3U2VA

Crystal structure of human glycogenin-1 (gyg1) complexed with manganese, udp and maltohexaose
Total Genus 90
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
90
sequence length
263
structure length
263
Chain Sequence
SMTDQAFVTLTTNDAYAKGALVLGSSLKQHRTTRRLVVLATPQVSDSMRKVLETVFDEVIMVDVLDSGDSAHLTLMKRPELGVTLTKLHCWSLTQYSKCVFMDADTLVLANIDDLFDREELSAAPDPGWPDCFNSGVFVYQPSVETYNQLLHLASEQGSFDGGDQGILNTFFSSWATTDIRKHLPFIYNLSSISIYSYLPAFKVFGASAKVVHFLGRVKPWNYTYDPKTKSVKSEAHDPNMTHPEFLILWWNIFTTNVLPLLQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Glycogenin-1
publication title Conformational plasticity of glycogenin and its maltosaccharide substrate during glycogen biogenesis.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 90
structure length 263
sequence length 263
chains with identical sequence B
ec nomenclature ec 2.4.1.186: Glycogenin glucosyltransferase.
pdb deposition date 2011-10-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01501 Glyco_transf_8 Glycosyl transferase family 8
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.550.10 Alpha Beta Alpha-Beta Complex Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A 3u2vA00
1JVGA 3U2TA 3FOQA 3HL3A 4FRBA 5CQLX 2I7BA 3TZTA 1FR9A 2Y6PA 3CKOA 2AGDA 3GUEA 1H7TA 1G3LA 4K6RA 1PZYB 4HO5A 1LZ0A 3V0NA 2X65A 3E26A 2OEFA 5CMGX 2X60A 5C4EA 4R7PA 3U0YA 2I5KA 1FXJA 3V0MA 5BXCA 2FFVA 4EE3A 2XWLA 4EE5A 1FR8A 4FRAA 5FU8A 1H7LA 1ZIZA 3RSBA 5IFYA 1QGSA 5C4FA 2QGIA 2Z86A 3SXBA 4NAIA 1G97A 1QG8A 2XMHA 2WGZA 3D5NA 4M4KA 3BRKX 5FV9A 1SS9A 3OGZA 1TVYA 1VZTA 3TQDA 4Y7UA 2D0JA 2RJ0A 4ASJA 1R7YA 3ZF8A 3K8EA 1INIA 4KC1A 2YQSA 3SX3A 3EE5A 1H7QA 2W0WA 1MP5A 1LL0A 3I0DA 2V0KA 2AESA 1WT3A 1H4EA 4KPZA 3F1CA 4Y7FA 1QWJA 3JUJA 1KWSA 1R81A 1GX4A 1ON6A 4E1KA 5CMJA 3V90A 5C1HA 1MP4A 2YCMA 1G23A 3SXDA 1FRWA 3V0OA 1WT1A 4D11C 4NAKA 1YP4A 4Y9XA 1I52A 5L6SA 2BO6A 2AECA 1V83A 3I0HA 1ZJOA 2UX8A 4AYLA 2AM4A 2VS3A 4FRHA 1G8OA 5L6VA 3Q80A 2WE9A 4B4GA 5FTVA 1YP3A 2O1GA 1LZIA 2RJ9A 4FRDA 2VS4A 3E25A 4JISA 3K8DA 4D0TA 1NQIB 4Y7VA 2Z87A 1NHEB 1G1LA 1VGWA 1VGTA 4D48A 1VPAA 2Y7AA 2Y4JA 3DJ4A 1HM9A 5C8RA 1H7FA 2QKXA 3RMVA 1O0RA 2OI5A 3LW6A 2Q4JA 1XZ6A 1S4OA 1HV9A 3U0XA 5FUHA 3T7NA 3Q4SA 3I0GA 1H7GA 2V0LA 1G93A 4DDZA 2E3DA 1R7UA 3OH2A 4FQWA 2BO4A 2ICYA 2O1HA 5C4BA 4FROA 5C4DA 4B3UA 3U2UA 3R3IA 1TW5A 1ZJ2A 2RITA 4DE7A 1WVCA 4HO3A 2FYBA 3NGWA 2WAWA 3SXGA 1LZ7A 5EJZA 2VSIA 3SX7A 1HJLA 2QH5A 4KT7A 4AYJA 4AC3A 4IRQA 1QGQA 5AJNA 3D8VA 3V91A 4B2WA 4ARWA 2YC3A 2I5EA 2AH9A 1H5SA 5CMIA 1TZFA 2RIXA 2ICXA 4B42A 2OI7A 2PGVA 2PGYA 3I0EA 1O7OA 3PNNA 3N9WA 1VZXA 1H3MA 2VS5A 2FYAA 1H5TA 4GBPA 4KPXA 4B5BA 5C3AA 3ST8A 4HCQA 2AM3A 5JQQA 1NF5B 1GX0A 2NXVA 5CQNX 1WT0A 2D7RA 4Y7GA 3PKQA 1H7EA 4DECA 4HG6A 5C1LA 1K4VA 2P6WA 2AM5A 5IDTA 4EEOA 5DDTA 1INJA 1H4CA 3I0LA 4HO4A 3IOHA 2RJ7A 1FZWA 4Y6UA 4MNDA 2P72A 2VXMA 2Y4LA 2PX7A 3KIAA 1FWYA 1VH3A 3JUKA 2JCKA 1JV1A 2RJ4A 2WVKA 1G95A 1JV3A 1S4PA 1OMZA 1IINA 1OQMB 2P73A 3R2WA 1LVWA 4KC2A 3T7OA 3SPTA 4J18A 5C38A 4MYBA 1W55A 1IIMA 5IDSA 2FYCB 5CMFX 2XWMA 1PZTA 4Y63A 5AJPA 3DK5A 2YQCA 1ZHJA 1E5KA 3CKJA 5CQPA 4FRPA 1FGGA 4EEMA 1LL3A 4ZDQA 1JVDA 4B2XA 1H5RB 4BQHA 1ZI3A 4YS8A 1O23B 2ZU9A 3V8YA 2X5SA 2YQJA 1FOAA 4FREA 1G9RA 1WSZA 4KQLA 3V0LA 1ZI4A 1R7VA 3JTJA 1HM0A 2DPWA 4KRVA 1ZDGA 2V0JA 4EVWA 4HO9A 4KNRA 2O1FA 5C3DA 3I0KA 2A8WA 4HOCA 1ZCVA 1HM8A 3POLA 4KNXA 4Y62A 4D0ZA 2BO8A 3CKNA 1EYRA 3ZLKA 1H5SD 1ZCTA 5C4CA 3ZGFA 1NKHB 1FO9A 2RJ5A 4P02A 5C36A 2RJ1A 1NMMB 1WT2A 2YESA 4HO2A 4CJBA 4Y6NA 3SX5A 4AAWA 4B4BA 5C47A 4G3SA 5CQOA 4L41C 2JCJA 4M2AA 3I0JA 5CQMX 1OMXA 4EEAA 1H5SB 3OH4A 2V0HA 1ZJ1A 4FRMA 5I1FA 2RIZA 1H5SC 1VGUA 1V82A 1FGXA 3Q7UA 4C2SA 4BMAA 3I0FA 1ZCUA 2JCOA 2YC5A 4KC4A 2E8BA 3SX8A 1H5TB 3SXAA 4ECMA 1VM8A 4Y7TA 4G3PA 1FG5N 1EZIA 3U2XA 1YP2A 4NANA 5C1GA 5HS2A 4CJ8A 2VXLA 3OAMA 2APCA 3CGXA 1ZCYA 2XWNA 4G3QA 4XWIA 1TW1A 4HO8A 1O7QA 1MP3A 1G2VA 4JD0A 1VH1A 4M2BA 5EJ1A 1GA8A 1JYLA 1VICA 5FYEA 4B4MA 2W0VA 2YQHA 1G0RA 1MC3A 4FRQA 2OI6A 1R82A 2RJ6A 2FYDB 4FCEA 3T7MA 1W77A 2WVLA 4FRLA 4Y64A 3FWWA 1GWWA 1JYKA 5EIYA 2WEEA 2VSHA 1ZDFA 1S4NA 1YROB 3DUVA 2BO7A 2ZU8A 4FCUA 1GWVA 1XHBA 4HO6A 2RIYA 4NALA 1VGZA 2Y4MA 3ZLLA 3USQA 2X5ZA 5C49A 3OC9A 3OKRA 3PKPA 1ZI1A 1H7HA 4HO0A 2MZBA 1ZI5A 2WVMA 4CJCA 2V0IA 2AE7A 2XMEA 3SXCA 2FY7A 5DDVA 5J49A 4D11A 3O3PA 2VD4A 2OEGA 2Y4KA 1ON8A 2GGQA 2PA4A 5CMHA 5FTSA 1R80A 5C3BA 4CVHA 3ZGGA 1NWGB 3OH0A 3V8ZA 3V0QA 1ZJ0A 3CU0A 3RMWA 1V84A 3I0CA 3U2WA 2ZU7A 1VZUA 1FO8A 2GGOA 1R7TA 1LL2A 4EEGA 3CKVA 1H5RA 2VFZA 2JCLA 1LZJA 4M28A 3F1YA 1HJJA 4ASYA 3CKQA 5C48A 4LW3A 1ZJPA 1Z90A 3V0PA 5AJOA 3QVBA 4IRPA 1FXOA 1W57A 3BCVA 3IOIA 1H4DA 3SXEA 3I0IX 4UEGA 3OH3A 1R7XA 4P00A 2RJ8A 1GQ9A 3IOJA 4KXOA 3D98A 3OH1A 3USRA 4LW6A 2A8UA 2FFUA 4EE4A 2D7IA 3U2VA 2CU2A 5FU0A 1ZJ3A 1GQCA 4G87A
chains in the Genus database with same CATH superfamily
4FIYA 1JVGA 3U2TA 3FOQA 3HL3A 4FRBA 5CQLX 2I7BA 3TZTA 1FR9A 2Y6PA 3CKOA 2AGDA 2VK9A 3GUEA 1H7TA 1G3LA 4K6RA 1PZYB 4HO5A 1LZ0A 3V0NA 2X65A 3E26A 2OEFA 5CMGX 2X60A 5C4EA 4O6NA 4R7PA 3U0YA 2I5KA 1FXJA 3V0MA 5BXCA 2FFVA 4EE3A 2XWLA 4EE5A 1FR8A 4FRAA 5FU8A 1H7LA 1ZIZA 3RSBA 5IFYA 1QGSA 5C4FA 2QGIA 2Z86A 3SXBA 4NAIA 1G97A 1QG8A 2XMHA 2WGZA 3D5NA 4M4KA 3BRKX 5FV9A 1SS9A 3OGZA 1TVYA 1VZTA 2J0AA 3TQDA 4Y7UA 2D0JA 2RJ0A 4ASJA 1R7YA 3ZF8A 3K8EA 1INIA 4KC1A 2YQSA 3SX3A 3EE5A 1H7QA 2W0WA 1MP5A 1LL0A 3I0DA 2V0KA 2AESA 1WT3A 1H4EA 4KPZA 3F1CA 4Y7FA 1QWJA 3JUJA 1KWSA 1R81A 1GX4A 1ON6A 4E1KA 5CMJA 3V90A 5C1HA 1MP4A 5D91A 2YCMA 1G23A 3SXDA 1FRWA 3V0OA 1WT1A 4D11C 4NAKA 1YP4A 4Y9XA 1I52A 5L6SA 2BO6A 2AECA 1V83A 3I0HA 1ZJOA 2UX8A 4AYLA 2AM4A 2VS3A 4O6MA 4FRHA 1G8OA 5L6VA 3Q80A 2WE9A 4B4GA 5FTVA 1YP3A 2O1GA 1LZIA 2RJ9A 4FRDA 2VS4A 3E25A 4JISA 3K8DA 4D0TA 1NQIB 4Y7VA 2Z87A 1NHEB 1G1LA 1VGWA 1VGTA 4D48A 1VPAA 2Y7AA 2Y4JA 3DJ4A 1HM9A 5C8RA 1H7FA 2QKXA 3RMVA 4FIXA 1O0RA 2OI5A 3LW6A 2Q4JA 1XZ6A 1S4OA 1HV9A 3U0XA 5FUHA 3T7NA 3Q4SA 3I0GA 1H7GA 2V0LA 1G93A 4DDZA 2E3DA 1R7UA 3OH2A 4FQWA 2BO4A 2ICYA 2O1HA 5C4BA 4FROA 5C4DA 4B3UA 3U2UA 3R3IA 1TW5A 1ZJ2A 2RITA 4DE7A 1WVCA 4HO3A 2FYBA 3NGWA 2WAWA 3SXGA 1LZ7A 5EJZA 2VSIA 3SX7A 1HJLA 2QH5A 4KT7A 4AYJA 4AC3A 4IRQA 1QGQA 5AJNA 3D8VA 3V91A 4B2WA 4ARWA 2YC3A 2I5EA 2AH9A 1H5SA 5CMIA 1TZFA 2RIXA 2ICXA 4B42A 2OI7A 2PGVA 2PGYA 3I0EA 1O7OA 3PNNA 3N9WA 1VZXA 1H3MA 2VS5A 2FYAA 1H5TA 4GBPA 2J0BA 4KPXA 4B5BA 5C3AA 3ST8A 4HCQA 2AM3A 5JQQA 1NF5B 1GX0A 2NXVA 5CQNX 1WT0A 2D7RA 4Y7GA 3PKQA 1H7EA 4DECA 4HG6A 5C1LA 1K4VA 2P6WA 2AM5A 5IDTA 4EEOA 5DDTA 1INJA 1H4CA 3I0LA 4HO4A 3IOHA 2RJ7A 1FZWA 4Y6UA 4MNDA 2P72A 2VXMA 2Y4LA 2PX7A 3KIAA 1FWYA 1VH3A 3JUKA 4Q7CA 2JCKA 1JV1A 2RJ4A 2WVKA 1G95A 1JV3A 1S4PA 1OMZA 1IINA 1OQMB 2P73A 3R2WA 1LVWA 4KC2A 3T7OA 3SPTA 4J18A 5C38A 4MYBA 1W55A 1IIMA 5IDSA 2FYCB 5CMFX 2XWMA 1PZTA 4Y63A 5AJPA 3DK5A 2YQCA 1ZHJA 1E5KA 3CKJA 5CQPA 4FRPA 1FGGA 4EEMA 1LL3A 4ZDQA 1JVDA 4B2XA 1H5RB 4BQHA 1ZI3A 4YS8A 1O23B 2ZU9A 3V8YA 2X5SA 2YQJA 1FOAA 4FREA 1G9RA 1WSZA 4KQLA 3V0LA 1ZI4A 1R7VA 3JTJA 1HM0A 2DPWA 4KRVA 1ZDGA 2V0JA 4EVWA 4HO9A 4KNRA 2O1FA 5C3DA 3I0KA 2A8WA 4HOCA 1ZCVA 1HM8A 3POLA 4KNXA 4Y62A 4D0ZA 2BO8A 3CKNA 1EYRA 3ZLKA 1H5SD 1ZCTA 5C4CA 3ZGFA 1NKHB 1FO9A 2RJ5A 4P02A 5C36A 2RJ1A 1NMMB 1WT2A 2YESA 4HO2A 4CJBA 4Y6NA 3SX5A 4AAWA 4B4BA 5C47A 4G3SA 5CQOA 4L41C 2JCJA 4M2AA 3I0JA 5CQMX 1OMXA 4EEAA 1H5SB 3OH4A 2V0HA 1ZJ1A 4FRMA 5I1FA 2RIZA 1H5SC 1VGUA 1V82A 1FGXA 3Q7UA 4C2SA 4BMAA 3I0FA 1ZCUA 2JCOA 2YC5A 4KC4A 2E8BA 5D92A 1H5TB 3SX8A 3SXAA 4ECMA 1VM8A 4MIXA 4Y7TA 4G3PA 1FG5N 1EZIA 3U2XA 1YP2A 4NANA 5C1GA 5HS2A 4CJ8A 2VXLA 3OAMA 2APCA 3CGXA 1ZCYA 2XWNA 4G3QA 4XWIA 1TW1A 4HO8A 1O7QA 1MP3A 1G2VA 4JD0A 1VH1A 4M2BA 5EJ1A 1GA8A 1JYLA 1VICA 5FYEA 4B4MA 2W0VA 2YQHA 1G0RA 1MC3A 4FRQA 2OI6A 1R82A 2RJ6A 2FYDB 4FCEA 3T7MA 1W77A 2WVLA 4FRLA 4Y64A 3FWWA 1GWWA 1JYKA 5EIYA 2WEEA 2VSHA 1ZDFA 1S4NA 1YROB 3DUVA 2BO7A 2ZU8A 4FCUA 1GWVA 1XHBA 4HO6A 2RIYA 4NALA 1VGZA 2Y4MA 3ZLLA 3USQA 2X5ZA 5C49A 3OC9A 3OKRA 3PKPA 1ZI1A 1H7HA 4HO0A 2MZBA 1ZI5A 2WVMA 4CJCA 2V0IA 2AE7A 2XMEA 3SXCA 2FY7A 5DDVA 5J49A 4D11A 3O3PA 2VD4A 2OEGA 2Y4KA 1ON8A 2GGQA 2PA4A 5CMHA 5FTSA 1R80A 5C3BA 4CVHA 3ZGGA 1NWGB 3OH0A 3V8ZA 3V0QA 1ZJ0A 3CU0A 3RMWA 1V84A 2C0NA 3I0CA 3U2WA 2ZU7A 1VZUA 1FO8A 2GGOA 1R7TA 1LL2A 4EEGA 3CKVA 1H5RA 2VFZA 2JCLA 1LZJA 4M28A 3F1YA 1HJJA 4ASYA 3CKQA 5C48A 4LW3A 1ZJPA 1Z90A 3V0PA 5AJOA 3QVBA 4IRPA 1FXOA 1W57A 3BCVA 3IOIA 1H4DA 3SXEA 3I0IX 4UEGA 3OH3A 1R7XA 4P00A 2RJ8A 1GQ9A 3IOJA 4KXOA 3D98A 3OH1A 3USRA 4LW6A 2A8UA 2FFUA 4EE4A 2D7IA 3U2VA 2CU2A 5FU0A 1ZJ3A 1GQCA 4G87A
chains in the Genus database with same CATH topology
4FIYA 1JVGA 3U2TA 3FOQA 3HL3A 4FRBA 5CQLX 2I7BA 3TZTA 1FR9A 2Y6PA 3CKOA 2AGDA 2VK9A 3GUEA 1H7TA 1G3LA 4K6RA 1PZYB 4HO5A 1LZ0A 3V0NA 2X65A 3E26A 2OEFA 5CMGX 2X60A 5C4EA 4O6NA 4R7PA 3U0YA 2I5KA 1FXJA 3V0MA 5BXCA 2FFVA 4EE3A 2XWLA 4EE5A 1FR8A 4FRAA 5FU8A 1H7LA 1ZIZA 3RSBA 5IFYA 1QGSA 5C4FA 2QGIA 2Z86A 3SXBA 4NAIA 1G97A 1QG8A 2XMHA 2WGZA 3D5NA 4M4KA 3BRKX 5FV9A 1SS9A 3OGZA 1TVYA 1VZTA 2J0AA 3TQDA 4Y7UA 2D0JA 2RJ0A 4ASJA 1R7YA 3ZF8A 3K8EA 1INIA 4KC1A 2YQSA 3SX3A 3EE5A 1H7QA 2W0WA 1MP5A 1LL0A 3I0DA 2V0KA 2AESA 1WT3A 1H4EA 4KPZA 3F1CA 4Y7FA 1QWJA 3JUJA 1KWSA 1R81A 1GX4A 1ON6A 4E1KA 5CMJA 3V90A 5C1HA 1MP4A 5D91A 2YCMA 1G23A 3SXDA 1FRWA 3V0OA 1WT1A 4D11C 4NAKA 1YP4A 4Y9XA 1I52A 5L6SA 2BO6A 2AECA 1V83A 3I0HA 1ZJOA 2UX8A 4AYLA 2AM4A 2VS3A 4O6MA 4FRHA 1G8OA 5L6VA 3Q80A 2WE9A 4B4GA 5FTVA 1YP3A 2O1GA 1LZIA 2RJ9A 4FRDA 2VS4A 3E25A 4JISA 3K8DA 4D0TA 1NQIB 4Y7VA 2Z87A 1NHEB 1G1LA 1VGWA 1VGTA 4D48A 1VPAA 2Y7AA 2Y4JA 3DJ4A 1HM9A 5C8RA 1H7FA 2QKXA 3RMVA 4FIXA 1O0RA 2OI5A 3LW6A 2Q4JA 1XZ6A 1S4OA 1HV9A 3U0XA 5FUHA 3T7NA 3Q4SA 3I0GA 1H7GA 2V0LA 1G93A 4DDZA 2E3DA 1R7UA 3OH2A 4FQWA 2BO4A 2ICYA 2O1HA 5C4BA 4FROA 5C4DA 4B3UA 3U2UA 3R3IA 1TW5A 1ZJ2A 2RITA 4DE7A 1WVCA 4HO3A 2FYBA 3NGWA 2WAWA 3SXGA 1LZ7A 5EJZA 2VSIA 3SX7A 1HJLA 2QH5A 4KT7A 4AYJA 4AC3A 4IRQA 1QGQA 5AJNA 3D8VA 3V91A 4B2WA 4ARWA 2YC3A 2I5EA 2AH9A 1H5SA 5CMIA 1TZFA 2RIXA 2ICXA 4B42A 2OI7A 2PGVA 2PGYA 3I0EA 1O7OA 3PNNA 3N9WA 1VZXA 1H3MA 2VS5A 2FYAA 1H5TA 4GBPA 2J0BA 4KPXA 4B5BA 5C3AA 3ST8A 4HCQA 2AM3A 5JQQA 1NF5B 1GX0A 2NXVA 5CQNX 1WT0A 2D7RA 4Y7GA 3PKQA 1H7EA 4DECA 4HG6A 5C1LA 1K4VA 2P6WA 2AM5A 5IDTA 4EEOA 5DDTA 1INJA 1H4CA 3I0LA 4HO4A 3IOHA 2RJ7A 1FZWA 4Y6UA 4MNDA 2P72A 2VXMA 2Y4LA 2PX7A 3KIAA 1FWYA 1VH3A 3JUKA 4Q7CA 2JCKA 1JV1A 2RJ4A 2WVKA 1G95A 1JV3A 1S4PA 1OMZA 1IINA 1OQMB 2P73A 3R2WA 1LVWA 4KC2A 3T7OA 3SPTA 4J18A 5C38A 4MYBA 1W55A 1IIMA 5IDSA 2FYCB 5CMFX 2XWMA 1PZTA 4Y63A 5AJPA 3DK5A 2YQCA 1ZHJA 1E5KA 3CKJA 5CQPA 4FRPA 1FGGA 4EEMA 1LL3A 4ZDQA 1JVDA 4B2XA 1H5RB 4BQHA 1ZI3A 4YS8A 1O23B 2ZU9A 3V8YA 2X5SA 2YQJA 1FOAA 4FREA 1G9RA 1WSZA 4KQLA 3V0LA 1ZI4A 1R7VA 3JTJA 1HM0A 2DPWA 4KRVA 1ZDGA 2V0JA 4EVWA 4HO9A 4KNRA 2O1FA 5C3DA 3I0KA 2A8WA 4HOCA 1ZCVA 1HM8A 3POLA 4KNXA 4Y62A 4D0ZA 2BO8A 3CKNA 1EYRA 3ZLKA 1H5SD 1ZCTA 5C4CA 3ZGFA 1NKHB 1FO9A 2RJ5A 4P02A 5C36A 2RJ1A 1NMMB 1WT2A 2YESA 4HO2A 4CJBA 4Y6NA 3SX5A 4AAWA 4B4BA 5C47A 4G3SA 5CQOA 4L41C 2JCJA 4M2AA 3I0JA 5CQMX 1OMXA 4EEAA 1H5SB 3OH4A 2V0HA 1ZJ1A 4FRMA 5I1FA 2RIZA 1H5SC 1VGUA 1V82A 1FGXA 3Q7UA 4C2SA 4BMAA 3I0FA 1ZCUA 2JCOA 2YC5A 4KC4A 2E8BA 5D92A 1H5TB 3SX8A 3SXAA 4ECMA 1VM8A 4MIXA 4Y7TA 4G3PA 1FG5N 1EZIA 3U2XA 1YP2A 4NANA 5C1GA 5HS2A 4CJ8A 2VXLA 3OAMA 2APCA 3CGXA 1ZCYA 2XWNA 4G3QA 4XWIA 1TW1A 4HO8A 1O7QA 1MP3A 1G2VA 4JD0A 1VH1A 4M2BA 5EJ1A 1GA8A 1JYLA 1VICA 5FYEA 4B4MA 2W0VA 2YQHA 1G0RA 1MC3A 4FRQA 2OI6A 1R82A 2RJ6A 2FYDB 4FCEA 3T7MA 1W77A 2WVLA 4FRLA 4Y64A 3FWWA 1GWWA 1JYKA 5EIYA 2WEEA 2VSHA 1ZDFA 1S4NA 1YROB 3DUVA 2BO7A 2ZU8A 4FCUA 1GWVA 1XHBA 4HO6A 2RIYA 4NALA 1VGZA 2Y4MA 3ZLLA 3USQA 2X5ZA 5C49A 3OC9A 3OKRA 3PKPA 1ZI1A 1H7HA 4HO0A 2MZBA 1ZI5A 2WVMA 4CJCA 2V0IA 2AE7A 2XMEA 3SXCA 2FY7A 5DDVA 5J49A 4D11A 3O3PA 2VD4A 2OEGA 2Y4KA 1ON8A 2GGQA 2PA4A 5CMHA 5FTSA 1R80A 5C3BA 4CVHA 3ZGGA 1NWGB 3OH0A 3V8ZA 3V0QA 1ZJ0A 3CU0A 3RMWA 1V84A 2C0NA 3I0CA 3U2WA 2ZU7A 1VZUA 1FO8A 2GGOA 1R7TA 1LL2A 4EEGA 3CKVA 1H5RA 2VFZA 2JCLA 1LZJA 4M28A 3F1YA 1HJJA 4ASYA 3CKQA 5C48A 4LW3A 1ZJPA 1Z90A 3V0PA 5AJOA 3QVBA 4IRPA 1FXOA 1W57A 3BCVA 3IOIA 1H4DA 3SXEA 3I0IX 4UEGA 3OH3A 1R7XA 4P00A 2RJ8A 1GQ9A 3IOJA 4KXOA 3D98A 3OH1A 3USRA 4LW6A 2A8UA 2FFUA 4EE4A 2D7IA 3U2VA 2CU2A 5FU0A 1ZJ3A 1GQCA 4G87A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1JVG A;  3U2T A;  3FOQ A;  3HL3 A;  4FRB A;  5CQL X;  2I7B A;  3TZT A;  1FR9 A;  2Y6P A;  3CKO A;  2AGD A;  3GUE A;  1H7T A;  1G3L A;  4K6R A;  1PZY B;  4HO5 A;  1LZ0 A;  3V0N A;  2X65 A;  3E26 A;  2OEF A;  5CMG X;  2X60 A;  5C4E A;  4R7P A;  3U0Y A;  2I5K A;  1FXJ A;  3V0M A;  5BXC A;  2FFV A;  4EE3 A;  2XWL A;  4EE5 A;  1FR8 A;  4FRA A;  5FU8 A;  1H7L A;  1ZIZ A;  3RSB A;  5IFY A;  1QGS A;  5C4F A;  2QGI A;  2Z86 A;  3SXB A;  4NAI A;  1G97 A;  1QG8 A;  2XMH A;  2WGZ A;  3D5N A;  4M4K A;  3BRK X;  5FV9 A;  1SS9 A;  3OGZ A;  1TVY A;  1VZT A;  3TQD A;  4Y7U A;  2D0J A;  2RJ0 A;  4ASJ A;  1R7Y A;  3ZF8 A;  3K8E A;  1INI A;  4KC1 A;  2YQS A;  3SX3 A;  3EE5 A;  1H7Q A;  2W0W A;  1MP5 A;  1LL0 A;  3I0D A;  2V0K A;  2AES A;  1WT3 A;  1H4E A;  4KPZ A;  3F1C A;  4Y7F A;  1QWJ A;  3JUJ A;  1KWS A;  1R81 A;  1GX4 A;  1ON6 A;  4E1K A;  5CMJ A;  3V90 A;  5C1H A;  1MP4 A;  2YCM A;  1G23 A;  3SXD A;  1FRW A;  3V0O A;  1WT1 A;  4D11 C;  4NAK A;  1YP4 A;  4Y9X A;  1I52 A;  5L6S A;  2BO6 A;  2AEC A;  1V83 A;  3I0H A;  1ZJO A;  2UX8 A;  4AYL A;  2AM4 A;  2VS3 A;  4FRH A;  1G8O A;  5L6V A;  3Q80 A;  2WE9 A;  4B4G A;  5FTV A;  1YP3 A;  2O1G A;  1LZI A;  2RJ9 A;  4FRD A;  2VS4 A;  3E25 A;  4JIS A;  3K8D A;  4D0T A;  1NQI B;  4Y7V A;  2Z87 A;  1NHE B;  1G1L A;  1VGW A;  1VGT A;  4D48 A;  1VPA A;  2Y7A A;  2Y4J A;  3DJ4 A;  1HM9 A;  5C8R A;  1H7F A;  2QKX A;  3RMV A;  1O0R A;  2OI5 A;  3LW6 A;  2Q4J A;  1XZ6 A;  1S4O A;  1HV9 A;  3U0X A;  5FUH A;  3T7N A;  3Q4S A;  3I0G A;  1H7G A;  2V0L A;  1G93 A;  4DDZ A;  2E3D A;  1R7U A;  3OH2 A;  4FQW A;  2BO4 A;  2ICY A;  2O1H A;  5C4B A;  4FRO A;  5C4D A;  4B3U A;  3U2U A;  3R3I A;  1TW5 A;  1ZJ2 A;  2RIT A;  4DE7 A;  1WVC A;  4HO3 A;  2FYB A;  3NGW A;  2WAW A;  3SXG A;  1LZ7 A;  5EJZ A;  2VSI A;  3SX7 A;  1HJL A;  2QH5 A;  4KT7 A;  4AYJ A;  4AC3 A;  4IRQ A;  1QGQ A;  5AJN A;  3D8V A;  3V91 A;  4B2W A;  4ARW A;  2YC3 A;  2I5E A;  2AH9 A;  1H5S A;  5CMI A;  1TZF A;  2RIX A;  2ICX A;  4B42 A;  2OI7 A;  2PGV A;  2PGY A;  3I0E A;  1O7O A;  3PNN A;  3N9W A;  1VZX A;  1H3M A;  2VS5 A;  2FYA A;  1H5T A;  4GBP A;  4KPX A;  4B5B A;  5C3A A;  3ST8 A;  4HCQ A;  2AM3 A;  5JQQ A;  1NF5 B;  1GX0 A;  2NXV A;  5CQN X;  1WT0 A;  2D7R A;  4Y7G A;  3PKQ A;  1H7E A;  4DEC A;  4HG6 A;  5C1L A;  1K4V A;  2P6W A;  2AM5 A;  5IDT A;  4EEO A;  5DDT A;  1INJ A;  1H4C A;  3I0L A;  4HO4 A;  3IOH A;  2RJ7 A;  1FZW A;  4Y6U A;  4MND A;  2P72 A;  2VXM A;  2Y4L A;  2PX7 A;  3KIA A;  1FWY A;  1VH3 A;  3JUK A;  2JCK A;  1JV1 A;  2RJ4 A;  2WVK A;  1G95 A;  1JV3 A;  1S4P A;  1OMZ A;  1IIN A;  1OQM B;  2P73 A;  3R2W A;  1LVW A;  4KC2 A;  3T7O A;  3SPT A;  4J18 A;  5C38 A;  4MYB A;  1W55 A;  1IIM A;  5IDS A;  2FYC B;  5CMF X;  2XWM A;  1PZT A;  4Y63 A;  5AJP A;  3DK5 A;  2YQC A;  1ZHJ A;  1E5K A;  3CKJ A;  5CQP A;  4FRP A;  1FGG A;  4EEM A;  1LL3 A;  4ZDQ A;  1JVD A;  4B2X A;  1H5R B;  4BQH A;  1ZI3 A;  4YS8 A;  1O23 B;  2ZU9 A;  3V8Y A;  2X5S A;  2YQJ A;  1FOA A;  4FRE A;  1G9R A;  1WSZ A;  4KQL A;  3V0L A;  1ZI4 A;  1R7V A;  3JTJ A;  1HM0 A;  2DPW A;  4KRV A;  1ZDG A;  2V0J A;  4EVW A;  4HO9 A;  4KNR A;  2O1F A;  5C3D A;  3I0K A;  2A8W A;  4HOC A;  1ZCV A;  1HM8 A;  3POL A;  4KNX A;  4Y62 A;  4D0Z A;  2BO8 A;  3CKN A;  1EYR A;  3ZLK A;  1H5S D;  1ZCT A;  5C4C A;  3ZGF A;  1NKH B;  1FO9 A;  2RJ5 A;  4P02 A;  5C36 A;  2RJ1 A;  1NMM B;  1WT2 A;  2YES A;  4HO2 A;  4CJB A;  4Y6N A;  3SX5 A;  4AAW A;  4B4B A;  5C47 A;  4G3S A;  5CQO A;  4L41 C;  2JCJ A;  4M2A A;  3I0J A;  5CQM X;  1OMX A;  4EEA A;  1H5S B;  3OH4 A;  2V0H A;  1ZJ1 A;  4FRM A;  5I1F A;  2RIZ A;  1H5S C;  1VGU A;  1V82 A;  1FGX A;  3Q7U A;  4C2S A;  4BMA A;  3I0F A;  1ZCU A;  2JCO A;  2YC5 A;  4KC4 A;  2E8B A;  3SX8 A;  1H5T B;  3SXA A;  4ECM A;  1VM8 A;  4Y7T A;  4G3P A;  1FG5 N;  1EZI A;  3U2X A;  1YP2 A;  4NAN A;  5C1G A;  5HS2 A;  4CJ8 A;  2VXL A;  3OAM A;  2APC A;  3CGX A;  1ZCY A;  2XWN A;  4G3Q A;  4XWI A;  1TW1 A;  4HO8 A;  1O7Q A;  1MP3 A;  1G2V A;  4JD0 A;  1VH1 A;  4M2B A;  5EJ1 A;  1GA8 A;  1JYL A;  1VIC A;  5FYE A;  4B4M A;  2W0V A;  2YQH A;  1G0R A;  1MC3 A;  4FRQ A;  2OI6 A;  1R82 A;  2RJ6 A;  2FYD B;  4FCE A;  3T7M A;  1W77 A;  2WVL A;  4FRL A;  4Y64 A;  3FWW A;  1GWW A;  1JYK A;  5EIY A;  2WEE A;  2VSH A;  1ZDF A;  1S4N A;  1YRO B;  3DUV A;  2BO7 A;  2ZU8 A;  4FCU A;  1GWV A;  1XHB A;  4HO6 A;  2RIY A;  4NAL A;  1VGZ A;  2Y4M A;  3ZLL A;  3USQ A;  2X5Z A;  5C49 A;  3OC9 A;  3OKR A;  3PKP A;  1ZI1 A;  1H7H A;  4HO0 A;  2MZB A;  1ZI5 A;  2WVM A;  4CJC A;  2V0I A;  2AE7 A;  2XME A;  3SXC A;  2FY7 A;  5DDV A;  5J49 A;  4D11 A;  3O3P A;  2VD4 A;  2OEG A;  2Y4K A;  1ON8 A;  2GGQ A;  2PA4 A;  5CMH A;  5FTS A;  1R80 A;  5C3B A;  4CVH A;  3ZGG A;  1NWG B;  3OH0 A;  3V8Z A;  3V0Q A;  1ZJ0 A;  3CU0 A;  3RMW A;  1V84 A;  3I0C A;  3U2W A;  2ZU7 A;  1VZU A;  1FO8 A;  2GGO A;  1R7T A;  1LL2 A;  4EEG A;  3CKV A;  1H5R A;  2VFZ A;  2JCL A;  1LZJ A;  4M28 A;  3F1Y A;  1HJJ A;  4ASY A;  3CKQ A;  5C48 A;  4LW3 A;  1ZJP A;  1Z90 A;  3V0P A;  5AJO A;  3QVB A;  4IRP A;  1FXO A;  1W57 A;  3BCV A;  3IOI A;  1H4D A;  3SXE A;  3I0I X;  4UEG A;  3OH3 A;  1R7X A;  4P00 A;  2RJ8 A;  1GQ9 A;  3IOJ A;  4KXO A;  3D98 A;  3OH1 A;  3USR A;  4LW6 A;  2A8U A;  2FFU A;  4EE4 A;  2D7I A;  3U2V A;  2CU2 A;  5FU0 A;  1ZJ3 A;  1GQC A;  4G87 A; 
#chains in the Genus database with same CATH topology
 4FIY A;  1JVG A;  3U2T A;  3FOQ A;  3HL3 A;  4FRB A;  5CQL X;  2I7B A;  3TZT A;  1FR9 A;  2Y6P A;  3CKO A;  2AGD A;  2VK9 A;  3GUE A;  1H7T A;  1G3L A;  4K6R A;  1PZY B;  4HO5 A;  1LZ0 A;  3V0N A;  2X65 A;  3E26 A;  2OEF A;  5CMG X;  2X60 A;  5C4E A;  4O6N A;  4R7P A;  3U0Y A;  2I5K A;  1FXJ A;  3V0M A;  5BXC A;  2FFV A;  4EE3 A;  2XWL A;  4EE5 A;  1FR8 A;  4FRA A;  5FU8 A;  1H7L A;  1ZIZ A;  3RSB A;  5IFY A;  1QGS A;  5C4F A;  2QGI A;  2Z86 A;  3SXB A;  4NAI A;  1G97 A;  1QG8 A;  2XMH A;  2WGZ A;  3D5N A;  4M4K A;  3BRK X;  5FV9 A;  1SS9 A;  3OGZ A;  1TVY A;  1VZT A;  2J0A A;  3TQD A;  4Y7U A;  2D0J A;  2RJ0 A;  4ASJ A;  1R7Y A;  3ZF8 A;  3K8E A;  1INI A;  4KC1 A;  2YQS A;  3SX3 A;  3EE5 A;  1H7Q A;  2W0W A;  1MP5 A;  1LL0 A;  3I0D A;  2V0K A;  2AES A;  1WT3 A;  1H4E A;  4KPZ A;  3F1C A;  4Y7F A;  1QWJ A;  3JUJ A;  1KWS A;  1R81 A;  1GX4 A;  1ON6 A;  4E1K A;  5CMJ A;  3V90 A;  5C1H A;  1MP4 A;  5D91 A;  2YCM A;  1G23 A;  3SXD A;  1FRW A;  3V0O A;  1WT1 A;  4D11 C;  4NAK A;  1YP4 A;  4Y9X A;  1I52 A;  5L6S A;  2BO6 A;  2AEC A;  1V83 A;  3I0H A;  1ZJO A;  2UX8 A;  4AYL A;  2AM4 A;  2VS3 A;  4O6M A;  4FRH A;  1G8O A;  5L6V A;  3Q80 A;  2WE9 A;  4B4G A;  5FTV A;  1YP3 A;  2O1G A;  1LZI A;  2RJ9 A;  4FRD A;  2VS4 A;  3E25 A;  4JIS A;  3K8D A;  4D0T A;  1NQI B;  4Y7V A;  2Z87 A;  1NHE B;  1G1L A;  1VGW A;  1VGT A;  4D48 A;  1VPA A;  2Y7A A;  2Y4J A;  3DJ4 A;  1HM9 A;  5C8R A;  1H7F A;  2QKX A;  3RMV A;  4FIX A;  1O0R A;  2OI5 A;  3LW6 A;  2Q4J A;  1XZ6 A;  1S4O A;  1HV9 A;  3U0X A;  5FUH A;  3T7N A;  3Q4S A;  3I0G A;  1H7G A;  2V0L A;  1G93 A;  4DDZ A;  2E3D A;  1R7U A;  3OH2 A;  4FQW A;  2BO4 A;  2ICY A;  2O1H A;  5C4B A;  4FRO A;  5C4D A;  4B3U A;  3U2U A;  3R3I A;  1TW5 A;  1ZJ2 A;  2RIT A;  4DE7 A;  1WVC A;  4HO3 A;  2FYB A;  3NGW A;  2WAW A;  3SXG A;  1LZ7 A;  5EJZ A;  2VSI A;  3SX7 A;  1HJL A;  2QH5 A;  4KT7 A;  4AYJ A;  4AC3 A;  4IRQ A;  1QGQ A;  5AJN A;  3D8V A;  3V91 A;  4B2W A;  4ARW A;  2YC3 A;  2I5E A;  2AH9 A;  1H5S A;  5CMI A;  1TZF A;  2RIX A;  2ICX A;  4B42 A;  2OI7 A;  2PGV A;  2PGY A;  3I0E A;  1O7O A;  3PNN A;  3N9W A;  1VZX A;  1H3M A;  2VS5 A;  2FYA A;  1H5T A;  4GBP A;  2J0B A;  4KPX A;  4B5B A;  5C3A A;  3ST8 A;  4HCQ A;  2AM3 A;  5JQQ A;  1NF5 B;  1GX0 A;  2NXV A;  5CQN X;  1WT0 A;  2D7R A;  4Y7G A;  3PKQ A;  1H7E A;  4DEC A;  4HG6 A;  5C1L A;  1K4V A;  2P6W A;  2AM5 A;  5IDT A;  4EEO A;  5DDT A;  1INJ A;  1H4C A;  3I0L A;  4HO4 A;  3IOH A;  2RJ7 A;  1FZW A;  4Y6U A;  4MND A;  2P72 A;  2VXM A;  2Y4L A;  2PX7 A;  3KIA A;  1FWY A;  1VH3 A;  3JUK A;  4Q7C A;  2JCK A;  1JV1 A;  2RJ4 A;  2WVK A;  1G95 A;  1JV3 A;  1S4P A;  1OMZ A;  1IIN A;  1OQM B;  2P73 A;  3R2W A;  1LVW A;  4KC2 A;  3T7O A;  3SPT A;  4J18 A;  5C38 A;  4MYB A;  1W55 A;  1IIM A;  5IDS A;  2FYC B;  5CMF X;  2XWM A;  1PZT A;  4Y63 A;  5AJP A;  3DK5 A;  2YQC A;  1ZHJ A;  1E5K A;  3CKJ A;  5CQP A;  4FRP A;  1FGG A;  4EEM A;  1LL3 A;  4ZDQ A;  1JVD A;  4B2X A;  1H5R B;  4BQH A;  1ZI3 A;  4YS8 A;  1O23 B;  2ZU9 A;  3V8Y A;  2X5S A;  2YQJ A;  1FOA A;  4FRE A;  1G9R A;  1WSZ A;  4KQL A;  3V0L A;  1ZI4 A;  1R7V A;  3JTJ A;  1HM0 A;  2DPW A;  4KRV A;  1ZDG A;  2V0J A;  4EVW A;  4HO9 A;  4KNR A;  2O1F A;  5C3D A;  3I0K A;  2A8W A;  4HOC A;  1ZCV A;  1HM8 A;  3POL A;  4KNX A;  4Y62 A;  4D0Z A;  2BO8 A;  3CKN A;  1EYR A;  3ZLK A;  1H5S D;  1ZCT A;  5C4C A;  3ZGF A;  1NKH B;  1FO9 A;  2RJ5 A;  4P02 A;  5C36 A;  2RJ1 A;  1NMM B;  1WT2 A;  2YES A;  4HO2 A;  4CJB A;  4Y6N A;  3SX5 A;  4AAW A;  4B4B A;  5C47 A;  4G3S A;  5CQO A;  4L41 C;  2JCJ A;  4M2A A;  3I0J A;  5CQM X;  1OMX A;  4EEA A;  1H5S B;  3OH4 A;  2V0H A;  1ZJ1 A;  4FRM A;  5I1F A;  2RIZ A;  1H5S C;  1VGU A;  1V82 A;  1FGX A;  3Q7U A;  4C2S A;  4BMA A;  3I0F A;  1ZCU A;  2JCO A;  2YC5 A;  4KC4 A;  2E8B A;  5D92 A;  1H5T B;  3SX8 A;  3SXA A;  4ECM A;  1VM8 A;  4MIX A;  4Y7T A;  4G3P A;  1FG5 N;  1EZI A;  3U2X A;  1YP2 A;  4NAN A;  5C1G A;  5HS2 A;  4CJ8 A;  2VXL A;  3OAM A;  2APC A;  3CGX A;  1ZCY A;  2XWN A;  4G3Q A;  4XWI A;  1TW1 A;  4HO8 A;  1O7Q A;  1MP3 A;  1G2V A;  4JD0 A;  1VH1 A;  4M2B A;  5EJ1 A;  1GA8 A;  1JYL A;  1VIC A;  5FYE A;  4B4M A;  2W0V A;  2YQH A;  1G0R A;  1MC3 A;  4FRQ A;  2OI6 A;  1R82 A;  2RJ6 A;  2FYD B;  4FCE A;  3T7M A;  1W77 A;  2WVL A;  4FRL A;  4Y64 A;  3FWW A;  1GWW A;  1JYK A;  5EIY A;  2WEE A;  2VSH A;  1ZDF A;  1S4N A;  1YRO B;  3DUV A;  2BO7 A;  2ZU8 A;  4FCU A;  1GWV A;  1XHB A;  4HO6 A;  2RIY A;  4NAL A;  1VGZ A;  2Y4M A;  3ZLL A;  3USQ A;  2X5Z A;  5C49 A;  3OC9 A;  3OKR A;  3PKP A;  1ZI1 A;  1H7H A;  4HO0 A;  2MZB A;  1ZI5 A;  2WVM A;  4CJC A;  2V0I A;  2AE7 A;  2XME A;  3SXC A;  2FY7 A;  5DDV A;  5J49 A;  4D11 A;  3O3P A;  2VD4 A;  2OEG A;  2Y4K A;  1ON8 A;  2GGQ A;  2PA4 A;  5CMH A;  5FTS A;  1R80 A;  5C3B A;  4CVH A;  3ZGG A;  1NWG B;  3OH0 A;  3V8Z A;  3V0Q A;  1ZJ0 A;  3CU0 A;  3RMW A;  1V84 A;  2C0N A;  3I0C A;  3U2W A;  2ZU7 A;  1VZU A;  1FO8 A;  2GGO A;  1R7T A;  1LL2 A;  4EEG A;  3CKV A;  1H5R A;  2VFZ A;  2JCL A;  1LZJ A;  4M28 A;  3F1Y A;  1HJJ A;  4ASY A;  3CKQ A;  5C48 A;  4LW3 A;  1ZJP A;  1Z90 A;  3V0P A;  5AJO A;  3QVB A;  4IRP A;  1FXO A;  1W57 A;  3BCV A;  3IOI A;  1H4D A;  3SXE A;  3I0I X;  4UEG A;  3OH3 A;  1R7X A;  4P00 A;  2RJ8 A;  1GQ9 A;  3IOJ A;  4KXO A;  3D98 A;  3OH1 A;  3USR A;  4LW6 A;  2A8U A;  2FFU A;  4EE4 A;  2D7I A;  3U2V A;  2CU2 A;  5FU0 A;  1ZJ3 A;  1GQC A;  4G87 A; 
#chains in the Genus database with same CATH homology
 4FIY A;  1JVG A;  3U2T A;  3FOQ A;  3HL3 A;  4FRB A;  5CQL X;  2I7B A;  3TZT A;  1FR9 A;  2Y6P A;  3CKO A;  2AGD A;  2VK9 A;  3GUE A;  1H7T A;  1G3L A;  4K6R A;  1PZY B;  4HO5 A;  1LZ0 A;  3V0N A;  2X65 A;  3E26 A;  2OEF A;  5CMG X;  2X60 A;  5C4E A;  4O6N A;  4R7P A;  3U0Y A;  2I5K A;  1FXJ A;  3V0M A;  5BXC A;  2FFV A;  4EE3 A;  2XWL A;  4EE5 A;  1FR8 A;  4FRA A;  5FU8 A;  1H7L A;  1ZIZ A;  3RSB A;  5IFY A;  1QGS A;  5C4F A;  2QGI A;  2Z86 A;  3SXB A;  4NAI A;  1G97 A;  1QG8 A;  2XMH A;  2WGZ A;  3D5N A;  4M4K A;  3BRK X;  5FV9 A;  1SS9 A;  3OGZ A;  1TVY A;  1VZT A;  2J0A A;  3TQD A;  4Y7U A;  2D0J A;  2RJ0 A;  4ASJ A;  1R7Y A;  3ZF8 A;  3K8E A;  1INI A;  4KC1 A;  2YQS A;  3SX3 A;  3EE5 A;  1H7Q A;  2W0W A;  1MP5 A;  1LL0 A;  3I0D A;  2V0K A;  2AES A;  1WT3 A;  1H4E A;  4KPZ A;  3F1C A;  4Y7F A;  1QWJ A;  3JUJ A;  1KWS A;  1R81 A;  1GX4 A;  1ON6 A;  4E1K A;  5CMJ A;  3V90 A;  5C1H A;  1MP4 A;  5D91 A;  2YCM A;  1G23 A;  3SXD A;  1FRW A;  3V0O A;  1WT1 A;  4D11 C;  4NAK A;  1YP4 A;  4Y9X A;  1I52 A;  5L6S A;  2BO6 A;  2AEC A;  1V83 A;  3I0H A;  1ZJO A;  2UX8 A;  4AYL A;  2AM4 A;  2VS3 A;  4O6M A;  4FRH A;  1G8O A;  5L6V A;  3Q80 A;  2WE9 A;  4B4G A;  5FTV A;  1YP3 A;  2O1G A;  1LZI A;  2RJ9 A;  4FRD A;  2VS4 A;  3E25 A;  4JIS A;  3K8D A;  4D0T A;  1NQI B;  4Y7V A;  2Z87 A;  1NHE B;  1G1L A;  1VGW A;  1VGT A;  4D48 A;  1VPA A;  2Y7A A;  2Y4J A;  3DJ4 A;  1HM9 A;  5C8R A;  1H7F A;  2QKX A;  3RMV A;  4FIX A;  1O0R A;  2OI5 A;  3LW6 A;  2Q4J A;  1XZ6 A;  1S4O A;  1HV9 A;  3U0X A;  5FUH A;  3T7N A;  3Q4S A;  3I0G A;  1H7G A;  2V0L A;  1G93 A;  4DDZ A;  2E3D A;  1R7U A;  3OH2 A;  4FQW A;  2BO4 A;  2ICY A;  2O1H A;  5C4B A;  4FRO A;  5C4D A;  4B3U A;  3U2U A;  3R3I A;  1TW5 A;  1ZJ2 A;  2RIT A;  4DE7 A;  1WVC A;  4HO3 A;  2FYB A;  3NGW A;  2WAW A;  3SXG A;  1LZ7 A;  5EJZ A;  2VSI A;  3SX7 A;  1HJL A;  2QH5 A;  4KT7 A;  4AYJ A;  4AC3 A;  4IRQ A;  1QGQ A;  5AJN A;  3D8V A;  3V91 A;  4B2W A;  4ARW A;  2YC3 A;  2I5E A;  2AH9 A;  1H5S A;  5CMI A;  1TZF A;  2RIX A;  2ICX A;  4B42 A;  2OI7 A;  2PGV A;  2PGY A;  3I0E A;  1O7O A;  3PNN A;  3N9W A;  1VZX A;  1H3M A;  2VS5 A;  2FYA A;  1H5T A;  4GBP A;  2J0B A;  4KPX A;  4B5B A;  5C3A A;  3ST8 A;  4HCQ A;  2AM3 A;  5JQQ A;  1NF5 B;  1GX0 A;  2NXV A;  5CQN X;  1WT0 A;  2D7R A;  4Y7G A;  3PKQ A;  1H7E A;  4DEC A;  4HG6 A;  5C1L A;  1K4V A;  2P6W A;  2AM5 A;  5IDT A;  4EEO A;  5DDT A;  1INJ A;  1H4C A;  3I0L A;  4HO4 A;  3IOH A;  2RJ7 A;  1FZW A;  4Y6U A;  4MND A;  2P72 A;  2VXM A;  2Y4L A;  2PX7 A;  3KIA A;  1FWY A;  1VH3 A;  3JUK A;  4Q7C A;  2JCK A;  1JV1 A;  2RJ4 A;  2WVK A;  1G95 A;  1JV3 A;  1S4P A;  1OMZ A;  1IIN A;  1OQM B;  2P73 A;  3R2W A;  1LVW A;  4KC2 A;  3T7O A;  3SPT A;  4J18 A;  5C38 A;  4MYB A;  1W55 A;  1IIM A;  5IDS A;  2FYC B;  5CMF X;  2XWM A;  1PZT A;  4Y63 A;  5AJP A;  3DK5 A;  2YQC A;  1ZHJ A;  1E5K A;  3CKJ A;  5CQP A;  4FRP A;  1FGG A;  4EEM A;  1LL3 A;  4ZDQ A;  1JVD A;  4B2X A;  1H5R B;  4BQH A;  1ZI3 A;  4YS8 A;  1O23 B;  2ZU9 A;  3V8Y A;  2X5S A;  2YQJ A;  1FOA A;  4FRE A;  1G9R A;  1WSZ A;  4KQL A;  3V0L A;  1ZI4 A;  1R7V A;  3JTJ A;  1HM0 A;  2DPW A;  4KRV A;  1ZDG A;  2V0J A;  4EVW A;  4HO9 A;  4KNR A;  2O1F A;  5C3D A;  3I0K A;  2A8W A;  4HOC A;  1ZCV A;  1HM8 A;  3POL A;  4KNX A;  4Y62 A;  4D0Z A;  2BO8 A;  3CKN A;  1EYR A;  3ZLK A;  1H5S D;  1ZCT A;  5C4C A;  3ZGF A;  1NKH B;  1FO9 A;  2RJ5 A;  4P02 A;  5C36 A;  2RJ1 A;  1NMM B;  1WT2 A;  2YES A;  4HO2 A;  4CJB A;  4Y6N A;  3SX5 A;  4AAW A;  4B4B A;  5C47 A;  4G3S A;  5CQO A;  4L41 C;  2JCJ A;  4M2A A;  3I0J A;  5CQM X;  1OMX A;  4EEA A;  1H5S B;  3OH4 A;  2V0H A;  1ZJ1 A;  4FRM A;  5I1F A;  2RIZ A;  1H5S C;  1VGU A;  1V82 A;  1FGX A;  3Q7U A;  4C2S A;  4BMA A;  3I0F A;  1ZCU A;  2JCO A;  2YC5 A;  4KC4 A;  2E8B A;  5D92 A;  1H5T B;  3SX8 A;  3SXA A;  4ECM A;  1VM8 A;  4MIX A;  4Y7T A;  4G3P A;  1FG5 N;  1EZI A;  3U2X A;  1YP2 A;  4NAN A;  5C1G A;  5HS2 A;  4CJ8 A;  2VXL A;  3OAM A;  2APC A;  3CGX A;  1ZCY A;  2XWN A;  4G3Q A;  4XWI A;  1TW1 A;  4HO8 A;  1O7Q A;  1MP3 A;  1G2V A;  4JD0 A;  1VH1 A;  4M2B A;  5EJ1 A;  1GA8 A;  1JYL A;  1VIC A;  5FYE A;  4B4M A;  2W0V A;  2YQH A;  1G0R A;  1MC3 A;  4FRQ A;  2OI6 A;  1R82 A;  2RJ6 A;  2FYD B;  4FCE A;  3T7M A;  1W77 A;  2WVL A;  4FRL A;  4Y64 A;  3FWW A;  1GWW A;  1JYK A;  5EIY A;  2WEE A;  2VSH A;  1ZDF A;  1S4N A;  1YRO B;  3DUV A;  2BO7 A;  2ZU8 A;  4FCU A;  1GWV A;  1XHB A;  4HO6 A;  2RIY A;  4NAL A;  1VGZ A;  2Y4M A;  3ZLL A;  3USQ A;  2X5Z A;  5C49 A;  3OC9 A;  3OKR A;  3PKP A;  1ZI1 A;  1H7H A;  4HO0 A;  2MZB A;  1ZI5 A;  2WVM A;  4CJC A;  2V0I A;  2AE7 A;  2XME A;  3SXC A;  2FY7 A;  5DDV A;  5J49 A;  4D11 A;  3O3P A;  2VD4 A;  2OEG A;  2Y4K A;  1ON8 A;  2GGQ A;  2PA4 A;  5CMH A;  5FTS A;  1R80 A;  5C3B A;  4CVH A;  3ZGG A;  1NWG B;  3OH0 A;  3V8Z A;  3V0Q A;  1ZJ0 A;  3CU0 A;  3RMW A;  1V84 A;  2C0N A;  3I0C A;  3U2W A;  2ZU7 A;  1VZU A;  1FO8 A;  2GGO A;  1R7T A;  1LL2 A;  4EEG A;  3CKV A;  1H5R A;  2VFZ A;  2JCL A;  1LZJ A;  4M28 A;  3F1Y A;  1HJJ A;  4ASY A;  3CKQ A;  5C48 A;  4LW3 A;  1ZJP A;  1Z90 A;  3V0P A;  5AJO A;  3QVB A;  4IRP A;  1FXO A;  1W57 A;  3BCV A;  3IOI A;  1H4D A;  3SXE A;  3I0I X;  4UEG A;  3OH3 A;  1R7X A;  4P00 A;  2RJ8 A;  1GQ9 A;  3IOJ A;  4KXO A;  3D98 A;  3OH1 A;  3USR A;  4LW6 A;  2A8U A;  2FFU A;  4EE4 A;  2D7I A;  3U2V A;  2CU2 A;  5FU0 A;  1ZJ3 A;  1GQC A;  4G87 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...