SXDA 3OH4A 1YP2A 1OQMB 2X5SA 1H5SA 1H4EA 3V0QA 2P6WA 2X5ZA 1MC3A 3I0LA 4KRVA 3RMVA 4CJBA 2J0BA 2WEEA 1NQIB 5EIYA 1FXJA 5C1LA 5C1GA 1NWGB 4E1KA 2E3DA 1R7UA 4NALA 2Z87A 2YC5A 2RJ1A 4MNDA 2VS5A 5HS2A 1FZWA 2VSIA 1G8OA 3NGWA 5C1HA 3OH1A 3CKVA 1H5TA 3ZGFA 2VSHA 2JCOA 5CQOA 1R82A 1INJA 2I5KA 4B4MA 2RIYA 3T7NA 2QH5A 3U2UA 1FRWA 3SXBA 2Y4JA 5AJPA 4D0TA 4M4KA 4DDZA 1FWYA 2Y4MA 2FY7A 2I7BA 3I0IX 2AESA 3KIAA 1ZI1A 2QGIA 4B3UA 3SXAA 4Y6NA 1GA8A 1LL2A 1H7TA 2Y7AA 3FOQA 1H7FA 4YS8A 1LZ7A 5IDSA 3I0KA 3SXCA 5C3DA 1YP4A 4KC2A 4B2WA 4BMAA 4FRMA 2Y4KA 1YP3A 1QG8A 1MP4A 1ZCUA 5EJZA 4B42A 3DJ4A 4ARWA 1R81A 1YROB 3V0NA 2QKXA 2FFVA 5CMGX 3T7MA 2RJ6A 5L6VA 2WVMA 3RMWA 2WVLA 3Q80A 1EZIA 4FRPA 1G0RA 2VS3A 4ASYA 1H5RB 1FOAA 1IIMA 2AM3A 1ZI3A 3U2WA 5C48A 2A8UA 1VZXA 3POLA 3USQA 5AJOA 5FU0A 1XZ6A 2RITA 3N9WA 2I5EA 3D98A 3PNNA 4FRDA 3OC9A 2AH9A 2NXVA 4P02A 3V8ZA 1O7QA 1WT3A 2AGDA 1LVWA 1R80A 3I0FA 1MP5A 1I52A 3K8EA 4AYJA 4FRAA 2XWNA 2FYCB 2FYDB 2V0KA 2RJ4A 3OAMA 2OI5A 2WAWA 1NKHB 2AE7A 2X60A 1E5KA 2ZU9A 3USRA 1VICA 2O1HA 4KPXA 3IOJA 4L41C 4P00A 4UEGA 1H5RA 3EE5A 1W77A 5AJNA 1ZCTA 1G93A 4Y63A 2ICXA 4FIYA 2J0AA 4MIXA 2WVKA 3K8DA 2P73A 2YQJA 3I0HA 4MYBA 4Y7UA 2BO6A 1TVYA 4KNRA 1FO9A 2VXLA 4J18A 5C8RA 1JV1A 3V0OA 2BO8A 1ZDFA 4ECMA 1TW1A 4KNXA 1EYRA 1GQCA 3JUKA 4O6MA 3U0YA 2FYBA 1ON8A 5C49A 5BXCA 4KC1A 1R7VA 1VH1A 4NANA 5FTVA 1G9RA 2AM5A 3BCVA 4B4GA 5C4CA 1VH3A 5CQMX 2OI7A 1GX0A 3QVBA 1H4CA 5DDVA 4B5BA 2AM4A 1LZIA 1VZTA 3I0CA 4Y9XA 1JYLA 5L6SA 2OI6A 2RJ5A 5JQQA 2RJ0A 2BO4A 1S4PA 4EEAA 5C4EA 3ZLLA 2RJ9A 5D92A 1FGGA 4FQWA 1H7HA 1ZJ1A 4Y6UA 3V8YA 2XWMA 3OH3A 2VD4A 1GWVA 4FRQA 1ZJ0A 1SS9A 3CKOA 4M2AA 1ZHJA 3SX8A 1PZYB 1W57A 3U2TA 4CVHA 4HO0A 1ZJ2A 5C38A 1JVGA 5J49A 4DECA 4EEMA 3E25A 1G23A 2RJ7A 4FCUA 2JCKA 2PA4A 3Q4SA 4FIXA 4CJCA 1K4VA 1JV3A 2P72A 4HO4A 1WT0A 4R7PA 2AECA 1LZ0A 3DK5A 3RSBA 4HO8A 4EE3A 1VGZA 4FRHA 4HO6A 4BQHA 3F1CA 1O23B 4G3QA 2VFZA 2E8BA 2D7IA 4FROA 2Y4LA 4JISA 4KXOA 3LW6A 3R2WA 1VGTA 4AYLA
chains in the Genus database with same CATH topology
1G95A 1GQ9A 4CJ8A 3T7OA 1LL3A 1HM8A 4FRBA 1FXOA 1WVCA 2Y6PA 4LW6A 4C2SA 4Y64A 3V90A 1ZIZA 1R7XA 2XWLA 1H5SD 4D11C 2PGYA 1H3MA 4HO2A 4DE7A 3F1YA 4D0ZA 1S4NA 3OH2A 4D48A 2YCMA 3I0JA 2A8WA 3R3IA 1V84A 3TZTA 3D8VA 4Y7GA 4KC4A 1QGQA 1QWJA 5CMIA 1VPAA 5D91A 2ZU8A 4Y62A 1JYKA 2JCJA 1H7GA 5DDTA 2O1GA 5CQNX 3V0LA 5CQPA 5FTSA 4EE5A 3BRKX 3I0DA 1HJJA 1O7OA 2WE9A 4IRPA 4IRQA 2ZU7A 1ZDGA 1HM9A 4LW3A 1NF5B 5IFYA 1HM0A 1ZI4A 1V83A 2OEGA 3PKQA 4G87A 2FYAA 4ZDQA 3ZF8A 1R7YA 3U2VA 2XMEA 1WT1A 2BO7A 4KPZA 2GGOA 3OH0A 4EE4A 4HCQA 2MZBA 3O3PA 4AAWA 5FV9A 3SXEA 1KWSA 2PX7A 2YC3A 1ZJ3A 3CKJA 4HO3A 5CMFX 1ON6A 2V0LA 4D11A 2OEFA 5FU8A 1JVDA 4O6NA 3CGXA 2GGQA 2V0JA 3CKQA 3SX7A 2VS4A 5C47A 3U0XA 4NAIA 1QGSA 2W0WA 1IINA 4JD0A 3SX5A 4HG6A 3PKPA 4FCEA 3V91A 3V0MA 1TW5A 1FO8A 4ASJA 3HL3A 1G3LA 1VGUA 1H7LA 3ST8A 2X65A 5CMHA 2RIXA 1ZJPA 2Q4JA 1W55A 2ICYA 3SPTA 2PGVA 3DUVA 3OGZA 4EEGA 2VXMA 4EEOA 3V0PA 2RJ8A 1R7TA 2RIZA 4XWIA 2D7RA 1HJLA 1LZJA 2YQSA 1OMXA 2D0JA 4M2BA 4Y7VA 1MP3A 4K6RA 4KQLA 2C0NA 1G97A 3GUEA 5EJ1A 3SXGA 3JTJA 3Q7UA 4M28A 4B4BA 1VGWA 4Q7CA 3ZLKA 4B2XA 5C4DA 2YESA 1OMZA 1WSZA 3E26A 2YQCA 1H5SC 3JUJA 5CMJA 4G3SA 3ZGGA 4EVWA 4NAKA 3TQDA 1Z90A 1FG5N 1H7QA 2XMHA 3CU0A 5C3BA 2Z86A 1H4DA 1VZUA 1O0RA 1ZI5A 1XHBA 5CQLX 1H5SB 2JCLA 4FREA 3OKRA 2DPWA 2VK9A 4AC3A 4GBPA 5C4BA 1TZFA 5IDTA 1V82A 1GX4A 1VM8A 2V0IA 3IOIA 5C3AA 5C4FA 3D5NA 3U2XA 3I0GA 5FUHA 1FR8A 2APCA 3IOHA 1HV9A 1FGXA 1ZCYA 3SX3A 2W0VA 1NMMB 2CU2A 4HO5A 5FYEA 1H5TB 5I1FA 1ZJOA 1PZTA 1G2VA 1LL0A 4G3PA 1INIA 2O1FA 5C36A 1ZCVA 2V0HA 4FRLA 4HOCA 1FR9A 3I0EA 4Y7FA 1G1LA 2YQHA 2UX8A 4HO9A 3FWWA 2WGZA 1GWWA 4Y7TA 1H7EA 3CKNA 1NHEB 1S4OA 1WT2A 2FFUA 4KT7A 3SXDA 3OH4A 1YP2A 1OQMB 2X5SA 1H5SA 1H4EA 3V0QA 2P6WA 2X5ZA 1MC3A 3I0LA 4KRVA 3RMVA 4CJBA 2J0BA 2WEEA 1NQIB 5EIYA 1FXJA 5C1LA 5C1GA 1NWGB 4E1KA 2E3DA 1R7UA 4NALA 2Z87A 2YC5A 2RJ1A 4MNDA 2VS5A 5HS2A 1FZWA 2VSIA 1G8OA 3NGWA 5C1HA 3OH1A 3CKVA 1H5TA 3ZGFA 2VSHA 2JCOA 5CQOA 1R82A 1INJA 2I5KA 4B4MA 2RIYA 3T7NA 2QH5A 3U2UA 1FRWA 3SXBA 2Y4JA 5AJPA 4D0TA 4M4KA 4DDZA 1FWYA 2Y4MA 2FY7A 2I7BA 3I0IX 2AESA 3KIAA 1ZI1A 2QGIA 4B3UA 3SXAA 4Y6NA 1GA8A 1LL2A 1H7TA 2Y7AA 3FOQA 1H7FA 4YS8A 1LZ7A 5IDSA 3I0KA 3SXCA 5C3DA 1YP4A 4KC2A 4B2WA 4BMAA 4FRMA 2Y4KA 1YP3A 1QG8A 1MP4A 1ZCUA 5EJZA 4B42A 3DJ4A 4ARWA 1R81A 1YROB 3V0NA 2QKXA 2FFVA 5CMGX 3T7MA 2RJ6A 5L6VA 2WVMA 3RMWA 2WVLA 3Q80A 1EZIA 4FRPA 1G0RA 2VS3A 4ASYA 1H5RB 1FOAA 1IIMA 2AM3A 1ZI3A 3U2WA 5C48A 2A8UA 1VZXA 3POLA 3USQA 5AJOA 5FU0A 1XZ6A 2RITA 3N9WA 2I5EA 3D98A 3PNNA 4FRDA 3OC9A 2AH9A 2NXVA 4P02A 3V8ZA 1O7QA 1WT3A 2AGDA 1LVWA 1R80A 3I0FA 1MP5A 1I52A 3K8EA 4AYJA 4FRAA 2XWNA 2FYCB 2FYDB 2V0KA 2RJ4A 3OAMA 2OI5A 2WAWA 1NKHB 2AE7A 2X60A 1E5KA 2ZU9A 3USRA 1VICA 2O1HA 4KPXA 3IOJA 4L41C 4P00A 4UEGA 1H5RA 3EE5A 1W77A 5AJNA 1ZCTA 1G93A 4Y63A 2ICXA 4FIYA 2J0AA 4MIXA 2WVKA 3K8DA 2P73A 2YQJA 3I0HA 4MYBA 4Y7UA 2BO6A 1TVYA 4KNRA 1FO9A 2VXLA 4J18A 5C8RA 1JV1A 3V0OA 2BO8A 1ZDFA 4ECMA 1TW1A 4KNXA 1EYRA 1GQCA 3JUKA 4O6MA 3U0YA 2FYBA 1ON8A 5C49A 5BXCA 4KC1A 1R7VA 1VH1A 4NANA 5FTVA 1G9RA 2AM5A 3BCVA 4B4GA 5C4CA 1VH3A 5CQMX 2OI7A 1GX0A 3QVBA 1H4CA 5DDVA 4B5BA 2AM4A 1LZIA 1VZTA 3I0CA 4Y9XA 1JYLA 5L6SA 2OI6A 2RJ5A 5JQQA 2RJ0A 2BO4A 1S4PA 4EEAA 5C4EA 3ZLLA 2RJ9A 5D92A 1FGGA 4FQWA 1H7HA 1ZJ1A 4Y6UA 3V8YA 2XWMA 3OH3A 2VD4A 1GWVA 4FRQA 1ZJ0A 1SS9A 3CKOA 4M2AA 1ZHJA 3SX8A 1PZYB 1W57A 3U2TA 4CVHA 4HO0A 1ZJ2A 5C38A 1JVGA 5J49A 4DECA 4EEMA 3E25A 1G23A 2RJ7A 4FCUA 2JCKA 2PA4A 3Q4SA 4FIXA 4CJCA 1K4VA 1JV3A 2P72A 4HO4A 1WT0A 4R7PA 2AECA 1LZ0A 3DK5A 3RSBA 4HO8A 4EE3A 1VGZA 4FRHA 4HO6A 4BQHA 3F1CA 1O23B 4G3QA 2VFZA 2E8BA 2D7IA 4FROA 2Y4LA 4JISA 4KXOA 3LW6A 3R2WA 1VGTA 4AYLA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1G95 A;  1GQ9 A;  4CJ8 A;  3T7O A;  1LL3 A;  1HM8 A;  4FRB A;  1FXO A;  1WVC A;  2Y6P A;  4LW6 A;  4C2S A;  4Y64 A;  3V90 A;  1ZIZ A;  1R7X A;  2XWL A;  1H5S D;  4D11 C;  2PGY A;  1H3M A;  4HO2 A;  4DE7 A;  3F1Y A;  4D0Z A;  1S4N A;  3OH2 A;  4D48 A;  2YCM A;  3I0J A;  2A8W A;  3R3I A;  1V84 A;  3TZT A;  3D8V A;  4Y7G A;  4KC4 A;  1QGQ A;  1QWJ A;  5CMI A;  1VPA A;  2ZU8 A;  4Y62 A;  1JYK A;  2JCJ A;  1H7G A;  5DDT A;  2O1G A;  5CQN X;  3V0L A;  5CQP A;  5FTS A;  4EE5 A;  3BRK X;  3I0D A;  1HJJ A;  1O7O A;  2WE9 A;  4IRP A;  4IRQ A;  2ZU7 A;  1ZDG A;  1HM9 A;  4LW3 A;  1NF5 B;  5IFY A;  1HM0 A;  1ZI4 A;  1V83 A;  2OEG A;  3PKQ A;  4G87 A;  2FYA A;  4ZDQ A;  3ZF8 A;  1R7Y A;  3U2V A;  2XME A;  1WT1 A;  2BO7 A;  4KPZ A;  2GGO A;  3OH0 A;  4EE4 A;  4HCQ A;  2MZB A;  3O3P A;  4AAW A;  5FV9 A;  3SXE A;  1KWS A;  2PX7 A;  2YC3 A;  1ZJ3 A;  3CKJ A;  4HO3 A;  5CMF X;  1ON6 A;  2V0L A;  4D11 A;  2OEF A;  5FU8 A;  1JVD A;  3CGX A;  2GGQ A;  2V0J A;  3CKQ A;  3SX7 A;  2VS4 A;  5C47 A;  3U0X A;  4NAI A;  1QGS A;  2W0W A;  1IIN A;  4JD0 A;  3SX5 A;  4HG6 A;  3PKP A;  4FCE A;  3V91 A;  3V0M A;  1TW5 A;  1FO8 A;  4ASJ A;  3HL3 A;  1G3L A;  1VGU A;  1H7L A;  3ST8 A;  2X65 A;  5CMH A;  2RIX A;  1ZJP A;  2Q4J A;  1W55 A;  2ICY A;  3SPT A;  2PGV A;  3DUV A;  3OGZ A;  4EEG A;  2VXM A;  4EEO A;  3V0P A;  2RJ8 A;  1R7T A;  2RIZ A;  4XWI A;  2D7R A;  1HJL A;  1LZJ A;  2YQS A;  1OMX A;  2D0J A;  4M2B A;  4Y7V A;  1MP3 A;  4K6R A;  4KQL A;  1G97 A;  3GUE A;  5EJ1 A;  3SXG A;  3JTJ A;  3Q7U A;  4M28 A;  4B4B A;  1VGW A;  3ZLK A;  4B2X A;  5C4D A;  2YES A;  1OMZ A;  1WSZ A;  3E26 A;  2YQC A;  1H5S C;  3JUJ A;  5CMJ A;  4G3S A;  3ZGG A;  4EVW A;  4NAK A;  3TQD A;  1Z90 A;  1FG5 N;  1H7Q A;  2XMH A;  3CU0 A;  5C3B A;  2Z86 A;  1H4D A;  1VZU A;  1O0R A;  1ZI5 A;  1XHB A;  5CQL X;  1H5S B;  2JCL A;  4FRE A;  3OKR A;  2DPW A;  4AC3 A;  4GBP A;  5C4B A;  1TZF A;  5IDT A;  1V82 A;  1GX4 A;  1VM8 A;  2V0I A;  3IOI A;  5C3A A;  5C4F A;  3D5N A;  3U2X A;  3I0G A;  5FUH A;  1FR8 A;  2APC A;  3IOH A;  1HV9 A;  1FGX A;  1ZCY A;  3SX3 A;  2W0V A;  1NMM B;  2CU2 A;  4HO5 A;  5FYE A;  1H5T B;  5I1F A;  1ZJO A;  1PZT A;  1G2V A;  1LL0 A;  4G3P A;  1INI A;  2O1F A;  5C36 A;  1ZCV A;  2V0H A;  4FRL A;  4HOC A;  1FR9 A;  3I0E A;  4Y7F A;  1G1L A;  2YQH A;  2UX8 A;  4HO9 A;  3FWW A;  2WGZ A;  1GWW A;  4Y7T A;  1H7E A;  3CKN A;  1NHE B;  1S4O A;  1WT2 A;  2FFU A;  4KT7 A;  3SXD A;  3OH4 A;  1YP2 A;  1OQM B;  2X5S A;  1H5S A;  1H4E A;  3V0Q A;  2P6W A;  2X5Z A;  1MC3 A;  3I0L A;  4KRV A;  3RMV A;  4CJB A;  2WEE A;  1NQI B;  5EIY A;  1FXJ A;  5C1L A;  5C1G A;  1NWG B;  4E1K A;  2E3D A;  1R7U A;  4NAL A;  2Z87 A;  2YC5 A;  2RJ1 A;  4MND A;  2VS5 A;  5HS2 A;  1FZW A;  2VSI A;  1G8O A;  3NGW A;  5C1H A;  3OH1 A;  3CKV A;  1H5T A;  3ZGF A;  2VSH A;  2JCO A;  5CQO A;  1R82 A;  1INJ A;  2I5K A;  4B4M A;  2RIY A;  3T7N A;  2QH5 A;  3U2U A;  1FRW A;  3SXB A;  2Y4J A;  5AJP A;  4D0T A;  4M4K A;  4DDZ A;  1FWY A;  2Y4M A;  2FY7 A;  2I7B A;  3I0I X;  2AES A;  3KIA A;  1ZI1 A;  2QGI A;  4B3U A;  3SXA A;  4Y6N A;  1GA8 A;  1LL2 A;  1H7T A;  2Y7A A;  3FOQ A;  1H7F A;  4YS8 A;  1LZ7 A;  5IDS A;  3I0K A;  3SXC A;  5C3D A;  1YP4 A;  4KC2 A;  4B2W A;  4BMA A;  4FRM A;  2Y4K A;  1YP3 A;  1QG8 A;  1MP4 A;  1ZCU A;  5EJZ A;  4B42 A;  3DJ4 A;  4ARW A;  1R81 A;  1YRO B;  3V0N A;  2QKX A;  2FFV A;  5CMG X;  3T7M A;  2RJ6 A;  5L6V A;  2WVM A;  3RMW A;  2WVL A;  3Q80 A;  1EZI A;  4FRP A;  1G0R A;  2VS3 A;  4ASY A;  1H5R B;  1FOA A;  1IIM A;  2AM3 A;  1ZI3 A;  3U2W A;  5C48 A;  2A8U A;  1VZX A;  3POL A;  3USQ A;  5AJO A;  5FU0 A;  1XZ6 A;  2RIT A;  3N9W A;  2I5E A;  3D98 A;  3PNN A;  4FRD A;  3OC9 A;  2AH9 A;  2NXV A;  4P02 A;  3V8Z A;  1O7Q A;  1WT3 A;  2AGD A;  1LVW A;  1R80 A;  3I0F A;  1MP5 A;  1I52 A;  3K8E A;  4AYJ A;  4FRA A;  2XWN A;  2FYC B;  2FYD B;  2V0K A;  2RJ4 A;  3OAM A;  2OI5 A;  2WAW A;  1NKH B;  2AE7 A;  2X60 A;  1E5K A;  2ZU9 A;  3USR A;  1VIC A;  2O1H A;  4KPX A;  3IOJ A;  4L41 C;  4P00 A;  4UEG A;  1H5R A;  3EE5 A;  1W77 A;  5AJN A;  1ZCT A;  1G93 A;  4Y63 A;  2ICX A;  2WVK A;  3K8D A;  2P73 A;  2YQJ A;  3I0H A;  4MYB A;  4Y7U A;  2BO6 A;  1TVY A;  4KNR A;  1FO9 A;  2VXL A;  4J18 A;  5C8R A;  1JV1 A;  3V0O A;  2BO8 A;  1ZDF A;  4ECM A;  1TW1 A;  4KNX A;  1EYR A;  1GQC A;  3JUK A;  3U0Y A;  2FYB A;  1ON8 A;  5C49 A;  5BXC A;  4KC1 A;  1R7V A;  1VH1 A;  4NAN A;  5FTV A;  1G9R A;  2AM5 A;  3BCV A;  4B4G A;  5C4C A;  1VH3 A;  5CQM X;  2OI7 A;  1GX0 A;  3QVB A;  1H4C A;  5DDV A;  4B5B A;  2AM4 A;  1LZI A;  1VZT A;  3I0C A;  4Y9X A;  1JYL A;  5L6S A;  2OI6 A;  2RJ5 A;  5JQQ A;  2RJ0 A;  2BO4 A;  1S4P A;  4EEA A;  5C4E A;  3ZLL A;  2RJ9 A;  1FGG A;  4FQW A;  1H7H A;  1ZJ1 A;  4Y6U A;  3V8Y A;  2XWM A;  3OH3 A;  2VD4 A;  1GWV A;  4FRQ A;  1ZJ0 A;  1SS9 A;  3CKO A;  4M2A A;  1ZHJ A;  3SX8 A;  1PZY B;  1W57 A;  3U2T A;  4CVH A;  4HO0 A;  1ZJ2 A;  5C38 A;  1JVG A;  5J49 A;  4DEC A;  4EEM A;  3E25 A;  1G23 A;  2RJ7 A;  4FCU A;  2JCK A;  2PA4 A;  3Q4S A;  4CJC A;  1K4V A;  1JV3 A;  2P72 A;  4HO4 A;  1WT0 A;  4R7P A;  2AEC A;  1LZ0 A;  3DK5 A;  3RSB A;  4HO8 A;  4EE3 A;  1VGZ A;  4FRH A;  4HO6 A;  4BQH A;  3F1C A;  1O23 B;  4G3Q A;  2VFZ A;  2E8B A;  2D7I A;  4FRO A;  2Y4L A;  4JIS A;  4KXO A;  3LW6 A;  3R2W A;  1VGT A;  4AYL A; 
#chains in the Genus database with same CATH topology
 1G95 A;  1GQ9 A;  4CJ8 A;  3T7O A;  1LL3 A;  1HM8 A;  4FRB A;  1FXO A;  1WVC A;  2Y6P A;  4LW6 A;  4C2S A;  4Y64 A;  3V90 A;  1ZIZ A;  1R7X A;  2XWL A;  1H5S D;  4D11 C;  2PGY A;  1H3M A;  4HO2 A;  4DE7 A;  3F1Y A;  4D0Z A;  1S4N A;  3OH2 A;  4D48 A;  2YCM A;  3I0J A;  2A8W A;  3R3I A;  1V84 A;  3TZT A;  3D8V A;  4Y7G A;  4KC4 A;  1QGQ A;  1QWJ A;  5CMI A;  1VPA A;  5D91 A;  2ZU8 A;  4Y62 A;  1JYK A;  2JCJ A;  1H7G A;  5DDT A;  2O1G A;  5CQN X;  3V0L A;  5CQP A;  5FTS A;  4EE5 A;  3BRK X;  3I0D A;  1HJJ A;  1O7O A;  2WE9 A;  4IRP A;  4IRQ A;  2ZU7 A;  1ZDG A;  1HM9 A;  4LW3 A;  1NF5 B;  5IFY A;  1HM0 A;  1ZI4 A;  1V83 A;  2OEG A;  3PKQ A;  4G87 A;  2FYA A;  4ZDQ A;  3ZF8 A;  1R7Y A;  3U2V A;  2XME A;  1WT1 A;  2BO7 A;  4KPZ A;  2GGO A;  3OH0 A;  4EE4 A;  4HCQ A;  2MZB A;  3O3P A;  4AAW A;  5FV9 A;  3SXE A;  1KWS A;  2PX7 A;  2YC3 A;  1ZJ3 A;  3CKJ A;  4HO3 A;  5CMF X;  1ON6 A;  2V0L A;  4D11 A;  2OEF A;  5FU8 A;  1JVD A;  4O6N A;  3CGX A;  2GGQ A;  2V0J A;  3CKQ A;  3SX7 A;  2VS4 A;  5C47 A;  3U0X A;  4NAI A;  1QGS A;  2W0W A;  1IIN A;  4JD0 A;  3SX5 A;  4HG6 A;  3PKP A;  4FCE A;  3V91 A;  3V0M A;  1TW5 A;  1FO8 A;  4ASJ A;  3HL3 A;  1G3L A;  1VGU A;  1H7L A;  3ST8 A;  2X65 A;  5CMH A;  2RIX A;  1ZJP A;  2Q4J A;  1W55 A;  2ICY A;  3SPT A;  2PGV A;  3DUV A;  3OGZ A;  4EEG A;  2VXM A;  4EEO A;  3V0P A;  2RJ8 A;  1R7T A;  2RIZ A;  4XWI A;  2D7R A;  1HJL A;  1LZJ A;  2YQS A;  1OMX A;  2D0J A;  4M2B A;  4Y7V A;  1MP3 A;  4K6R A;  4KQL A;  2C0N A;  1G97 A;  3GUE A;  5EJ1 A;  3SXG A;  3JTJ A;  3Q7U A;  4M28 A;  4B4B A;  1VGW A;  4Q7C A;  3ZLK A;  4B2X A;  5C4D A;  2YES A;  1OMZ A;  1WSZ A;  3E26 A;  2YQC A;  1H5S C;  3JUJ A;  5CMJ A;  4G3S A;  3ZGG A;  4EVW A;  4NAK A;  3TQD A;  1Z90 A;  1FG5 N;  1H7Q A;  2XMH A;  3CU0 A;  5C3B A;  2Z86 A;  1H4D A;  1VZU A;  1O0R A;  1ZI5 A;  1XHB A;  5CQL X;  1H5S B;  2JCL A;  4FRE A;  3OKR A;  2DPW A;  2VK9 A;  4AC3 A;  4GBP A;  5C4B A;  1TZF A;  5IDT A;  1V82 A;  1GX4 A;  1VM8 A;  2V0I A;  3IOI A;  5C3A A;  5C4F A;  3D5N A;  3U2X A;  3I0G A;  5FUH A;  1FR8 A;  2APC A;  3IOH A;  1HV9 A;  1FGX A;  1ZCY A;  3SX3 A;  2W0V A;  1NMM B;  2CU2 A;  4HO5 A;  5FYE A;  1H5T B;  5I1F A;  1ZJO A;  1PZT A;  1G2V A;  1LL0 A;  4G3P A;  1INI A;  2O1F A;  5C36 A;  1ZCV A;  2V0H A;  4FRL A;  4HOC A;  1FR9 A;  3I0E A;  4Y7F A;  1G1L A;  2YQH A;  2UX8 A;  4HO9 A;  3FWW A;  2WGZ A;  1GWW A;  4Y7T A;  1H7E A;  3CKN A;  1NHE B;  1S4O A;  1WT2 A;  2FFU A;  4KT7 A;  3SXD A;  3OH4 A;  1YP2 A;  1OQM B;  2X5S A;  1H5S A;  1H4E A;  3V0Q A;  2P6W A;  2X5Z A;  1MC3 A;  3I0L A;  4KRV A;  3RMV A;  4CJB A;  2J0B A;  2WEE A;  1NQI B;  5EIY A;  1FXJ A;  5C1L A;  5C1G A;  1NWG B;  4E1K A;  2E3D A;  1R7U A;  4NAL A;  2Z87 A;  2YC5 A;  2RJ1 A;  4MND A;  2VS5 A;  5HS2 A;  1FZW A;  2VSI A;  1G8O A;  3NGW A;  5C1H A;  3OH1 A;  3CKV A;  1H5T A;  3ZGF A;  2VSH A;  2JCO A;  5CQO A;  1R82 A;  1INJ A;  2I5K A;  4B4M A;  2RIY A;  3T7N A;  2QH5 A;  3U2U A;  1FRW A;  3SXB A;  2Y4J A;  5AJP A;  4D0T A;  4M4K A;  4DDZ A;  1FWY A;  2Y4M A;  2FY7 A;  2I7B A;  3I0I X;  2AES A;  3KIA A;  1ZI1 A;  2QGI A;  4B3U A;  3SXA A;  4Y6N A;  1GA8 A;  1LL2 A;  1H7T A;  2Y7A A;  3FOQ A;  1H7F A;  4YS8 A;  1LZ7 A;  5IDS A;  3I0K A;  3SXC A;  5C3D A;  1YP4 A;  4KC2 A;  4B2W A;  4BMA A;  4FRM A;  2Y4K A;  1YP3 A;  1QG8 A;  1MP4 A;  1ZCU A;  5EJZ A;  4B42 A;  3DJ4 A;  4ARW A;  1R81 A;  1YRO B;  3V0N A;  2QKX A;  2FFV A;  5CMG X;  3T7M A;  2RJ6 A;  5L6V A;  2WVM A;  3RMW A;  2WVL A;  3Q80 A;  1EZI A;  4FRP A;  1G0R A;  2VS3 A;  4ASY A;  1H5R B;  1FOA A;  1IIM A;  2AM3 A;  1ZI3 A;  3U2W A;  5C48 A;  2A8U A;  1VZX A;  3POL A;  3USQ A;  5AJO A;  5FU0 A;  1XZ6 A;  2RIT A;  3N9W A;  2I5E A;  3D98 A;  3PNN A;  4FRD A;  3OC9 A;  2AH9 A;  2NXV A;  4P02 A;  3V8Z A;  1O7Q A;  1WT3 A;  2AGD A;  1LVW A;  1R80 A;  3I0F A;  1MP5 A;  1I52 A;  3K8E A;  4AYJ A;  4FRA A;  2XWN A;  2FYC B;  2FYD B;  2V0K A;  2RJ4 A;  3OAM A;  2OI5 A;  2WAW A;  1NKH B;  2AE7 A;  2X60 A;  1E5K A;  2ZU9 A;  3USR A;  1VIC A;  2O1H A;  4KPX A;  3IOJ A;  4L41 C;  4P00 A;  4UEG A;  1H5R A;  3EE5 A;  1W77 A;  5AJN A;  1ZCT A;  1G93 A;  4Y63 A;  2ICX A;  4FIY A;  2J0A A;  4MIX A;  2WVK A;  3K8D A;  2P73 A;  2YQJ A;  3I0H A;  4MYB A;  4Y7U A;  2BO6 A;  1TVY A;  4KNR A;  1FO9 A;  2VXL A;  4J18 A;  5C8R A;  1JV1 A;  3V0O A;  2BO8 A;  1ZDF A;  4ECM A;  1TW1 A;  4KNX A;  1EYR A;  1GQC A;  3JUK A;  4O6M A;  3U0Y A;  2FYB A;  1ON8 A;  5C49 A;  5BXC A;  4KC1 A;  1R7V A;  1VH1 A;  4NAN A;  5FTV A;  1G9R A;  2AM5 A;  3BCV A;  4B4G A;  5C4C A;  1VH3 A;  5CQM X;  2OI7 A;  1GX0 A;  3QVB A;  1H4C A;  5DDV A;  4B5B A;  2AM4 A;  1LZI A;  1VZT A;  3I0C A;  4Y9X A;  1JYL A;  5L6S A;  2OI6 A;  2RJ5 A;  5JQQ A;  2RJ0 A;  2BO4 A;  1S4P A;  4EEA A;  5C4E A;  3ZLL A;  2RJ9 A;  5D92 A;  1FGG A;  4FQW A;  1H7H A;  1ZJ1 A;  4Y6U A;  3V8Y A;  2XWM A;  3OH3 A;  2VD4 A;  1GWV A;  4FRQ A;  1ZJ0 A;  1SS9 A;  3CKO A;  4M2A A;  1ZHJ A;  3SX8 A;  1PZY B;  1W57 A;  3U2T A;  4CVH A;  4HO0 A;  1ZJ2 A;  5C38 A;  1JVG A;  5J49 A;  4DEC A;  4EEM A;  3E25 A;  1G23 A;  2RJ7 A;  4FCU A;  2JCK A;  2PA4 A;  3Q4S A;  4FIX A;  4CJC A;  1K4V A;  1JV3 A;  2P72 A;  4HO4 A;  1WT0 A;  4R7P A;  2AEC A;  1LZ0 A;  3DK5 A;  3RSB A;  4HO8 A;  4EE3 A;  1VGZ A;  4FRH A;  4HO6 A;  4BQH A;  3F1C A;  1O23 B;  4G3Q A;  2VFZ A;  2E8B A;  2D7I A;  4FRO A;  2Y4L A;  4JIS A;  4KXO A;  3LW6 A;  3R2W A;  1VGT A;  4AYL A; 
#chains in the Genus database with same CATH homology
 1G95 A;  1GQ9 A;  4CJ8 A;  3T7O A;  1LL3 A;  1HM8 A;  4FRB A;  1FXO A;  1WVC A;  2Y6P A;  4LW6 A;  4C2S A;  4Y64 A;  3V90 A;  1ZIZ A;  1R7X A;  2XWL A;  1H5S D;  4D11 C;  2PGY A;  1H3M A;  4HO2 A;  4DE7 A;  3F1Y A;  4D0Z A;  1S4N A;  3OH2 A;  4D48 A;  2YCM A;  3I0J A;  2A8W A;  3R3I A;  1V84 A;  3TZT A;  3D8V A;  4Y7G A;  4KC4 A;  1QGQ A;  1QWJ A;  5CMI A;  1VPA A;  5D91 A;  2ZU8 A;  4Y62 A;  1JYK A;  2JCJ A;  1H7G A;  5DDT A;  2O1G A;  5CQN X;  3V0L A;  5CQP A;  5FTS A;  4EE5 A;  3BRK X;  3I0D A;  1HJJ A;  1O7O A;  2WE9 A;  4IRP A;  4IRQ A;  2ZU7 A;  1ZDG A;  1HM9 A;  4LW3 A;  1NF5 B;  5IFY A;  1HM0 A;  1ZI4 A;  1V83 A;  2OEG A;  3PKQ A;  4G87 A;  2FYA A;  4ZDQ A;  3ZF8 A;  1R7Y A;  3U2V A;  2XME A;  1WT1 A;  2BO7 A;  4KPZ A;  2GGO A;  3OH0 A;  4EE4 A;  4HCQ A;  2MZB A;  3O3P A;  4AAW A;  5FV9 A;  3SXE A;  1KWS A;  2PX7 A;  2YC3 A;  1ZJ3 A;  3CKJ A;  4HO3 A;  5CMF X;  1ON6 A;  2V0L A;  4D11 A;  2OEF A;  5FU8 A;  1JVD A;  4O6N A;  3CGX A;  2GGQ A;  2V0J A;  3CKQ A;  3SX7 A;  2VS4 A;  5C47 A;  3U0X A;  4NAI A;  1QGS A;  2W0W A;  1IIN A;  4JD0 A;  3SX5 A;  4HG6 A;  3PKP A;  4FCE A;  3V91 A;  3V0M A;  1TW5 A;  1FO8 A;  4ASJ A;  3HL3 A;  1G3L A;  1VGU A;  1H7L A;  3ST8 A;  2X65 A;  5CMH A;  2RIX A;  1ZJP A;  2Q4J A;  1W55 A;  2ICY A;  3SPT A;  2PGV A;  3DUV A;  3OGZ A;  4EEG A;  2VXM A;  4EEO A;  3V0P A;  2RJ8 A;  1R7T A;  2RIZ A;  4XWI A;  2D7R A;  1HJL A;  1LZJ A;  2YQS A;  1OMX A;  2D0J A;  4M2B A;  4Y7V A;  1MP3 A;  4K6R A;  4KQL A;  2C0N A;  1G97 A;  3GUE A;  5EJ1 A;  3SXG A;  3JTJ A;  3Q7U A;  4M28 A;  4B4B A;  1VGW A;  4Q7C A;  3ZLK A;  4B2X A;  5C4D A;  2YES A;  1OMZ A;  1WSZ A;  3E26 A;  2YQC A;  1H5S C;  3JUJ A;  5CMJ A;  4G3S A;  3ZGG A;  4EVW A;  4NAK A;  3TQD A;  1Z90 A;  1FG5 N;  1H7Q A;  2XMH A;  3CU0 A;  5C3B A;  2Z86 A;  1H4D A;  1VZU A;  1O0R A;  1ZI5 A;  1XHB A;  5CQL X;  1H5S B;  2JCL A;  4FRE A;  3OKR A;  2DPW A;  2VK9 A;  4AC3 A;  4GBP A;  5C4B A;  1TZF A;  5IDT A;  1V82 A;  1GX4 A;  1VM8 A;  2V0I A;  3IOI A;  5C3A A;  5C4F A;  3D5N A;  3U2X A;  3I0G A;  5FUH A;  1FR8 A;  2APC A;  3IOH A;  1HV9 A;  1FGX A;  1ZCY A;  3SX3 A;  2W0V A;  1NMM B;  2CU2 A;  4HO5 A;  5FYE A;  1H5T B;  5I1F A;  1ZJO A;  1PZT A;  1G2V A;  1LL0 A;  4G3P A;  1INI A;  2O1F A;  5C36 A;  1ZCV A;  2V0H A;  4FRL A;  4HOC A;  1FR9 A;  3I0E A;  4Y7F A;  1G1L A;  2YQH A;  2UX8 A;  4HO9 A;  3FWW A;  2WGZ A;  1GWW A;  4Y7T A;  1H7E A;  3CKN A;  1NHE B;  1S4O A;  1WT2 A;  2FFU A;  4KT7 A;  3SXD A;  3OH4 A;  1YP2 A;  1OQM B;  2X5S A;  1H5S A;  1H4E A;  3V0Q A;  2P6W A;  2X5Z A;  1MC3 A;  3I0L A;  4KRV A;  3RMV A;  4CJB A;  2J0B A;  2WEE A;  1NQI B;  5EIY A;  1FXJ A;  5C1L A;  5C1G A;  1NWG B;  4E1K A;  2E3D A;  1R7U A;  4NAL A;  2Z87 A;  2YC5 A;  2RJ1 A;  4MND A;  2VS5 A;  5HS2 A;  1FZW A;  2VSI A;  1G8O A;  3NGW A;  5C1H A;  3OH1 A;  3CKV A;  1H5T A;  3ZGF A;  2VSH A;  2JCO A;  5CQO A;  1R82 A;  1INJ A;  2I5K A;  4B4M A;  2RIY A;  3T7N A;  2QH5 A;  3U2U A;  1FRW A;  3SXB A;  2Y4J A;  5AJP A;  4D0T A;  4M4K A;  4DDZ A;  1FWY A;  2Y4M A;  2FY7 A;  2I7B A;  3I0I X;  2AES A;  3KIA A;  1ZI1 A;  2QGI A;  4B3U A;  3SXA A;  4Y6N A;  1GA8 A;  1LL2 A;  1H7T A;  2Y7A A;  3FOQ A;  1H7F A;  4YS8 A;  1LZ7 A;  5IDS A;  3I0K A;  3SXC A;  5C3D A;  1YP4 A;  4KC2 A;  4B2W A;  4BMA A;  4FRM A;  2Y4K A;  1YP3 A;  1QG8 A;  1MP4 A;  1ZCU A;  5EJZ A;  4B42 A;  3DJ4 A;  4ARW A;  1R81 A;  1YRO B;  3V0N A;  2QKX A;  2FFV A;  5CMG X;  3T7M A;  2RJ6 A;  5L6V A;  2WVM A;  3RMW A;  2WVL A;  3Q80 A;  1EZI A;  4FRP A;  1G0R A;  2VS3 A;  4ASY A;  1H5R B;  1FOA A;  1IIM A;  2AM3 A;  1ZI3 A;  3U2W A;  5C48 A;  2A8U A;  1VZX A;  3POL A;  3USQ A;  5AJO A;  5FU0 A;  1XZ6 A;  2RIT A;  3N9W A;  2I5E A;  3D98 A;  3PNN A;  4FRD A;  3OC9 A;  2AH9 A;  2NXV A;  4P02 A;  3V8Z A;  1O7Q A;  1WT3 A;  2AGD A;  1LVW A;  1R80 A;  3I0F A;  1MP5 A;  1I52 A;  3K8E A;  4AYJ A;  4FRA A;  2XWN A;  2FYC B;  2FYD B;  2V0K A;  2RJ4 A;  3OAM A;  2OI5 A;  2WAW A;  1NKH B;  2AE7 A;  2X60 A;  1E5K A;  2ZU9 A;  3USR A;  1VIC A;  2O1H A;  4KPX A;  3IOJ A;  4L41 C;  4P00 A;  4UEG A;  1H5R A;  3EE5 A;  1W77 A;  5AJN A;  1ZCT A;  1G93 A;  4Y63 A;  2ICX A;  4FIY A;  2J0A A;  4MIX A;  2WVK A;  3K8D A;  2P73 A;  2YQJ A;  3I0H A;  4MYB A;  4Y7U A;  2BO6 A;  1TVY A;  4KNR A;  1FO9 A;  2VXL A;  4J18 A;  5C8R A;  1JV1 A;  3V0O A;  2BO8 A;  1ZDF A;  4ECM A;  1TW1 A;  4KNX A;  1EYR A;  1GQC A;  3JUK A;  4O6M A;  3U0Y A;  2FYB A;  1ON8 A;  5C49 A;  5BXC A;  4KC1 A;  1R7V A;  1VH1 A;  4NAN A;  5FTV A;  1G9R A;  2AM5 A;  3BCV A;  4B4G A;  5C4C A;  1VH3 A;  5CQM X;  2OI7 A;  1GX0 A;  3QVB A;  1H4C A;  5DDV A;  4B5B A;  2AM4 A;  1LZI A;  1VZT A;  3I0C A;  4Y9X A;  1JYL A;  5L6S A;  2OI6 A;  2RJ5 A;  5JQQ A;  2RJ0 A;  2BO4 A;  1S4P A;  4EEA A;  5C4E A;  3ZLL A;  2RJ9 A;  5D92 A;  1FGG A;  4FQW A;  1H7H A;  1ZJ1 A;  4Y6U A;  3V8Y A;  2XWM A;  3OH3 A;  2VD4 A;  1GWV A;  4FRQ A;  1ZJ0 A;  1SS9 A;  3CKO A;  4M2A A;  1ZHJ A;  3SX8 A;  1PZY B;  1W57 A;  3U2T A;  4CVH A;  4HO0 A;  1ZJ2 A;  5C38 A;  1JVG A;  5J49 A;  4DEC A;  4EEM A;  3E25 A;  1G23 A;  2RJ7 A;  4FCU A;  2JCK A;  2PA4 A;  3Q4S A;  4FIX A;  4CJC A;  1K4V A;  1JV3 A;  2P72 A;  4HO4 A;  1WT0 A;  4R7P A;  2AEC A;  1LZ0 A;  3DK5 A;  3RSB A;  4HO8 A;  4EE3 A;  1VGZ A;  4FRH A;  4HO6 A;  4BQH A;  3F1C A;  1O23 B;  4G3Q A;  2VFZ A;  2E8B A;  2D7I A;  4FRO A;  2Y4L A;  4JIS A;  4KXO A;  3LW6 A;  3R2W A;  1VGT A;  4AYL A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...