4YS8A

Crystal structure of 2-c-methyl-d-erythritol 4-phosphate cytidylyltransferase (ispd) from burkholderia thailandensis
Total Genus 59
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
59
sequence length
230
structure length
225
Chain Sequence
TSRLFALIPCAGGSALPKQYRTLAGRALLHYTLAAFDACSEFAQTLVVISPDDAHFDARRFAGLRFAVRRCGGASRQASVMNGLIQLAEFGATDADWVLVHDAARPGITPALIRTLIGALKDDPVGGIVALPVADTLKRVPAGGDAIERTESRNGLWQAQTPQMFRIGMLRDAIQRAQLEGRDLTDEASAIEWAGHTPRVVQGSLRNFKVTYPEDFDLAEAILAH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords 2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase
publication title Crystal Structure of 2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase (IspD) from Burkholderia thailandensis
rcsb
source organism Burkholderia thailandensis
total genus 59
structure length 225
sequence length 230
chains with identical sequence B, C, D
ec nomenclature ec 2.7.7.60: 2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase.
pdb deposition date 2015-03-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01128 IspD 2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.550.10 Alpha Beta Alpha-Beta Complex Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A 4ys8A00
1G3LA 3SPTA 3I0JA 4HO6A 1HV9A 2UX8A 1VZXA 1H5SC 3EE5A 1H7EA 1FXOA 5J49A 1R82A 1R80A 2XWNA 3SXEA 3IOIA 1K4VA 2Y6PA 1WT0A 3O3PA 3LW6A 1HM0A 1H5SD 4CJ8A 1ZDGA 4HCQA 2ZU9A 1VGTA 2AE7A 1FGXA 4B3UA 2QGIA 2Y4JA 5CMGX 1GX4A 2O1GA 4NANA 4B42A 2A8WA 4Y62A 3OAMA 3V0PA 3JUJA 4EEGA 4Y64A 3U2VA 4FCUA 3D98A 4HO3A 5C4DA 4FRBA 1PZYB 4G3SA 2YQHA 5CQMX 2FFVA 3K8DA 3RMVA 1KWSA 1OQMB 2GGOA 3ST8A 1G93A 1G95A 3PKPA 1ZIZA 4Y63A 2X5SA 5C3DA 4D11A 3U2TA 1FO8A 1XHBA 2FYBA 1IINA 2P72A 1MP5A 4R7PA 3ZF8A 2ICXA 2YQJA 3OH0A 3PNNA 4CVHA 1FXJA 2RJ0A 1GWWA 3SX7A 5C4CA 4NALA 1V83A 1XZ6A 4J18A 4ARWA 4NAKA 1R7XA 1ZDFA 2ZU8A 4KC2A 1NF5B 4KXOA 2JCLA 4DE7A 4CJCA 1H5TB 1ZCUA 5AJPA 3USRA 4FROA 3FWWA 1GQCA 2V0LA 4FQWA 4HO8A 2Y4LA 1FR9A 4Y7TA 1ZI1A 4B5BA 2JCJA 5JQQA 1ZJ2A 3SX5A 1HM8A 3V0NA 2BO8A 3E26A 3TZTA 1IIMA 1YP3A 5C49A 4DECA 4EE3A 2OEFA 5CQNX 1O23B 1JYLA 5C1LA 3FOQA 4JD0A 3SXGA 1MC3A 1VGWA 4AYLA 3SXDA 1O0RA 1ZI5A 5EJ1A 2ICYA 3USQA 3ZGFA 1HJLA 1VPAA 2PA4A 1NWGB 2RJ8A 1VH1A 4M28A 1O7OA 1VGZA 4EEOA 2O1FA 2YCMA 3I0DA 1LZJA 5FTVA 1ZI4A 5EJZA 3BRKX 3CKVA 5CQLX 2Y7AA 3POLA 3V8YA 3OC9A 3T7NA 4G87A 4LW3A 2Z87A 1H7LA 3ZGGA 4ZDQA 3DK5A 5BXCA 2YQCA 4B4GA 5HS2A 4B2WA 1ZCYA 3SX8A 4HOCA 5I1FA 2AESA 4Y7UA 2OEGA 2VS4A 5IDSA 1ZJ3A 4DDZA 5C36A 2RJ7A 5CMIA 1G8OA 3OGZA 4IRQA 2MZBA 3V0QA 3QVBA 4FRMA 3I0LA 1V82A 3CKJA 3E25A 1H7HA 1H7QA 2W0WA 5C47A 5C38A 2I7BA 4E1KA 2YESA 5CMHA 1JV1A 1EZIA 2E8BA 2Y4KA 1LL0A 1ZJOA 4KPXA 4B4MA 1WSZA 1QG8A 1H4DA 1O7QA 3OH4A 1R7UA 3T7MA 4EE4A 3V8ZA 3CU0A 3OH2A 4D48A 5DDTA 3I0IX 3T7OA 3N9WA 3SXAA 2RJ9A 5C3BA 2XMEA 1G0RA 2VFZA 3GUEA 4FRDA 1FR8A 1MP4A 1H4CA 2APCA 4FREA 2AECA 2D7IA 3Q7UA 4FRPA 2BO6A 1TVYA 2RIZA 3U2UA 1FRWA 1MP3A 1W77A 3V91A 1ZHJA 2WEEA 2VXMA 2W0VA 1SS9A 3DJ4A 5FYEA 2V0HA 2FY7A 3KIAA 3PKQA 1S4OA 2PGVA 4KPZA 3ZLLA 3V90A 1V84A 1YP4A 2Y4MA 4AYJA 3R3IA 1NMMB 2AM5A 4EVWA 5FU8A 4P00A 2QKXA 1TW5A 4B4BA 1YROB 1VICA 2JCKA 3I0KA 4CJBA 1ZCTA 1QGSA 2FYAA 3U2XA 4HO5A 2AGDA 4L41C 1ZI3A 5CQOA 3OKRA 2XWLA 1EYRA 4B2XA 1VM8A 2FYDB 4KNRA 3ZLKA 4LW6A 3F1CA 3JTJA 2BO4A 2VSHA 2X60A 2VXLA 5L6VA 3SX3A 2I5EA 1H5RA 2AM3A 5L6SA 4KT7A 2O1HA 2V0JA 1FWYA 1TZFA 3CGXA 2QH5A 1JVDA 1PZTA 3V0OA 5AJOA 5C8RA 4Y7FA 4FRQA 2FYCB 2GGQA 2YQSA 4KNXA 4HO0A 2NXVA 1H7GA 2RIYA 3D8VA 1LVWA 4FRLA 3RSBA 4JISA 1ZJ0A 1R81A 5C4FA 2WE9A 4P02A 4ECMA 1YP2A 1W55A 1H3MA 4D11C 1OMXA 4Y7GA 1VH3A 1R7YA 3CKNA 1ON6A 2PGYA 2OI7A 2I5KA 1VZUA 3U0YA 1H7FA 2Z86A 5CQPA 5FU0A 2CU2A 5C1GA 3I0EA 2E3DA 1R7TA 2PX7A 4HO4A 4Y6NA 2XMHA 4BMAA 4GBPA 4HG6A 1QGQA 5AJNA 4AAWA 1Z90A 3I0HA 1S4PA 1LZ7A 3NGWA 5FTSA 1ON8A 2JCOA 2FFUA 2D0JA 5C3AA 2AH9A 2VD4A 4UEGA 4M2AA 4FRAA 3U0XA 1H5RB 5C4BA 2XWMA 4ASYA 1LZIA 3I0GA 2WVMA 4EEAA 1LZ0A 1GA8A 1H5SA 2RJ1A 3RMWA 1R7VA 1E5KA 5IDTA 3CKQA 1TW1A 1G23A 1S4NA 2VS5A 2VSIA 2DPWA 1VZTA 3OH1A 4Y6UA 4M2BA 1JVGA 1ZCVA 3U2WA 5EIYA 2OI5A 3CKOA 1W57A 3I0CA 2X5ZA 1HJJA 2P6WA 1G2VA 1ZJ1A 3DUVA 3F1YA 4KC4A 3JUKA 5CMFX 2A8UA 4ASJA 1G97A 2AM4A 3K8EA 1GWVA 1FG5N 1WVCA 5FUHA 1NHEB 2Q4JA 1FO9A 3SXBA 3R2WA 2BO7A 2WGZA 2WAWA 2VS3A 2RIXA 1JV3A 2RJ4A 3IOHA 1LL2A 2P73A 2V0IA 4EE5A 2RITA 4K6RA 1H7TA 4BQHA 3OH3A 2RJ5A 1H4EA 5IFYA 4EEMA 1WT2A 4Y9XA 4G3QA 1FZWA 4XWIA 3BCVA 3Q80A 3IOJA 2D7RA 3TQDA 4G3PA 1JYKA 2WVLA 4HO2A 1INIA 5DDVA 3SXCA 4FRHA 4D0TA 5C1HA 1G1LA 4IRPA 5C4EA 4M4KA 4MYBA 1FOAA 1QWJA 5C48A 2OI6A 2X65A 4HO9A 1FGGA 1H5SB 2RJ6A 2YC3A 4KC1A 1HM9A 4NAIA 4FCEA 2ZU7A 1OMZA 5FV9A 1WT1A 4Y7VA 3V0LA 1GX0A 3HL3A 4KQLA 5CMJA 4AC3A 2V0KA 3Q4SA 1GQ9A 3D5NA 1WT3A 4D0ZA 4KRVA 2WVKA 3V0MA 1G9RA 1I52A 4MNDA 4YS8A 4C2SA 1ZJPA 1LL3A 1VGUA 2YC5A 1NKHB 1H5TA 1NQIB 3I0FA 1INJA
chains in the Genus database with same CATH superfamily
1G3LA 3SPTA 3I0JA 4HO6A 1HV9A 2UX8A 1VZXA 1H5SC 3EE5A 1H7EA 1FXOA 5J49A 1R82A 4FIXA 1R80A 2XWNA 3SXEA 3IOIA 1K4VA 2Y6PA 1WT0A 3O3PA 3LW6A 1HM0A 1H5SD 4CJ8A 1ZDGA 4HCQA 2ZU9A 1VGTA 2AE7A 1FGXA 4O6MA 4B3UA 2QGIA 2Y4JA 5CMGX 1GX4A 2O1GA 4NANA 4B42A 2A8WA 4Y62A 3OAMA 3V0PA 3JUJA 4EEGA 4Y64A 3U2VA 4FCUA 3D98A 4HO3A 5C4DA 4FRBA 1PZYB 4G3SA 2YQHA 5CQMX 2FFVA 3K8DA 3RMVA 1KWSA 1OQMB 2GGOA 3ST8A 1G93A 1G95A 3PKPA 1ZIZA 4Y63A 2X5SA 5C3DA 4D11A 3U2TA 1FO8A 1XHBA 2FYBA 1IINA 2P72A 1MP5A 4R7PA 3ZF8A 2ICXA 2YQJA 3OH0A 3PNNA 4CVHA 1FXJA 2RJ0A 1GWWA 3SX7A 5C4CA 4NALA 1V83A 1XZ6A 4J18A 4ARWA 4NAKA 1R7XA 1ZDFA 2ZU8A 4KC2A 1NF5B 4KXOA 2JCLA 4DE7A 4CJCA 1H5TB 1ZCUA 5AJPA 3USRA 4FROA 3FWWA 1GQCA 2V0LA 4FQWA 4HO8A 2Y4LA 1FR9A 4Y7TA 1ZI1A 4B5BA 2JCJA 5JQQA 1ZJ2A 3SX5A 1HM8A 3V0NA 2BO8A 2VK9A 3E26A 3TZTA 1IIMA 1YP3A 5C49A 4DECA 4EE3A 2OEFA 5CQNX 1O23B 1JYLA 5C1LA 3FOQA 4JD0A 3SXGA 1MC3A 1VGWA 4AYLA 3SXDA 1O0RA 1ZI5A 5EJ1A 2ICYA 3USQA 3ZGFA 1HJLA 1VPAA 2PA4A 1NWGB 2RJ8A 1VH1A 4M28A 1O7OA 1VGZA 4EEOA 2O1FA 2YCMA 3I0DA 1LZJA 5FTVA 1ZI4A 5EJZA 3BRKX 3CKVA 5CQLX 2Y7AA 3POLA 3V8YA 3OC9A 3T7NA 4MIXA 4G87A 4LW3A 2Z87A 1H7LA 3ZGGA 4ZDQA 3DK5A 5BXCA 2YQCA 4B4GA 5HS2A 4B2WA 1ZCYA 3SX8A 4HOCA 5I1FA 2AESA 4Y7UA 2OEGA 2VS4A 5IDSA 1ZJ3A 4DDZA 5C36A 2RJ7A 5CMIA 1G8OA 3OGZA 4IRQA 2MZBA 3V0QA 3QVBA 4FRMA 3I0LA 1V82A 3CKJA 3E25A 1H7HA 1H7QA 2W0WA 5C47A 5C38A 2I7BA 4E1KA 2YESA 5CMHA 1JV1A 1EZIA 2E8BA 2Y4KA 1LL0A 1ZJOA 4KPXA 4B4MA 1WSZA 1QG8A 1H4DA 1O7QA 3OH4A 1R7UA 3T7MA 4EE4A 3V8ZA 3CU0A 3OH2A 4D48A 5DDTA 3I0IX 3T7OA 3N9WA 3SXAA 2RJ9A 5C3BA 2XMEA 1G0RA 2VFZA 5D91A 5D92A 3GUEA 4Q7CA 4FRDA 1FR8A 1MP4A 1H4CA 2APCA 4FREA 2AECA 2D7IA 3Q7UA 4FRPA 2BO6A 1TVYA 2RIZA 3U2UA 1FRWA 1MP3A 1W77A 3V91A 1ZHJA 2WEEA 2VXMA 2W0VA 1SS9A 3DJ4A 5FYEA 2V0HA 2FY7A 3KIAA 3PKQA 1S4OA 2PGVA 4KPZA 3ZLLA 3V90A 1V84A 1YP4A 2Y4MA 4AYJA 3R3IA 1NMMB 2AM5A 4EVWA 5FU8A 4P00A 2QKXA 1TW5A 4B4BA 1YROB 1VICA 2JCKA 3I0KA 4CJBA 1ZCTA 1QGSA 2FYAA 3U2XA 4HO5A 2AGDA 4L41C 1ZI3A 5CQOA 3OKRA 2XWLA 1EYRA 4B2XA 1VM8A 2FYDB 4KNRA 3ZLKA 4LW6A 3F1CA 3JTJA 2BO4A 2J0BA 2VSHA 2X60A 2VXLA 5L6VA 3SX3A 2I5EA 1H5RA 2AM3A 5L6SA 4KT7A 2O1HA 2V0JA 1FWYA 1TZFA 3CGXA 2QH5A 1JVDA 1PZTA 3V0OA 5AJOA 5C8RA 4Y7FA 4FRQA 2FYCB 2GGQA 2YQSA 4KNXA 4HO0A 2NXVA 1H7GA 2RIYA 3D8VA 1LVWA 4FRLA 3RSBA 4JISA 1ZJ0A 1R81A 5C4FA 2WE9A 4P02A 4ECMA 1YP2A 1W55A 1H3MA 4D11C 1OMXA 4Y7GA 1VH3A 1R7YA 3CKNA 1ON6A 2PGYA 2OI7A 2C0NA 2I5KA 1VZUA 3U0YA 1H7FA 2Z86A 5CQPA 5FU0A 2CU2A 5C1GA 3I0EA 2E3DA 1R7TA 2PX7A 4HO4A 4Y6NA 2XMHA 4BMAA 4GBPA 4HG6A 1QGQA 5AJNA 4AAWA 1Z90A 3I0HA 2J0AA 1S4PA 1LZ7A 3NGWA 5FTSA 1ON8A 2JCOA 2FFUA 2D0JA 5C3AA 2AH9A 2VD4A 4UEGA 4M2AA 4FRAA 3U0XA 1H5RB 5C4BA 2XWMA 4ASYA 1LZIA 3I0GA 2WVMA 4EEAA 1LZ0A 1GA8A 4FIYA 1H5SA 2RJ1A 3RMWA 1R7VA 1E5KA 5IDTA 3CKQA 1TW1A 1G23A 1S4NA 2VS5A 2VSIA 2DPWA 1VZTA 3OH1A 4Y6UA 4O6NA 4M2BA 1JVGA 1ZCVA 3U2WA 5EIYA 2OI5A 3CKOA 1W57A 3I0CA 2X5ZA 1HJJA 2P6WA 1G2VA 1ZJ1A 3DUVA 3F1YA 4KC4A 3JUKA 5CMFX 2A8UA 4ASJA 1G97A 2AM4A 3K8EA 1GWVA 1FG5N 1WVCA 5FUHA 1NHEB 2Q4JA 1FO9A 3SXBA 3R2WA 2BO7A 2WGZA 2WAWA 2VS3A 2RIXA 1JV3A 2RJ4A 3IOHA 1LL2A 2P73A 2V0IA 4EE5A 2RITA 4K6RA 1H7TA 4BQHA 3OH3A 2RJ5A 1H4EA 5IFYA 4EEMA 1WT2A 4Y9XA 4G3QA 1FZWA 4XWIA 3BCVA 3Q80A 3IOJA 2D7RA 3TQDA 4G3PA 1JYKA 2WVLA 4HO2A 1INIA 5DDVA 3SXCA 4FRHA 4D0TA 5C1HA 1G1LA 4IRPA 5C4EA 4M4KA 4MYBA 1FOAA 1QWJA 5C48A 2OI6A 2X65A 4HO9A 1FGGA 1H5SB 2RJ6A 2YC3A 4KC1A 1HM9A 4NAIA 4FCEA 2ZU7A 1OMZA 5FV9A 1WT1A 4Y7VA 3V0LA 1GX0A 3HL3A 4KQLA 5CMJA 4AC3A 2V0KA 3Q4SA 1GQ9A 3D5NA 1WT3A 4D0ZA 4KRVA 2WVKA 3V0MA 1G9RA 1I52A 4MNDA 4YS8A 4C2SA 1ZJPA 1LL3A 1VGUA 2YC5A 1NKHB 1H5TA 1NQIB 3I0FA 1INJA
chains in the Genus database with same CATH topology
1G3LA 3SPTA 3I0JA 4HO6A 1HV9A 2UX8A 1VZXA 1H5SC 3EE5A 1H7EA 1FXOA 5J49A 1R82A 4FIXA 1R80A 2XWNA 3SXEA 3IOIA 1K4VA 2Y6PA 1WT0A 3O3PA 3LW6A 1HM0A 1H5SD 4CJ8A 1ZDGA 4HCQA 2ZU9A 1VGTA 2AE7A 1FGXA 4O6MA 4B3UA 2QGIA 2Y4JA 5CMGX 1GX4A 2O1GA 4NANA 4B42A 2A8WA 4Y62A 3OAMA 3V0PA 3JUJA 4EEGA 4Y64A 3U2VA 4FCUA 3D98A 4HO3A 5C4DA 4FRBA 1PZYB 4G3SA 2YQHA 5CQMX 2FFVA 3K8DA 3RMVA 1KWSA 1OQMB 2GGOA 3ST8A 1G93A 1G95A 3PKPA 1ZIZA 4Y63A 2X5SA 5C3DA 4D11A 3U2TA 1FO8A 1XHBA 2FYBA 1IINA 2P72A 1MP5A 4R7PA 3ZF8A 2ICXA 2YQJA 3OH0A 3PNNA 4CVHA 1FXJA 2RJ0A 1GWWA 3SX7A 5C4CA 4NALA 1V83A 1XZ6A 4J18A 4ARWA 4NAKA 1R7XA 1ZDFA 2ZU8A 4KC2A 1NF5B 4KXOA 2JCLA 4DE7A 4CJCA 1H5TB 1ZCUA 5AJPA 3USRA 4FROA 3FWWA 1GQCA 2V0LA 4FQWA 4HO8A 2Y4LA 1FR9A 4Y7TA 1ZI1A 4B5BA 2JCJA 5JQQA 1ZJ2A 3SX5A 1HM8A 3V0NA 2BO8A 2VK9A 3E26A 3TZTA 1IIMA 1YP3A 5C49A 4DECA 4EE3A 2OEFA 5CQNX 1O23B 1JYLA 5C1LA 3FOQA 4JD0A 3SXGA 1MC3A 1VGWA 4AYLA 3SXDA 1O0RA 1ZI5A 5EJ1A 2ICYA 3USQA 3ZGFA 1HJLA 1VPAA 2PA4A 1NWGB 2RJ8A 1VH1A 4M28A 1O7OA 1VGZA 4EEOA 2O1FA 2YCMA 3I0DA 1LZJA 5FTVA 1ZI4A 5EJZA 3BRKX 3CKVA 5CQLX 2Y7AA 3POLA 3V8YA 3OC9A 3T7NA 4MIXA 4G87A 4LW3A 2Z87A 1H7LA 3ZGGA 4ZDQA 3DK5A 5BXCA 2YQCA 4B4GA 5HS2A 4B2WA 1ZCYA 3SX8A 4HOCA 5I1FA 2AESA 4Y7UA 2OEGA 2VS4A 5IDSA 1ZJ3A 4DDZA 5C36A 2RJ7A 5CMIA 1G8OA 3OGZA 4IRQA 2MZBA 3V0QA 3QVBA 4FRMA 3I0LA 1V82A 3CKJA 3E25A 1H7HA 1H7QA 2W0WA 5C47A 5C38A 2I7BA 4E1KA 2YESA 5CMHA 1JV1A 1EZIA 2E8BA 2Y4KA 1LL0A 1ZJOA 4KPXA 4B4MA 1WSZA 1QG8A 1H4DA 1O7QA 3OH4A 1R7UA 3T7MA 4EE4A 3V8ZA 3CU0A 3OH2A 4D48A 5DDTA 3I0IX 3T7OA 3N9WA 3SXAA 2RJ9A 5C3BA 2XMEA 1G0RA 2VFZA 5D91A 5D92A 3GUEA 4Q7CA 4FRDA 1FR8A 1MP4A 1H4CA 2APCA 4FREA 2AECA 2D7IA 3Q7UA 4FRPA 2BO6A 1TVYA 2RIZA 3U2UA 1FRWA 1MP3A 1W77A 3V91A 1ZHJA 2WEEA 2VXMA 2W0VA 1SS9A 3DJ4A 5FYEA 2V0HA 2FY7A 3KIAA 3PKQA 1S4OA 2PGVA 4KPZA 3ZLLA 3V90A 1V84A 1YP4A 2Y4MA 4AYJA 3R3IA 1NMMB 2AM5A 4EVWA 5FU8A 4P00A 2QKXA 1TW5A 4B4BA 1YROB 1VICA 2JCKA 3I0KA 4CJBA 1ZCTA 1QGSA 2FYAA 3U2XA 4HO5A 2AGDA 4L41C 1ZI3A 5CQOA 3OKRA 2XWLA 1EYRA 4B2XA 1VM8A 2FYDB 4KNRA 3ZLKA 4LW6A 3F1CA 3JTJA 2BO4A 2J0BA 2VSHA 2X60A 2VXLA 5L6VA 3SX3A 2I5EA 1H5RA 2AM3A 5L6SA 4KT7A 2O1HA 2V0JA 1FWYA 1TZFA 3CGXA 2QH5A 1JVDA 1PZTA 3V0OA 5AJOA 5C8RA 4Y7FA 4FRQA 2FYCB 2GGQA 2YQSA 4KNXA 4HO0A 2NXVA 1H7GA 2RIYA 3D8VA 1LVWA 4FRLA 3RSBA 4JISA 1ZJ0A 1R81A 5C4FA 2WE9A 4P02A 4ECMA 1YP2A 1W55A 1H3MA 4D11C 1OMXA 4Y7GA 1VH3A 1R7YA 3CKNA 1ON6A 2PGYA 2OI7A 2C0NA 2I5KA 1VZUA 3U0YA 1H7FA 2Z86A 5CQPA 5FU0A 2CU2A 5C1GA 3I0EA 2E3DA 1R7TA 2PX7A 4HO4A 4Y6NA 2XMHA 4BMAA 4GBPA 4HG6A 1QGQA 5AJNA 4AAWA 1Z90A 3I0HA 2J0AA 1S4PA 1LZ7A 3NGWA 5FTSA 1ON8A 2JCOA 2FFUA 2D0JA 5C3AA 2AH9A 2VD4A 4UEGA 4M2AA 4FRAA 3U0XA 1H5RB 5C4BA 2XWMA 4ASYA 1LZIA 3I0GA 2WVMA 4EEAA 1LZ0A 1GA8A 4FIYA 1H5SA 2RJ1A 3RMWA 1R7VA 1E5KA 5IDTA 3CKQA 1TW1A 1G23A 1S4NA 2VS5A 2VSIA 2DPWA 1VZTA 3OH1A 4Y6UA 4O6NA 4M2BA 1JVGA 1ZCVA 3U2WA 5EIYA 2OI5A 3CKOA 1W57A 3I0CA 2X5ZA 1HJJA 2P6WA 1G2VA 1ZJ1A 3DUVA 3F1YA 4KC4A 3JUKA 5CMFX 2A8UA 4ASJA 1G97A 2AM4A 3K8EA 1GWVA 1FG5N 1WVCA 5FUHA 1NHEB 2Q4JA 1FO9A 3SXBA 3R2WA 2BO7A 2WGZA 2WAWA 2VS3A 2RIXA 1JV3A 2RJ4A 3IOHA 1LL2A 2P73A 2V0IA 4EE5A 2RITA 4K6RA 1H7TA 4BQHA 3OH3A 2RJ5A 1H4EA 5IFYA 4EEMA 1WT2A 4Y9XA 4G3QA 1FZWA 4XWIA 3BCVA 3Q80A 3IOJA 2D7RA 3TQDA 4G3PA 1JYKA 2WVLA 4HO2A 1INIA 5DDVA 3SXCA 4FRHA 4D0TA 5C1HA 1G1LA 4IRPA 5C4EA 4M4KA 4MYBA 1FOAA 1QWJA 5C48A 2OI6A 2X65A 4HO9A 1FGGA 1H5SB 2RJ6A 2YC3A 4KC1A 1HM9A 4NAIA 4FCEA 2ZU7A 1OMZA 5FV9A 1WT1A 4Y7VA 3V0LA 1GX0A 3HL3A 4KQLA 5CMJA 4AC3A 2V0KA 3Q4SA 1GQ9A 3D5NA 1WT3A 4D0ZA 4KRVA 2WVKA 3V0MA 1G9RA 1I52A 4MNDA 4YS8A 4C2SA 1ZJPA 1LL3A 1VGUA 2YC5A 1NKHB 1H5TA 1NQIB 3I0FA 1INJA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1G3L A;  3SPT A;  3I0J A;  4HO6 A;  1HV9 A;  2UX8 A;  1VZX A;  1H5S C;  3EE5 A;  1H7E A;  1FXO A;  5J49 A;  1R82 A;  1R80 A;  2XWN A;  3SXE A;  3IOI A;  1K4V A;  2Y6P A;  1WT0 A;  3O3P A;  3LW6 A;  1HM0 A;  1H5S D;  4CJ8 A;  1ZDG A;  4HCQ A;  2ZU9 A;  1VGT A;  2AE7 A;  1FGX A;  4B3U A;  2QGI A;  2Y4J A;  5CMG X;  1GX4 A;  2O1G A;  4NAN A;  4B42 A;  2A8W A;  4Y62 A;  3OAM A;  3V0P A;  3JUJ A;  4EEG A;  4Y64 A;  3U2V A;  4FCU A;  3D98 A;  4HO3 A;  5C4D A;  4FRB A;  1PZY B;  4G3S A;  2YQH A;  5CQM X;  2FFV A;  3K8D A;  3RMV A;  1KWS A;  1OQM B;  2GGO A;  3ST8 A;  1G93 A;  1G95 A;  3PKP A;  1ZIZ A;  4Y63 A;  2X5S A;  5C3D A;  4D11 A;  3U2T A;  1FO8 A;  1XHB A;  2FYB A;  1IIN A;  2P72 A;  1MP5 A;  4R7P A;  3ZF8 A;  2ICX A;  2YQJ A;  3OH0 A;  3PNN A;  4CVH A;  1FXJ A;  2RJ0 A;  1GWW A;  3SX7 A;  5C4C A;  4NAL A;  1V83 A;  1XZ6 A;  4J18 A;  4ARW A;  4NAK A;  1R7X A;  1ZDF A;  2ZU8 A;  4KC2 A;  1NF5 B;  4KXO A;  2JCL A;  4DE7 A;  4CJC A;  1H5T B;  1ZCU A;  5AJP A;  3USR A;  4FRO A;  3FWW A;  1GQC A;  2V0L A;  4FQW A;  4HO8 A;  2Y4L A;  1FR9 A;  4Y7T A;  1ZI1 A;  4B5B A;  2JCJ A;  5JQQ A;  1ZJ2 A;  3SX5 A;  1HM8 A;  3V0N A;  2BO8 A;  3E26 A;  3TZT A;  1IIM A;  1YP3 A;  5C49 A;  4DEC A;  4EE3 A;  2OEF A;  5CQN X;  1O23 B;  1JYL A;  5C1L A;  3FOQ A;  4JD0 A;  3SXG A;  1MC3 A;  1VGW A;  4AYL A;  3SXD A;  1O0R A;  1ZI5 A;  5EJ1 A;  2ICY A;  3USQ A;  3ZGF A;  1HJL A;  1VPA A;  2PA4 A;  1NWG B;  2RJ8 A;  1VH1 A;  4M28 A;  1O7O A;  1VGZ A;  4EEO A;  2O1F A;  2YCM A;  3I0D A;  1LZJ A;  5FTV A;  1ZI4 A;  5EJZ A;  3BRK X;  3CKV A;  5CQL X;  2Y7A A;  3POL A;  3V8Y A;  3OC9 A;  3T7N A;  4G87 A;  4LW3 A;  2Z87 A;  1H7L A;  3ZGG A;  4ZDQ A;  3DK5 A;  5BXC A;  2YQC A;  4B4G A;  5HS2 A;  4B2W A;  1ZCY A;  3SX8 A;  4HOC A;  5I1F A;  2AES A;  4Y7U A;  2OEG A;  2VS4 A;  5IDS A;  1ZJ3 A;  4DDZ A;  5C36 A;  2RJ7 A;  5CMI A;  1G8O A;  3OGZ A;  4IRQ A;  2MZB A;  3V0Q A;  3QVB A;  4FRM A;  3I0L A;  1V82 A;  3CKJ A;  3E25 A;  1H7H A;  1H7Q A;  2W0W A;  5C47 A;  5C38 A;  2I7B A;  4E1K A;  2YES A;  5CMH A;  1JV1 A;  1EZI A;  2E8B A;  2Y4K A;  1LL0 A;  1ZJO A;  4KPX A;  4B4M A;  1WSZ A;  1QG8 A;  1H4D A;  1O7Q A;  3OH4 A;  1R7U A;  3T7M A;  4EE4 A;  3V8Z A;  3CU0 A;  3OH2 A;  4D48 A;  5DDT A;  3I0I X;  3T7O A;  3N9W A;  3SXA A;  2RJ9 A;  5C3B A;  2XME A;  1G0R A;  2VFZ A;  3GUE A;  4FRD A;  1FR8 A;  1MP4 A;  1H4C A;  2APC A;  4FRE A;  2AEC A;  2D7I A;  3Q7U A;  4FRP A;  2BO6 A;  1TVY A;  2RIZ A;  3U2U A;  1FRW A;  1MP3 A;  1W77 A;  3V91 A;  1ZHJ A;  2WEE A;  2VXM A;  2W0V A;  1SS9 A;  3DJ4 A;  5FYE A;  2V0H A;  2FY7 A;  3KIA A;  3PKQ A;  1S4O A;  2PGV A;  4KPZ A;  3ZLL A;  3V90 A;  1V84 A;  1YP4 A;  2Y4M A;  4AYJ A;  3R3I A;  1NMM B;  2AM5 A;  4EVW A;  5FU8 A;  4P00 A;  2QKX A;  1TW5 A;  4B4B A;  1YRO B;  1VIC A;  2JCK A;  3I0K A;  4CJB A;  1ZCT A;  1QGS A;  2FYA A;  3U2X A;  4HO5 A;  2AGD A;  4L41 C;  1ZI3 A;  5CQO A;  3OKR A;  2XWL A;  1EYR A;  4B2X A;  1VM8 A;  2FYD B;  4KNR A;  3ZLK A;  4LW6 A;  3F1C A;  3JTJ A;  2BO4 A;  2VSH A;  2X60 A;  2VXL A;  5L6V A;  3SX3 A;  2I5E A;  1H5R A;  2AM3 A;  5L6S A;  4KT7 A;  2O1H A;  2V0J A;  1FWY A;  1TZF A;  3CGX A;  2QH5 A;  1JVD A;  1PZT A;  3V0O A;  5AJO A;  5C8R A;  4Y7F A;  4FRQ A;  2FYC B;  2GGQ A;  2YQS A;  4KNX A;  4HO0 A;  2NXV A;  1H7G A;  2RIY A;  3D8V A;  1LVW A;  4FRL A;  3RSB A;  4JIS A;  1ZJ0 A;  1R81 A;  5C4F A;  2WE9 A;  4P02 A;  4ECM A;  1YP2 A;  1W55 A;  1H3M A;  4D11 C;  1OMX A;  4Y7G A;  1VH3 A;  1R7Y A;  3CKN A;  1ON6 A;  2PGY A;  2OI7 A;  2I5K A;  1VZU A;  3U0Y A;  1H7F A;  2Z86 A;  5CQP A;  5FU0 A;  2CU2 A;  5C1G A;  3I0E A;  2E3D A;  1R7T A;  2PX7 A;  4HO4 A;  4Y6N A;  2XMH A;  4BMA A;  4GBP A;  4HG6 A;  1QGQ A;  5AJN A;  4AAW A;  1Z90 A;  3I0H A;  1S4P A;  1LZ7 A;  3NGW A;  5FTS A;  1ON8 A;  2JCO A;  2FFU A;  2D0J A;  5C3A A;  2AH9 A;  2VD4 A;  4UEG A;  4M2A A;  4FRA A;  3U0X A;  1H5R B;  5C4B A;  2XWM A;  4ASY A;  1LZI A;  3I0G A;  2WVM A;  4EEA A;  1LZ0 A;  1GA8 A;  1H5S A;  2RJ1 A;  3RMW A;  1R7V A;  1E5K A;  5IDT A;  3CKQ A;  1TW1 A;  1G23 A;  1S4N A;  2VS5 A;  2VSI A;  2DPW A;  1VZT A;  3OH1 A;  4Y6U A;  4M2B A;  1JVG A;  1ZCV A;  3U2W A;  5EIY A;  2OI5 A;  3CKO A;  1W57 A;  3I0C A;  2X5Z A;  1HJJ A;  2P6W A;  1G2V A;  1ZJ1 A;  3DUV A;  3F1Y A;  4KC4 A;  3JUK A;  5CMF X;  2A8U A;  4ASJ A;  1G97 A;  2AM4 A;  3K8E A;  1GWV A;  1FG5 N;  1WVC A;  5FUH A;  1NHE B;  2Q4J A;  1FO9 A;  3SXB A;  3R2W A;  2BO7 A;  2WGZ A;  2WAW A;  2VS3 A;  2RIX A;  1JV3 A;  2RJ4 A;  3IOH A;  1LL2 A;  2P73 A;  2V0I A;  4EE5 A;  2RIT A;  4K6R A;  1H7T A;  4BQH A;  3OH3 A;  2RJ5 A;  1H4E A;  5IFY A;  4EEM A;  1WT2 A;  4Y9X A;  4G3Q A;  1FZW A;  4XWI A;  3BCV A;  3Q80 A;  3IOJ A;  2D7R A;  3TQD A;  4G3P A;  1JYK A;  2WVL A;  4HO2 A;  1INI A;  5DDV A;  3SXC A;  4FRH A;  4D0T A;  5C1H A;  1G1L A;  4IRP A;  5C4E A;  4M4K A;  4MYB A;  1FOA A;  1QWJ A;  5C48 A;  2OI6 A;  2X65 A;  4HO9 A;  1FGG A;  1H5S B;  2RJ6 A;  2YC3 A;  4KC1 A;  1HM9 A;  4NAI A;  4FCE A;  2ZU7 A;  1OMZ A;  5FV9 A;  1WT1 A;  4Y7V A;  3V0L A;  1GX0 A;  3HL3 A;  4KQL A;  5CMJ A;  4AC3 A;  2V0K A;  3Q4S A;  1GQ9 A;  3D5N A;  1WT3 A;  4D0Z A;  4KRV A;  2WVK A;  3V0M A;  1G9R A;  1I52 A;  4MND A;  4YS8 A;  4C2S A;  1ZJP A;  1LL3 A;  1VGU A;  2YC5 A;  1NKH B;  1H5T A;  1NQI B;  3I0F A;  1INJ A; 
#chains in the Genus database with same CATH topology
 1G3L A;  3SPT A;  3I0J A;  4HO6 A;  1HV9 A;  2UX8 A;  1VZX A;  1H5S C;  3EE5 A;  1H7E A;  1FXO A;  5J49 A;  1R82 A;  4FIX A;  1R80 A;  2XWN A;  3SXE A;  3IOI A;  1K4V A;  2Y6P A;  1WT0 A;  3O3P A;  3LW6 A;  1HM0 A;  1H5S D;  4CJ8 A;  1ZDG A;  4HCQ A;  2ZU9 A;  1VGT A;  2AE7 A;  1FGX A;  4O6M A;  4B3U A;  2QGI A;  2Y4J A;  5CMG X;  1GX4 A;  2O1G A;  4NAN A;  4B42 A;  2A8W A;  4Y62 A;  3OAM A;  3V0P A;  3JUJ A;  4EEG A;  4Y64 A;  3U2V A;  4FCU A;  3D98 A;  4HO3 A;  5C4D A;  4FRB A;  1PZY B;  4G3S A;  2YQH A;  5CQM X;  2FFV A;  3K8D A;  3RMV A;  1KWS A;  1OQM B;  2GGO A;  3ST8 A;  1G93 A;  1G95 A;  3PKP A;  1ZIZ A;  4Y63 A;  2X5S A;  5C3D A;  4D11 A;  3U2T A;  1FO8 A;  1XHB A;  2FYB A;  1IIN A;  2P72 A;  1MP5 A;  4R7P A;  3ZF8 A;  2ICX A;  2YQJ A;  3OH0 A;  3PNN A;  4CVH A;  1FXJ A;  2RJ0 A;  1GWW A;  3SX7 A;  5C4C A;  4NAL A;  1V83 A;  1XZ6 A;  4J18 A;  4ARW A;  4NAK A;  1R7X A;  1ZDF A;  2ZU8 A;  4KC2 A;  1NF5 B;  4KXO A;  2JCL A;  4DE7 A;  4CJC A;  1H5T B;  1ZCU A;  5AJP A;  3USR A;  4FRO A;  3FWW A;  1GQC A;  2V0L A;  4FQW A;  4HO8 A;  2Y4L A;  1FR9 A;  4Y7T A;  1ZI1 A;  4B5B A;  2JCJ A;  5JQQ A;  1ZJ2 A;  3SX5 A;  1HM8 A;  3V0N A;  2BO8 A;  2VK9 A;  3E26 A;  3TZT A;  1IIM A;  1YP3 A;  5C49 A;  4DEC A;  4EE3 A;  2OEF A;  5CQN X;  1O23 B;  1JYL A;  5C1L A;  3FOQ A;  4JD0 A;  3SXG A;  1MC3 A;  1VGW A;  4AYL A;  3SXD A;  1O0R A;  1ZI5 A;  5EJ1 A;  2ICY A;  3USQ A;  3ZGF A;  1HJL A;  1VPA A;  2PA4 A;  1NWG B;  2RJ8 A;  1VH1 A;  4M28 A;  1O7O A;  1VGZ A;  4EEO A;  2O1F A;  2YCM A;  3I0D A;  1LZJ A;  5FTV A;  1ZI4 A;  5EJZ A;  3BRK X;  3CKV A;  5CQL X;  2Y7A A;  3POL A;  3V8Y A;  3OC9 A;  3T7N A;  4MIX A;  4G87 A;  4LW3 A;  2Z87 A;  1H7L A;  3ZGG A;  4ZDQ A;  3DK5 A;  5BXC A;  2YQC A;  4B4G A;  5HS2 A;  4B2W A;  1ZCY A;  3SX8 A;  4HOC A;  5I1F A;  2AES A;  4Y7U A;  2OEG A;  2VS4 A;  5IDS A;  1ZJ3 A;  4DDZ A;  5C36 A;  2RJ7 A;  5CMI A;  1G8O A;  3OGZ A;  4IRQ A;  2MZB A;  3V0Q A;  3QVB A;  4FRM A;  3I0L A;  1V82 A;  3CKJ A;  3E25 A;  1H7H A;  1H7Q A;  2W0W A;  5C47 A;  5C38 A;  2I7B A;  4E1K A;  2YES A;  5CMH A;  1JV1 A;  1EZI A;  2E8B A;  2Y4K A;  1LL0 A;  1ZJO A;  4KPX A;  4B4M A;  1WSZ A;  1QG8 A;  1H4D A;  1O7Q A;  3OH4 A;  1R7U A;  3T7M A;  4EE4 A;  3V8Z A;  3CU0 A;  3OH2 A;  4D48 A;  5DDT A;  3I0I X;  3T7O A;  3N9W A;  3SXA A;  2RJ9 A;  5C3B A;  2XME A;  1G0R A;  2VFZ A;  5D91 A;  5D92 A;  3GUE A;  4Q7C A;  4FRD A;  1FR8 A;  1MP4 A;  1H4C A;  2APC A;  4FRE A;  2AEC A;  2D7I A;  3Q7U A;  4FRP A;  2BO6 A;  1TVY A;  2RIZ A;  3U2U A;  1FRW A;  1MP3 A;  1W77 A;  3V91 A;  1ZHJ A;  2WEE A;  2VXM A;  2W0V A;  1SS9 A;  3DJ4 A;  5FYE A;  2V0H A;  2FY7 A;  3KIA A;  3PKQ A;  1S4O A;  2PGV A;  4KPZ A;  3ZLL A;  3V90 A;  1V84 A;  1YP4 A;  2Y4M A;  4AYJ A;  3R3I A;  1NMM B;  2AM5 A;  4EVW A;  5FU8 A;  4P00 A;  2QKX A;  1TW5 A;  4B4B A;  1YRO B;  1VIC A;  2JCK A;  3I0K A;  4CJB A;  1ZCT A;  1QGS A;  2FYA A;  3U2X A;  4HO5 A;  2AGD A;  4L41 C;  1ZI3 A;  5CQO A;  3OKR A;  2XWL A;  1EYR A;  4B2X A;  1VM8 A;  2FYD B;  4KNR A;  3ZLK A;  4LW6 A;  3F1C A;  3JTJ A;  2BO4 A;  2J0B A;  2VSH A;  2X60 A;  2VXL A;  5L6V A;  3SX3 A;  2I5E A;  1H5R A;  2AM3 A;  5L6S A;  4KT7 A;  2O1H A;  2V0J A;  1FWY A;  1TZF A;  3CGX A;  2QH5 A;  1JVD A;  1PZT A;  3V0O A;  5AJO A;  5C8R A;  4Y7F A;  4FRQ A;  2FYC B;  2GGQ A;  2YQS A;  4KNX A;  4HO0 A;  2NXV A;  1H7G A;  2RIY A;  3D8V A;  1LVW A;  4FRL A;  3RSB A;  4JIS A;  1ZJ0 A;  1R81 A;  5C4F A;  2WE9 A;  4P02 A;  4ECM A;  1YP2 A;  1W55 A;  1H3M A;  4D11 C;  1OMX A;  4Y7G A;  1VH3 A;  1R7Y A;  3CKN A;  1ON6 A;  2PGY A;  2OI7 A;  2C0N A;  2I5K A;  1VZU A;  3U0Y A;  1H7F A;  2Z86 A;  5CQP A;  5FU0 A;  2CU2 A;  5C1G A;  3I0E A;  2E3D A;  1R7T A;  2PX7 A;  4HO4 A;  4Y6N A;  2XMH A;  4BMA A;  4GBP A;  4HG6 A;  1QGQ A;  5AJN A;  4AAW A;  1Z90 A;  3I0H A;  2J0A A;  1S4P A;  1LZ7 A;  3NGW A;  5FTS A;  1ON8 A;  2JCO A;  2FFU A;  2D0J A;  5C3A A;  2AH9 A;  2VD4 A;  4UEG A;  4M2A A;  4FRA A;  3U0X A;  1H5R B;  5C4B A;  2XWM A;  4ASY A;  1LZI A;  3I0G A;  2WVM A;  4EEA A;  1LZ0 A;  1GA8 A;  4FIY A;  1H5S A;  2RJ1 A;  3RMW A;  1R7V A;  1E5K A;  5IDT A;  3CKQ A;  1TW1 A;  1G23 A;  1S4N A;  2VS5 A;  2VSI A;  2DPW A;  1VZT A;  3OH1 A;  4Y6U A;  4O6N A;  4M2B A;  1JVG A;  1ZCV A;  3U2W A;  5EIY A;  2OI5 A;  3CKO A;  1W57 A;  3I0C A;  2X5Z A;  1HJJ A;  2P6W A;  1G2V A;  1ZJ1 A;  3DUV A;  3F1Y A;  4KC4 A;  3JUK A;  5CMF X;  2A8U A;  4ASJ A;  1G97 A;  2AM4 A;  3K8E A;  1GWV A;  1FG5 N;  1WVC A;  5FUH A;  1NHE B;  2Q4J A;  1FO9 A;  3SXB A;  3R2W A;  2BO7 A;  2WGZ A;  2WAW A;  2VS3 A;  2RIX A;  1JV3 A;  2RJ4 A;  3IOH A;  1LL2 A;  2P73 A;  2V0I A;  4EE5 A;  2RIT A;  4K6R A;  1H7T A;  4BQH A;  3OH3 A;  2RJ5 A;  1H4E A;  5IFY A;  4EEM A;  1WT2 A;  4Y9X A;  4G3Q A;  1FZW A;  4XWI A;  3BCV A;  3Q80 A;  3IOJ A;  2D7R A;  3TQD A;  4G3P A;  1JYK A;  2WVL A;  4HO2 A;  1INI A;  5DDV A;  3SXC A;  4FRH A;  4D0T A;  5C1H A;  1G1L A;  4IRP A;  5C4E A;  4M4K A;  4MYB A;  1FOA A;  1QWJ A;  5C48 A;  2OI6 A;  2X65 A;  4HO9 A;  1FGG A;  1H5S B;  2RJ6 A;  2YC3 A;  4KC1 A;  1HM9 A;  4NAI A;  4FCE A;  2ZU7 A;  1OMZ A;  5FV9 A;  1WT1 A;  4Y7V A;  3V0L A;  1GX0 A;  3HL3 A;  4KQL A;  5CMJ A;  4AC3 A;  2V0K A;  3Q4S A;  1GQ9 A;  3D5N A;  1WT3 A;  4D0Z A;  4KRV A;  2WVK A;  3V0M A;  1G9R A;  1I52 A;  4MND A;  4YS8 A;  4C2S A;  1ZJP A;  1LL3 A;  1VGU A;  2YC5 A;  1NKH B;  1H5T A;  1NQI B;  3I0F A;  1INJ A; 
#chains in the Genus database with same CATH homology
 1G3L A;  3SPT A;  3I0J A;  4HO6 A;  1HV9 A;  2UX8 A;  1VZX A;  1H5S C;  3EE5 A;  1H7E A;  1FXO A;  5J49 A;  1R82 A;  4FIX A;  1R80 A;  2XWN A;  3SXE A;  3IOI A;  1K4V A;  2Y6P A;  1WT0 A;  3O3P A;  3LW6 A;  1HM0 A;  1H5S D;  4CJ8 A;  1ZDG A;  4HCQ A;  2ZU9 A;  1VGT A;  2AE7 A;  1FGX A;  4O6M A;  4B3U A;  2QGI A;  2Y4J A;  5CMG X;  1GX4 A;  2O1G A;  4NAN A;  4B42 A;  2A8W A;  4Y62 A;  3OAM A;  3V0P A;  3JUJ A;  4EEG A;  4Y64 A;  3U2V A;  4FCU A;  3D98 A;  4HO3 A;  5C4D A;  4FRB A;  1PZY B;  4G3S A;  2YQH A;  5CQM X;  2FFV A;  3K8D A;  3RMV A;  1KWS A;  1OQM B;  2GGO A;  3ST8 A;  1G93 A;  1G95 A;  3PKP A;  1ZIZ A;  4Y63 A;  2X5S A;  5C3D A;  4D11 A;  3U2T A;  1FO8 A;  1XHB A;  2FYB A;  1IIN A;  2P72 A;  1MP5 A;  4R7P A;  3ZF8 A;  2ICX A;  2YQJ A;  3OH0 A;  3PNN A;  4CVH A;  1FXJ A;  2RJ0 A;  1GWW A;  3SX7 A;  5C4C A;  4NAL A;  1V83 A;  1XZ6 A;  4J18 A;  4ARW A;  4NAK A;  1R7X A;  1ZDF A;  2ZU8 A;  4KC2 A;  1NF5 B;  4KXO A;  2JCL A;  4DE7 A;  4CJC A;  1H5T B;  1ZCU A;  5AJP A;  3USR A;  4FRO A;  3FWW A;  1GQC A;  2V0L A;  4FQW A;  4HO8 A;  2Y4L A;  1FR9 A;  4Y7T A;  1ZI1 A;  4B5B A;  2JCJ A;  5JQQ A;  1ZJ2 A;  3SX5 A;  1HM8 A;  3V0N A;  2BO8 A;  2VK9 A;  3E26 A;  3TZT A;  1IIM A;  1YP3 A;  5C49 A;  4DEC A;  4EE3 A;  2OEF A;  5CQN X;  1O23 B;  1JYL A;  5C1L A;  3FOQ A;  4JD0 A;  3SXG A;  1MC3 A;  1VGW A;  4AYL A;  3SXD A;  1O0R A;  1ZI5 A;  5EJ1 A;  2ICY A;  3USQ A;  3ZGF A;  1HJL A;  1VPA A;  2PA4 A;  1NWG B;  2RJ8 A;  1VH1 A;  4M28 A;  1O7O A;  1VGZ A;  4EEO A;  2O1F A;  2YCM A;  3I0D A;  1LZJ A;  5FTV A;  1ZI4 A;  5EJZ A;  3BRK X;  3CKV A;  5CQL X;  2Y7A A;  3POL A;  3V8Y A;  3OC9 A;  3T7N A;  4MIX A;  4G87 A;  4LW3 A;  2Z87 A;  1H7L A;  3ZGG A;  4ZDQ A;  3DK5 A;  5BXC A;  2YQC A;  4B4G A;  5HS2 A;  4B2W A;  1ZCY A;  3SX8 A;  4HOC A;  5I1F A;  2AES A;  4Y7U A;  2OEG A;  2VS4 A;  5IDS A;  1ZJ3 A;  4DDZ A;  5C36 A;  2RJ7 A;  5CMI A;  1G8O A;  3OGZ A;  4IRQ A;  2MZB A;  3V0Q A;  3QVB A;  4FRM A;  3I0L A;  1V82 A;  3CKJ A;  3E25 A;  1H7H A;  1H7Q A;  2W0W A;  5C47 A;  5C38 A;  2I7B A;  4E1K A;  2YES A;  5CMH A;  1JV1 A;  1EZI A;  2E8B A;  2Y4K A;  1LL0 A;  1ZJO A;  4KPX A;  4B4M A;  1WSZ A;  1QG8 A;  1H4D A;  1O7Q A;  3OH4 A;  1R7U A;  3T7M A;  4EE4 A;  3V8Z A;  3CU0 A;  3OH2 A;  4D48 A;  5DDT A;  3I0I X;  3T7O A;  3N9W A;  3SXA A;  2RJ9 A;  5C3B A;  2XME A;  1G0R A;  2VFZ A;  5D91 A;  5D92 A;  3GUE A;  4Q7C A;  4FRD A;  1FR8 A;  1MP4 A;  1H4C A;  2APC A;  4FRE A;  2AEC A;  2D7I A;  3Q7U A;  4FRP A;  2BO6 A;  1TVY A;  2RIZ A;  3U2U A;  1FRW A;  1MP3 A;  1W77 A;  3V91 A;  1ZHJ A;  2WEE A;  2VXM A;  2W0V A;  1SS9 A;  3DJ4 A;  5FYE A;  2V0H A;  2FY7 A;  3KIA A;  3PKQ A;  1S4O A;  2PGV A;  4KPZ A;  3ZLL A;  3V90 A;  1V84 A;  1YP4 A;  2Y4M A;  4AYJ A;  3R3I A;  1NMM B;  2AM5 A;  4EVW A;  5FU8 A;  4P00 A;  2QKX A;  1TW5 A;  4B4B A;  1YRO B;  1VIC A;  2JCK A;  3I0K A;  4CJB A;  1ZCT A;  1QGS A;  2FYA A;  3U2X A;  4HO5 A;  2AGD A;  4L41 C;  1ZI3 A;  5CQO A;  3OKR A;  2XWL A;  1EYR A;  4B2X A;  1VM8 A;  2FYD B;  4KNR A;  3ZLK A;  4LW6 A;  3F1C A;  3JTJ A;  2BO4 A;  2J0B A;  2VSH A;  2X60 A;  2VXL A;  5L6V A;  3SX3 A;  2I5E A;  1H5R A;  2AM3 A;  5L6S A;  4KT7 A;  2O1H A;  2V0J A;  1FWY A;  1TZF A;  3CGX A;  2QH5 A;  1JVD A;  1PZT A;  3V0O A;  5AJO A;  5C8R A;  4Y7F A;  4FRQ A;  2FYC B;  2GGQ A;  2YQS A;  4KNX A;  4HO0 A;  2NXV A;  1H7G A;  2RIY A;  3D8V A;  1LVW A;  4FRL A;  3RSB A;  4JIS A;  1ZJ0 A;  1R81 A;  5C4F A;  2WE9 A;  4P02 A;  4ECM A;  1YP2 A;  1W55 A;  1H3M A;  4D11 C;  1OMX A;  4Y7G A;  1VH3 A;  1R7Y A;  3CKN A;  1ON6 A;  2PGY A;  2OI7 A;  2C0N A;  2I5K A;  1VZU A;  3U0Y A;  1H7F A;  2Z86 A;  5CQP A;  5FU0 A;  2CU2 A;  5C1G A;  3I0E A;  2E3D A;  1R7T A;  2PX7 A;  4HO4 A;  4Y6N A;  2XMH A;  4BMA A;  4GBP A;  4HG6 A;  1QGQ A;  5AJN A;  4AAW A;  1Z90 A;  3I0H A;  2J0A A;  1S4P A;  1LZ7 A;  3NGW A;  5FTS A;  1ON8 A;  2JCO A;  2FFU A;  2D0J A;  5C3A A;  2AH9 A;  2VD4 A;  4UEG A;  4M2A A;  4FRA A;  3U0X A;  1H5R B;  5C4B A;  2XWM A;  4ASY A;  1LZI A;  3I0G A;  2WVM A;  4EEA A;  1LZ0 A;  1GA8 A;  4FIY A;  1H5S A;  2RJ1 A;  3RMW A;  1R7V A;  1E5K A;  5IDT A;  3CKQ A;  1TW1 A;  1G23 A;  1S4N A;  2VS5 A;  2VSI A;  2DPW A;  1VZT A;  3OH1 A;  4Y6U A;  4O6N A;  4M2B A;  1JVG A;  1ZCV A;  3U2W A;  5EIY A;  2OI5 A;  3CKO A;  1W57 A;  3I0C A;  2X5Z A;  1HJJ A;  2P6W A;  1G2V A;  1ZJ1 A;  3DUV A;  3F1Y A;  4KC4 A;  3JUK A;  5CMF X;  2A8U A;  4ASJ A;  1G97 A;  2AM4 A;  3K8E A;  1GWV A;  1FG5 N;  1WVC A;  5FUH A;  1NHE B;  2Q4J A;  1FO9 A;  3SXB A;  3R2W A;  2BO7 A;  2WGZ A;  2WAW A;  2VS3 A;  2RIX A;  1JV3 A;  2RJ4 A;  3IOH A;  1LL2 A;  2P73 A;  2V0I A;  4EE5 A;  2RIT A;  4K6R A;  1H7T A;  4BQH A;  3OH3 A;  2RJ5 A;  1H4E A;  5IFY A;  4EEM A;  1WT2 A;  4Y9X A;  4G3Q A;  1FZW A;  4XWI A;  3BCV A;  3Q80 A;  3IOJ A;  2D7R A;  3TQD A;  4G3P A;  1JYK A;  2WVL A;  4HO2 A;  1INI A;  5DDV A;  3SXC A;  4FRH A;  4D0T A;  5C1H A;  1G1L A;  4IRP A;  5C4E A;  4M4K A;  4MYB A;  1FOA A;  1QWJ A;  5C48 A;  2OI6 A;  2X65 A;  4HO9 A;  1FGG A;  1H5S B;  2RJ6 A;  2YC3 A;  4KC1 A;  1HM9 A;  4NAI A;  4FCE A;  2ZU7 A;  1OMZ A;  5FV9 A;  1WT1 A;  4Y7V A;  3V0L A;  1GX0 A;  3HL3 A;  4KQL A;  5CMJ A;  4AC3 A;  2V0K A;  3Q4S A;  1GQ9 A;  3D5N A;  1WT3 A;  4D0Z A;  4KRV A;  2WVK A;  3V0M A;  1G9R A;  1I52 A;  4MND A;  4YS8 A;  4C2S A;  1ZJP A;  1LL3 A;  1VGU A;  2YC5 A;  1NKH B;  1H5T A;  1NQI B;  3I0F A;  1INJ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...