4YS8A

Crystal structure of 2-c-methyl-d-erythritol 4-phosphate cytidylyltransferase (ispd) from burkholderia thailandensis
Total Genus 59
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
59
sequence length
230
structure length
225
Chain Sequence
TSRLFALIPCAGGSALPKQYRTLAGRALLHYTLAAFDACSEFAQTLVVISPDDAHFDARRFAGLRFAVRRCGGASRQASVMNGLIQLAEFGATDADWVLVHDAARPGITPALIRTLIGALKDDPVGGIVALPVADTLKRVPAGGDAIERTESRNGLWQAQTPQMFRIGMLRDAIQRAQLEGRDLTDEASAIEWAGHTPRVVQGSLRNFKVTYPEDFDLAEAILAH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase
publication title Crystal Structure of 2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase (IspD) from Burkholderia thailandensis
rcsb
source organism Burkholderia thailandensis
molecule tags Transferase
total genus 59
structure length 225
sequence length 230
chains with identical sequence B, C, D
ec nomenclature ec 2.7.7.60: 2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase.
pdb deposition date 2015-03-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01128 IspD 2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.550.10 Alpha Beta Alpha-Beta Complex Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A 4ys8A00
2AESA 3JUKA 4FRQA 4M28A 4HG6A 1JYKA 3V91A 3V0OA 2YQJA 1YP2A 4NALA 1HM0A 4B2XA 3EE5A 1ZCYA 1LVWA 1H4CA 4B4MA 4ARWA 4XWIA 2D7RA 3SXDA 2V0HA 1TZFA 4HO3A 3V0LA 3OH3A 1VICA 4KT7A 3U2WA 3Q7UA 2BO6A 1K4VA 1FGXA 1JVDA 3V8YA 3SXGA 4FCUA 1MP3A 4AYLA 3V0PA 2ICXA 4EEAA 3OC9A 1FR8A 3CKOA 3U2VA 4IRQA 1QG8A 3I0HA 2Y6PA 2A8UA 3Q4SA 2A8WA 3V90A 4AC3A 1VGZA 3I0IX 4FRHA 1R7VA 1FG5N 2MZBA 4EEMA 1WT3A 1ZJOA 4EEGA 2JCJA 2VSIA 4EE4A 1XHBA 1LL0A 2RJ8A 1WT1A 2WVMA 5FU8A 1R81A 4HOCA 2FYAA 1H7TA 3TQDA 2VS5A 2P6WA 4K6RA 1W77A 4HO2A 1WSZA 5CQLX 1GA8A 2RJ9A 1H3MA 2WVLA 3SXCA 3ZLLA 2RIZA 5CMIA 4B3UA 4R7PA 3DUVA 2O1HA 3I0EA 2X5SA 4G3PA 2WEEA 4Y64A 3DJ4A 5FTSA 2V0IA 3I0DA 3SXEA 5IDTA 1LZ0A 3IOIA 4FRPA 4D11C 1ZJPA 4HO6A 3NGWA 4KNRA 1S4NA 1KWSA 3V8ZA 4KC4A 2YC5A 4BQHA 2PX7A 3ZGGA 2FYBA 1INIA 1H5RB 5CQPA 1VZXA 3GUEA 4Y6UA 4KC2A 5C1LA 3Q80A 1HM9A 1ZI5A 4HO8A 3RSBA 5HS2A 5EJ1A 2P72A 3SX5A 2YQCA 3U2TA 3F1CA 3OKRA 5FTVA 1LZIA 4LW3A 1VGUA 1O0RA 2WVKA 1FO9A 2RJ7A 2Z87A 4NANA 1QWJA 5C1HA 2ZU8A 3OGZA 4KXOA 1ZI4A 4CJ8A 5C4DA 3D8VA 2JCLA 4HO0A 3K8EA 4B4BA 1ZJ2A 2FFUA 4JISA 1OMZA 2AM5A 4MNDA 1LZJA 4ASJA 2CU2A 1GQ9A 3RMWA 2V0JA 1H5TA 1H5SB 2Q4JA 3E26A 3I0JA 4G87A 1ZJ3A 4KPZA 2QGIA 3ST8A 2XWNA 1ON8A 3OH4A 3T7MA 2RIYA 1OMXA 5C8RA 2RJ6A 1NKHB 1ZDGA 2VS3A 3BCVA 3O3PA 2X60A 2RJ4A 1O7QA 5CQMX 3PKQA 1VH3A 1R7TA 4LW6A 4FRAA 2NXVA 1VZUA 2YCMA 1H7HA 3SXBA 4G3SA 2VXMA 1FRWA 1LZ7A 2D7IA 4Y7GA 4P00A 2AGDA 1I52A 1HM8A 5BXCA 2OI5A 5CMHA 4HCQA 3USQA 1G8OA 4FCEA 4B42A 3N9WA 5IDSA 5C4EA 1H7QA 5CMJA 5C4BA 2JCKA 5FYEA 1W55A 3CGXA 1HJLA 4D0ZA 1HJJA 2RJ0A 5DDTA 5JQQA 5C47A 5J49A 4KQLA 1MP5A 1TW1A 5C4FA 3R2WA 4UEGA 4CVHA 4Y9XA 4D0TA 4FREA 1OQMB 2Y4JA 3POLA 3CKVA 3I0LA 1NQIB 1PZYB 4Y7FA 2E8BA 3SX3A 3OAMA 1O23B 3R3IA 3SXAA 1MC3A 1IINA 5C1GA 1E5KA 1G95A 1G3LA 3U0YA 5C48A 1ZI3A 1JV1A 2VD4A 1VPAA 2AE7A 2FYDB 2Y4LA 2V0LA 3QVBA 2VS4A 4DECA 2GGQA 3FWWA 4GBPA 3KIAA 5AJNA 5C3BA 5C3AA 1Z90A 3ZF8A 4EE3A 2WE9A 1G1LA 1H7EA 5C49A 4YS8A 4J18A 1TW5A 4NAKA 1NF5B 1QGSA 1VGTA 4HO9A 2W0WA 2XWMA 4KC1A 1LL3A 1H7GA 1EZIA 1ZDFA 4ECMA 1YP3A 1H4EA 3V0QA 3BRKX 2P73A 1V83A 1FR9A 5L6SA 3RMVA 2X5ZA 3CKNA 4Y7UA 5CQNX 4B4GA 5C36A 4Y63A 5FUHA 2RIXA 3I0CA 2I5EA 2VXLA 4G3QA 4C2SA 3ZGFA 2O1FA 2Y4MA 3U2UA 1FXOA 3FOQA 1HV9A 1ZIZA 2PGVA 1FOAA 1ZCVA 3HL3A 1ZCUA 1FO8A 1YROB 1H7LA 4JD0A 3SX7A 4HO4A 2ICYA 1YP4A 1W57A 2VFZA 2BO4A 2Y7AA 1S4PA 1JVGA 3SX8A 1VM8A 5CQOA 2OI7A 4E1KA 1FWYA 3CKJA 2XMEA 1G0RA 4CJBA 1SS9A 4ASYA 5C3DA 1V84A 1G23A 1H7FA 1WT2A 2W0VA 5CMFX 2VSHA 1NMMB 5FU0A 1G97A 1VGWA 2APCA 4EE5A 1ZJ0A 1R82A 1GX0A 2BO8A 3I0GA 5C4CA 4KRVA 2OEGA 2E3DA 3OH2A 4EEOA 4DDZA 3U2XA 1V82A 1XZ6A 2FYCB 4L41C 3JTJA 1H5RA 2YQHA 4FQWA 3V0NA 2Y4KA 3E25A 2OI6A 5EIYA 5EJZA 2WGZA 2XWLA 2DPWA 4MYBA 2AH9A 2YQSA 1G9RA 2AM4A 3IOJA 4D11A 5C38A 5L6VA 1IIMA 4AYJA 2FFVA 3CU0A 2QH5A 1NWGB 2PGYA 4B5BA 3V0MA 1JYLA 3DK5A 1QGQA 4B2WA 2ZU9A 1H4DA 4D48A 1GWVA 2I5KA 3U0XA 1VH1A 1H5TB 1ON6A 1VZTA 3F1YA 1H5SD 1H5SA 3SPTA 1GX4A 2I7BA 2OEFA 2YESA 4AAWA 3D98A 2XMHA 4Y7TA 5CMGX 4KPXA 4IRPA 4FRLA 2AM3A 4Y6NA 2GGOA 1FGGA 1R7YA 3CKQA 3IOHA 1INJA 3OH0A 1JV3A 2PA4A 4DE7A 2Z86A 4CJCA 1ZCTA 4BMAA 3LW6A 1WVCA 2ZU7A 1FXJA 2X65A 1FZWA 2AECA 4FRDA 4HO5A 4M4KA 3T7NA 2FY7A 4M2AA 4FRMA 3I0FA 3OH1A 3USRA 1TVYA 5I1FA 2RJ1A 1MP4A 1R7XA 4FRBA 5AJPA 5IFYA 5AJOA 4KNXA 4EVWA 2RITA 2RJ5A 1R7UA 3D5NA 1PZTA 5FV9A 1LL2A 2JCOA 1NHEB 1GQCA 1G93A 3K8DA 1WT0A 1EYRA 4M2BA 1H5SC 2D0JA 1O7OA 2UX8A 1G2VA 2YC3A 3I0KA 3JUJA 4Y7VA 4FROA 2BO7A 2WAWA 2QKXA 1ZHJA 1R80A 4P02A 4Y62A 1ZI1A 3PKPA 2V0KA 3ZLKA 1S4OA 4NAIA 3PNNA 1ZJ1A 1GWWA 4ZDQA 2O1GA 5DDVA 3T7OA 3TZTA
chains in the Genus database with same CATH superfamily
2AESA 3JUKA 4FRQA 4M28A 4HG6A 1JYKA 3V91A 3V0OA 2YQJA 1YP2A 4NALA 1HM0A 4B2XA 3EE5A 1ZCYA 1LVWA 1H4CA 4B4MA 4ARWA 4XWIA 2D7RA 3SXDA 2V0HA 1TZFA 4HO3A 3V0LA 3OH3A 1VICA 4KT7A 3U2WA 3Q7UA 2BO6A 1K4VA 1FGXA 1JVDA 3V8YA 2C0NA 3SXGA 4FCUA 1MP3A 4AYLA 3V0PA 2ICXA 4EEAA 3OC9A 1FR8A 3CKOA 3U2VA 4IRQA 1QG8A 3I0HA 2Y6PA 2A8UA 3Q4SA 2A8WA 3V90A 4AC3A 1VGZA 3I0IX 4FRHA 1R7VA 1FG5N 2MZBA 4EEMA 1WT3A 1ZJOA 4EEGA 2JCJA 2VSIA 4EE4A 1XHBA 1LL0A 2RJ8A 1WT1A 2WVMA 5FU8A 1R81A 4HOCA 2FYAA 1H7TA 3TQDA 2VS5A 2P6WA 4K6RA 1W77A 4HO2A 1WSZA 5CQLX 1GA8A 2RJ9A 1H3MA 2WVLA 3SXCA 3ZLLA 2RIZA 5CMIA 4B3UA 4R7PA 3DUVA 2O1HA 3I0EA 2X5SA 4G3PA 2WEEA 4Y64A 3DJ4A 5FTSA 2V0IA 3I0DA 3SXEA 5IDTA 1LZ0A 3IOIA 4FRPA 4D11C 1ZJPA 4HO6A 3NGWA 4KNRA 1S4NA 1KWSA 3V8ZA 4KC4A 2YC5A 4BQHA 2PX7A 3ZGGA 2FYBA 1INIA 1H5RB 5CQPA 1VZXA 3GUEA 4Y6UA 4KC2A 5C1LA 3Q80A 1HM9A 1ZI5A 2J0AA 4HO8A 3RSBA 5HS2A 5EJ1A 2P72A 3SX5A 2YQCA 3U2TA 3F1CA 3OKRA 5FTVA 1LZIA 4LW3A 1VGUA 1O0RA 2WVKA 1FO9A 2RJ7A 2Z87A 5D91A 4NANA 1QWJA 5C1HA 2ZU8A 3OGZA 4KXOA 1ZI4A 4CJ8A 5C4DA 3D8VA 4O6NA 2JCLA 4HO0A 3K8EA 4B4BA 1ZJ2A 2FFUA 4JISA 1OMZA 2AM5A 4MNDA 1LZJA 4ASJA 2CU2A 1GQ9A 3RMWA 2V0JA 1H5TA 1H5SB 2Q4JA 3E26A 3I0JA 4G87A 1ZJ3A 4KPZA 2QGIA 3ST8A 2XWNA 1ON8A 3OH4A 3T7MA 2RIYA 1OMXA 5C8RA 2RJ6A 1NKHB 1ZDGA 2VS3A 3BCVA 3O3PA 2X60A 2RJ4A 1O7QA 2J0BA 5CQMX 3PKQA 1VH3A 1R7TA 4LW6A 4Q7CA 4FRAA 2NXVA 1VZUA 2YCMA 1H7HA 3SXBA 4G3SA 2VXMA 1FRWA 1LZ7A 2D7IA 4Y7GA 4P00A 2AGDA 1I52A 1HM8A 5BXCA 2OI5A 5CMHA 4HCQA 3USQA 1G8OA 4FCEA 4B42A 3N9WA 5IDSA 5C4EA 1H7QA 5CMJA 5C4BA 2JCKA 5FYEA 1W55A 3CGXA 1HJLA 4D0ZA 1HJJA 2RJ0A 5DDTA 5JQQA 5C47A 5J49A 4KQLA 1MP5A 1TW1A 5C4FA 3R2WA 4UEGA 4CVHA 4Y9XA 4D0TA 4FREA 1OQMB 2Y4JA 3POLA 3CKVA 3I0LA 1NQIB 1PZYB 4Y7FA 2E8BA 3SX3A 3OAMA 1O23B 3R3IA 3SXAA 1MC3A 1IINA 5C1GA 1E5KA 1G95A 1G3LA 3U0YA 5C48A 1ZI3A 1JV1A 2VD4A 1VPAA 2AE7A 2FYDB 2Y4LA 2V0LA 3QVBA 2VS4A 4DECA 2GGQA 3FWWA 4GBPA 3KIAA 5AJNA 5C3BA 5C3AA 1Z90A 3ZF8A 4EE3A 2WE9A 1G1LA 1H7EA 5C49A 4YS8A 4J18A 1TW5A 4NAKA 1NF5B 1QGSA 1VGTA 4HO9A 2W0WA 2XWMA 4KC1A 1LL3A 1H7GA 1EZIA 1ZDFA 4ECMA 1YP3A 1H4EA 3V0QA 3BRKX 2P73A 1V83A 1FR9A 5L6SA 3RMVA 2X5ZA 3CKNA 4Y7UA 5CQNX 4B4GA 5C36A 4Y63A 5FUHA 2RIXA 3I0CA 2I5EA 4FIXA 2VXLA 4G3QA 4C2SA 3ZGFA 2O1FA 2Y4MA 3U2UA 1FXOA 3FOQA 1HV9A 1ZIZA 2PGVA 1FOAA 1ZCVA 3HL3A 1ZCUA 1FO8A 1YROB 1H7LA 4JD0A 3SX7A 2VK9A 4HO4A 2ICYA 1YP4A 1W57A 2VFZA 2BO4A 2Y7AA 1S4PA 1JVGA 3SX8A 1VM8A 5CQOA 2OI7A 4E1KA 1FWYA 3CKJA 2XMEA 1G0RA 4CJBA 1SS9A 4ASYA 5C3DA 1V84A 1G23A 1H7FA 4O6MA 1WT2A 2W0VA 5CMFX 2VSHA 1NMMB 5FU0A 1G97A 1VGWA 2APCA 5D92A 4EE5A 1ZJ0A 1R82A 1GX0A 2BO8A 3I0GA 5C4CA 4KRVA 2OEGA 2E3DA 3OH2A 4EEOA 4DDZA 4FIYA 3U2XA 1V82A 1XZ6A 2FYCB 4L41C 3JTJA 1H5RA 2YQHA 4FQWA 3V0NA 2Y4KA 3E25A 2OI6A 5EIYA 5EJZA 2WGZA 2XWLA 2DPWA 4MYBA 2AH9A 2YQSA 1G9RA 2AM4A 3IOJA 4D11A 5C38A 5L6VA 1IIMA 4AYJA 2FFVA 3CU0A 2QH5A 1NWGB 2PGYA 4B5BA 3V0MA 1JYLA 3DK5A 1QGQA 4B2WA 2ZU9A 1H4DA 4D48A 1GWVA 2I5KA 3U0XA 1VH1A 1H5TB 1ON6A 1VZTA 3F1YA 1H5SD 1H5SA 3SPTA 1GX4A 2I7BA 2OEFA 2YESA 4AAWA 3D98A 2XMHA 4Y7TA 5CMGX 4KPXA 4IRPA 4FRLA 2AM3A 4Y6NA 2GGOA 1FGGA 1R7YA 3CKQA 3IOHA 1INJA 3OH0A 1JV3A 2PA4A 4DE7A 2Z86A 4CJCA 1ZCTA 4BMAA 3LW6A 1WVCA 2ZU7A 1FXJA 2X65A 1FZWA 2AECA 4FRDA 4HO5A 4M4KA 3T7NA 2FY7A 4M2AA 4FRMA 3I0FA 3OH1A 4MIXA 3USRA 1TVYA 5I1FA 2RJ1A 1MP4A 1R7XA 4FRBA 5AJPA 5IFYA 5AJOA 4KNXA 4EVWA 2RITA 2RJ5A 1R7UA 3D5NA 1PZTA 5FV9A 1LL2A 2JCOA 1NHEB 1GQCA 1G93A 3K8DA 1WT0A 1EYRA 4M2BA 1H5SC 2D0JA 1O7OA 2UX8A 1G2VA 2YC3A 3I0KA 3JUJA 4Y7VA 4FROA 2BO7A 2WAWA 2QKXA 1ZHJA 1R80A 4P02A 4Y62A 1ZI1A 3PKPA 2V0KA 3ZLKA 1S4OA 4NAIA 3PNNA 1ZJ1A 1GWWA 4ZDQA 2O1GA 5DDVA 3T7OA 3TZTA
chains in the Genus database with same CATH topology
2AESA 3JUKA 4FRQA 4M28A 4HG6A 1JYKA 3V91A 3V0OA 2YQJA 1YP2A 4NALA 1HM0A 4B2XA 3EE5A 1ZCYA 1LVWA 1H4CA 4B4MA 4ARWA 4XWIA 2D7RA 3SXDA 2V0HA 1TZFA 4HO3A 3V0LA 3OH3A 1VICA 4KT7A 3U2WA 3Q7UA 2BO6A 1K4VA 1FGXA 1JVDA 3V8YA 2C0NA 3SXGA 4FCUA 1MP3A 4AYLA 3V0PA 2ICXA 4EEAA 3OC9A 1FR8A 3CKOA 3U2VA 4IRQA 1QG8A 3I0HA 2Y6PA 2A8UA 3Q4SA 2A8WA 3V90A 4AC3A 1VGZA 3I0IX 4FRHA 1R7VA 1FG5N 2MZBA 4EEMA 1WT3A 1ZJOA 4EEGA 2JCJA 2VSIA 4EE4A 1XHBA 1LL0A 2RJ8A 1WT1A 2WVMA 5FU8A 1R81A 4HOCA 2FYAA 1H7TA 3TQDA 2VS5A 2P6WA 4K6RA 1W77A 4HO2A 1WSZA 5CQLX 1GA8A 2RJ9A 1H3MA 2WVLA 3SXCA 3ZLLA 2RIZA 5CMIA 4B3UA 4R7PA 3DUVA 2O1HA 3I0EA 2X5SA 4G3PA 2WEEA 4Y64A 3DJ4A 5FTSA 2V0IA 3I0DA 3SXEA 5IDTA 1LZ0A 3IOIA 4FRPA 4D11C 1ZJPA 4HO6A 3NGWA 4KNRA 1S4NA 1KWSA 3V8ZA 4KC4A 2YC5A 4BQHA 2PX7A 3ZGGA 2FYBA 1INIA 1H5RB 5CQPA 1VZXA 3GUEA 4Y6UA 4KC2A 5C1LA 3Q80A 1HM9A 1ZI5A 2J0AA 4HO8A 3RSBA 5HS2A 5EJ1A 2P72A 3SX5A 2YQCA 3U2TA 3F1CA 3OKRA 5FTVA 1LZIA 4LW3A 1VGUA 1O0RA 2WVKA 1FO9A 2RJ7A 2Z87A 5D91A 4NANA 1QWJA 5C1HA 2ZU8A 3OGZA 4KXOA 1ZI4A 4CJ8A 5C4DA 3D8VA 4O6NA 2JCLA 4HO0A 3K8EA 4B4BA 1ZJ2A 2FFUA 4JISA 1OMZA 2AM5A 4MNDA 1LZJA 4ASJA 2CU2A 1GQ9A 3RMWA 2V0JA 1H5TA 1H5SB 2Q4JA 3E26A 3I0JA 4G87A 1ZJ3A 4KPZA 2QGIA 3ST8A 2XWNA 1ON8A 3OH4A 3T7MA 2RIYA 1OMXA 5C8RA 2RJ6A 1NKHB 1ZDGA 2VS3A 3BCVA 3O3PA 2X60A 2RJ4A 1O7QA 2J0BA 5CQMX 3PKQA 1VH3A 1R7TA 4LW6A 4Q7CA 4FRAA 2NXVA 1VZUA 2YCMA 1H7HA 3SXBA 4G3SA 2VXMA 1FRWA 1LZ7A 2D7IA 4Y7GA 4P00A 2AGDA 1I52A 1HM8A 5BXCA 2OI5A 5CMHA 4HCQA 3USQA 1G8OA 4FCEA 4B42A 3N9WA 5IDSA 5C4EA 1H7QA 5CMJA 5C4BA 2JCKA 5FYEA 1W55A 3CGXA 1HJLA 4D0ZA 1HJJA 2RJ0A 5DDTA 5JQQA 5C47A 5J49A 4KQLA 1MP5A 1TW1A 5C4FA 3R2WA 4UEGA 4CVHA 4Y9XA 4D0TA 4FREA 1OQMB 2Y4JA 3POLA 3CKVA 3I0LA 1NQIB 1PZYB 4Y7FA 2E8BA 3SX3A 3OAMA 1O23B 3R3IA 3SXAA 1MC3A 1IINA 5C1GA 1E5KA 1G95A 1G3LA 3U0YA 5C48A 1ZI3A 1JV1A 2VD4A 1VPAA 2AE7A 2FYDB 2Y4LA 2V0LA 3QVBA 2VS4A 4DECA 2GGQA 3FWWA 4GBPA 3KIAA 5AJNA 5C3BA 5C3AA 1Z90A 3ZF8A 4EE3A 2WE9A 1G1LA 1H7EA 5C49A 4YS8A 4J18A 1TW5A 4NAKA 1NF5B 1QGSA 1VGTA 4HO9A 2W0WA 2XWMA 4KC1A 1LL3A 1H7GA 1EZIA 1ZDFA 4ECMA 1YP3A 1H4EA 3V0QA 3BRKX 2P73A 1V83A 1FR9A 5L6SA 3RMVA 2X5ZA 3CKNA 4Y7UA 5CQNX 4B4GA 5C36A 4Y63A 5FUHA 2RIXA 3I0CA 2I5EA 4FIXA 2VXLA 4G3QA 4C2SA 3ZGFA 2O1FA 2Y4MA 3U2UA 1FXOA 3FOQA 1HV9A 1ZIZA 2PGVA 1FOAA 1ZCVA 3HL3A 1ZCUA 1FO8A 1YROB 1H7LA 4JD0A 3SX7A 2VK9A 4HO4A 2ICYA 1YP4A 1W57A 2VFZA 2BO4A 2Y7AA 1S4PA 1JVGA 3SX8A 1VM8A 5CQOA 2OI7A 4E1KA 1FWYA 3CKJA 2XMEA 1G0RA 4CJBA 1SS9A 4ASYA 5C3DA 1V84A 1G23A 1H7FA 4O6MA 1WT2A 2W0VA 5CMFX 2VSHA 1NMMB 5FU0A 1G97A 1VGWA 2APCA 5D92A 4EE5A 1ZJ0A 1R82A 1GX0A 2BO8A 3I0GA 5C4CA 4KRVA 2OEGA 2E3DA 3OH2A 4EEOA 4DDZA 4FIYA 3U2XA 1V82A 1XZ6A 2FYCB 4L41C 3JTJA 1H5RA 2YQHA 4FQWA 3V0NA 2Y4KA 3E25A 2OI6A 5EIYA 5EJZA 2WGZA 2XWLA 2DPWA 4MYBA 2AH9A 2YQSA 1G9RA 2AM4A 3IOJA 4D11A 5C38A 5L6VA 1IIMA 4AYJA 2FFVA 3CU0A 2QH5A 1NWGB 2PGYA 4B5BA 3V0MA 1JYLA 3DK5A 1QGQA 4B2WA 2ZU9A 1H4DA 4D48A 1GWVA 2I5KA 3U0XA 1VH1A 1H5TB 1ON6A 1VZTA 3F1YA 1H5SD 1H5SA 3SPTA 1GX4A 2I7BA 2OEFA 2YESA 4AAWA 3D98A 2XMHA 4Y7TA 5CMGX 4KPXA 4IRPA 4FRLA 2AM3A 4Y6NA 2GGOA 1FGGA 1R7YA 3CKQA 3IOHA 1INJA 3OH0A 1JV3A 2PA4A 4DE7A 2Z86A 4CJCA 1ZCTA 4BMAA 3LW6A 1WVCA 2ZU7A 1FXJA 2X65A 1FZWA 2AECA 4FRDA 4HO5A 4M4KA 3T7NA 2FY7A 4M2AA 4FRMA 3I0FA 3OH1A 4MIXA 3USRA 1TVYA 5I1FA 2RJ1A 1MP4A 1R7XA 4FRBA 5AJPA 5IFYA 5AJOA 4KNXA 4EVWA 2RITA 2RJ5A 1R7UA 3D5NA 1PZTA 5FV9A 1LL2A 2JCOA 1NHEB 1GQCA 1G93A 3K8DA 1WT0A 1EYRA 4M2BA 1H5SC 2D0JA 1O7OA 2UX8A 1G2VA 2YC3A 3I0KA 3JUJA 4Y7VA 4FROA 2BO7A 2WAWA 2QKXA 1ZHJA 1R80A 4P02A 4Y62A 1ZI1A 3PKPA 2V0KA 3ZLKA 1S4OA 4NAIA 3PNNA 1ZJ1A 1GWWA 4ZDQA 2O1GA 5DDVA 3T7OA 3TZTA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2AES A;  3JUK A;  4FRQ A;  4M28 A;  4HG6 A;  1JYK A;  3V91 A;  3V0O A;  2YQJ A;  1YP2 A;  4NAL A;  1HM0 A;  4B2X A;  3EE5 A;  1ZCY A;  1LVW A;  1H4C A;  4B4M A;  4ARW A;  4XWI A;  2D7R A;  3SXD A;  2V0H A;  1TZF A;  4HO3 A;  3V0L A;  3OH3 A;  1VIC A;  4KT7 A;  3U2W A;  3Q7U A;  2BO6 A;  1K4V A;  1FGX A;  1JVD A;  3V8Y A;  3SXG A;  4FCU A;  1MP3 A;  4AYL A;  3V0P A;  2ICX A;  4EEA A;  3OC9 A;  1FR8 A;  3CKO A;  3U2V A;  4IRQ A;  1QG8 A;  3I0H A;  2Y6P A;  2A8U A;  3Q4S A;  2A8W A;  3V90 A;  4AC3 A;  1VGZ A;  3I0I X;  4FRH A;  1R7V A;  1FG5 N;  2MZB A;  4EEM A;  1WT3 A;  1ZJO A;  4EEG A;  2JCJ A;  2VSI A;  4EE4 A;  1XHB A;  1LL0 A;  2RJ8 A;  1WT1 A;  2WVM A;  5FU8 A;  1R81 A;  4HOC A;  2FYA A;  1H7T A;  3TQD A;  2VS5 A;  2P6W A;  4K6R A;  1W77 A;  4HO2 A;  1WSZ A;  5CQL X;  1GA8 A;  2RJ9 A;  1H3M A;  2WVL A;  3SXC A;  3ZLL A;  2RIZ A;  5CMI A;  4B3U A;  4R7P A;  3DUV A;  2O1H A;  3I0E A;  2X5S A;  4G3P A;  2WEE A;  4Y64 A;  3DJ4 A;  5FTS A;  2V0I A;  3I0D A;  3SXE A;  5IDT A;  1LZ0 A;  3IOI A;  4FRP A;  4D11 C;  1ZJP A;  4HO6 A;  3NGW A;  4KNR A;  1S4N A;  1KWS A;  3V8Z A;  4KC4 A;  2YC5 A;  4BQH A;  2PX7 A;  3ZGG A;  2FYB A;  1INI A;  1H5R B;  5CQP A;  1VZX A;  3GUE A;  4Y6U A;  4KC2 A;  5C1L A;  3Q80 A;  1HM9 A;  1ZI5 A;  4HO8 A;  3RSB A;  5HS2 A;  5EJ1 A;  2P72 A;  3SX5 A;  2YQC A;  3U2T A;  3F1C A;  3OKR A;  5FTV A;  1LZI A;  4LW3 A;  1VGU A;  1O0R A;  2WVK A;  1FO9 A;  2RJ7 A;  2Z87 A;  4NAN A;  1QWJ A;  5C1H A;  2ZU8 A;  3OGZ A;  4KXO A;  1ZI4 A;  4CJ8 A;  5C4D A;  3D8V A;  2JCL A;  4HO0 A;  3K8E A;  4B4B A;  1ZJ2 A;  2FFU A;  4JIS A;  1OMZ A;  2AM5 A;  4MND A;  1LZJ A;  4ASJ A;  2CU2 A;  1GQ9 A;  3RMW A;  2V0J A;  1H5T A;  1H5S B;  2Q4J A;  3E26 A;  3I0J A;  4G87 A;  1ZJ3 A;  4KPZ A;  2QGI A;  3ST8 A;  2XWN A;  1ON8 A;  3OH4 A;  3T7M A;  2RIY A;  1OMX A;  5C8R A;  2RJ6 A;  1NKH B;  1ZDG A;  2VS3 A;  3BCV A;  3O3P A;  2X60 A;  2RJ4 A;  1O7Q A;  5CQM X;  3PKQ A;  1VH3 A;  1R7T A;  4LW6 A;  4FRA A;  2NXV A;  1VZU A;  2YCM A;  1H7H A;  3SXB A;  4G3S A;  2VXM A;  1FRW A;  1LZ7 A;  2D7I A;  4Y7G A;  4P00 A;  2AGD A;  1I52 A;  1HM8 A;  5BXC A;  2OI5 A;  5CMH A;  4HCQ A;  3USQ A;  1G8O A;  4FCE A;  4B42 A;  3N9W A;  5IDS A;  5C4E A;  1H7Q A;  5CMJ A;  5C4B A;  2JCK A;  5FYE A;  1W55 A;  3CGX A;  1HJL A;  4D0Z A;  1HJJ A;  2RJ0 A;  5DDT A;  5JQQ A;  5C47 A;  5J49 A;  4KQL A;  1MP5 A;  1TW1 A;  5C4F A;  3R2W A;  4UEG A;  4CVH A;  4Y9X A;  4D0T A;  4FRE A;  1OQM B;  2Y4J A;  3POL A;  3CKV A;  3I0L A;  1NQI B;  1PZY B;  4Y7F A;  2E8B A;  3SX3 A;  3OAM A;  1O23 B;  3R3I A;  3SXA A;  1MC3 A;  1IIN A;  5C1G A;  1E5K A;  1G95 A;  1G3L A;  3U0Y A;  5C48 A;  1ZI3 A;  1JV1 A;  2VD4 A;  1VPA A;  2AE7 A;  2FYD B;  2Y4L A;  2V0L A;  3QVB A;  2VS4 A;  4DEC A;  2GGQ A;  3FWW A;  4GBP A;  3KIA A;  5AJN A;  5C3B A;  5C3A A;  1Z90 A;  3ZF8 A;  4EE3 A;  2WE9 A;  1G1L A;  1H7E A;  5C49 A;  4YS8 A;  4J18 A;  1TW5 A;  4NAK A;  1NF5 B;  1QGS A;  1VGT A;  4HO9 A;  2W0W A;  2XWM A;  4KC1 A;  1LL3 A;  1H7G A;  1EZI A;  1ZDF A;  4ECM A;  1YP3 A;  1H4E A;  3V0Q A;  3BRK X;  2P73 A;  1V83 A;  1FR9 A;  5L6S A;  3RMV A;  2X5Z A;  3CKN A;  4Y7U A;  5CQN X;  4B4G A;  5C36 A;  4Y63 A;  5FUH A;  2RIX A;  3I0C A;  2I5E A;  2VXL A;  4G3Q A;  4C2S A;  3ZGF A;  2O1F A;  2Y4M A;  3U2U A;  1FXO A;  3FOQ A;  1HV9 A;  1ZIZ A;  2PGV A;  1FOA A;  1ZCV A;  3HL3 A;  1ZCU A;  1FO8 A;  1YRO B;  1H7L A;  4JD0 A;  3SX7 A;  4HO4 A;  2ICY A;  1YP4 A;  1W57 A;  2VFZ A;  2BO4 A;  2Y7A A;  1S4P A;  1JVG A;  3SX8 A;  1VM8 A;  5CQO A;  2OI7 A;  4E1K A;  1FWY A;  3CKJ A;  2XME A;  1G0R A;  4CJB A;  1SS9 A;  4ASY A;  5C3D A;  1V84 A;  1G23 A;  1H7F A;  1WT2 A;  2W0V A;  5CMF X;  2VSH A;  1NMM B;  5FU0 A;  1G97 A;  1VGW A;  2APC A;  4EE5 A;  1ZJ0 A;  1R82 A;  1GX0 A;  2BO8 A;  3I0G A;  5C4C A;  4KRV A;  2OEG A;  2E3D A;  3OH2 A;  4EEO A;  4DDZ A;  3U2X A;  1V82 A;  1XZ6 A;  2FYC B;  4L41 C;  3JTJ A;  1H5R A;  2YQH A;  4FQW A;  3V0N A;  2Y4K A;  3E25 A;  2OI6 A;  5EIY A;  5EJZ A;  2WGZ A;  2XWL A;  2DPW A;  4MYB A;  2AH9 A;  2YQS A;  1G9R A;  2AM4 A;  3IOJ A;  4D11 A;  5C38 A;  5L6V A;  1IIM A;  4AYJ A;  2FFV A;  3CU0 A;  2QH5 A;  1NWG B;  2PGY A;  4B5B A;  3V0M A;  1JYL A;  3DK5 A;  1QGQ A;  4B2W A;  2ZU9 A;  1H4D A;  4D48 A;  1GWV A;  2I5K A;  3U0X A;  1VH1 A;  1H5T B;  1ON6 A;  1VZT A;  3F1Y A;  1H5S D;  1H5S A;  3SPT A;  1GX4 A;  2I7B A;  2OEF A;  2YES A;  4AAW A;  3D98 A;  2XMH A;  4Y7T A;  5CMG X;  4KPX A;  4IRP A;  4FRL A;  2AM3 A;  4Y6N A;  2GGO A;  1FGG A;  1R7Y A;  3CKQ A;  3IOH A;  1INJ A;  3OH0 A;  1JV3 A;  2PA4 A;  4DE7 A;  2Z86 A;  4CJC A;  1ZCT A;  4BMA A;  3LW6 A;  1WVC A;  2ZU7 A;  1FXJ A;  2X65 A;  1FZW A;  2AEC A;  4FRD A;  4HO5 A;  4M4K A;  3T7N A;  2FY7 A;  4M2A A;  4FRM A;  3I0F A;  3OH1 A;  3USR A;  1TVY A;  5I1F A;  2RJ1 A;  1MP4 A;  1R7X A;  4FRB A;  5AJP A;  5IFY A;  5AJO A;  4KNX A;  4EVW A;  2RIT A;  2RJ5 A;  1R7U A;  3D5N A;  1PZT A;  5FV9 A;  1LL2 A;  2JCO A;  1NHE B;  1GQC A;  1G93 A;  3K8D A;  1WT0 A;  1EYR A;  4M2B A;  1H5S C;  2D0J A;  1O7O A;  2UX8 A;  1G2V A;  2YC3 A;  3I0K A;  3JUJ A;  4Y7V A;  4FRO A;  2BO7 A;  2WAW A;  2QKX A;  1ZHJ A;  1R80 A;  4P02 A;  4Y62 A;  1ZI1 A;  3PKP A;  2V0K A;  3ZLK A;  1S4O A;  4NAI A;  3PNN A;  1ZJ1 A;  1GWW A;  4ZDQ A;  2O1G A;  5DDV A;  3T7O A;  3TZT A; 
#chains in the Genus database with same CATH topology
 2AES A;  3JUK A;  4FRQ A;  4M28 A;  4HG6 A;  1JYK A;  3V91 A;  3V0O A;  2YQJ A;  1YP2 A;  4NAL A;  1HM0 A;  4B2X A;  3EE5 A;  1ZCY A;  1LVW A;  1H4C A;  4B4M A;  4ARW A;  4XWI A;  2D7R A;  3SXD A;  2V0H A;  1TZF A;  4HO3 A;  3V0L A;  3OH3 A;  1VIC A;  4KT7 A;  3U2W A;  3Q7U A;  2BO6 A;  1K4V A;  1FGX A;  1JVD A;  3V8Y A;  2C0N A;  3SXG A;  4FCU A;  1MP3 A;  4AYL A;  3V0P A;  2ICX A;  4EEA A;  3OC9 A;  1FR8 A;  3CKO A;  3U2V A;  4IRQ A;  1QG8 A;  3I0H A;  2Y6P A;  2A8U A;  3Q4S A;  2A8W A;  3V90 A;  4AC3 A;  1VGZ A;  3I0I X;  4FRH A;  1R7V A;  1FG5 N;  2MZB A;  4EEM A;  1WT3 A;  1ZJO A;  4EEG A;  2JCJ A;  2VSI A;  4EE4 A;  1XHB A;  1LL0 A;  2RJ8 A;  1WT1 A;  2WVM A;  5FU8 A;  1R81 A;  4HOC A;  2FYA A;  1H7T A;  3TQD A;  2VS5 A;  2P6W A;  4K6R A;  1W77 A;  4HO2 A;  1WSZ A;  5CQL X;  1GA8 A;  2RJ9 A;  1H3M A;  2WVL A;  3SXC A;  3ZLL A;  2RIZ A;  5CMI A;  4B3U A;  4R7P A;  3DUV A;  2O1H A;  3I0E A;  2X5S A;  4G3P A;  2WEE A;  4Y64 A;  3DJ4 A;  5FTS A;  2V0I A;  3I0D A;  3SXE A;  5IDT A;  1LZ0 A;  3IOI A;  4FRP A;  4D11 C;  1ZJP A;  4HO6 A;  3NGW A;  4KNR A;  1S4N A;  1KWS A;  3V8Z A;  4KC4 A;  2YC5 A;  4BQH A;  2PX7 A;  3ZGG A;  2FYB A;  1INI A;  1H5R B;  5CQP A;  1VZX A;  3GUE A;  4Y6U A;  4KC2 A;  5C1L A;  3Q80 A;  1HM9 A;  1ZI5 A;  2J0A A;  4HO8 A;  3RSB A;  5HS2 A;  5EJ1 A;  2P72 A;  3SX5 A;  2YQC A;  3U2T A;  3F1C A;  3OKR A;  5FTV A;  1LZI A;  4LW3 A;  1VGU A;  1O0R A;  2WVK A;  1FO9 A;  2RJ7 A;  2Z87 A;  5D91 A;  4NAN A;  1QWJ A;  5C1H A;  2ZU8 A;  3OGZ A;  4KXO A;  1ZI4 A;  4CJ8 A;  5C4D A;  3D8V A;  4O6N A;  2JCL A;  4HO0 A;  3K8E A;  4B4B A;  1ZJ2 A;  2FFU A;  4JIS A;  1OMZ A;  2AM5 A;  4MND A;  1LZJ A;  4ASJ A;  2CU2 A;  1GQ9 A;  3RMW A;  2V0J A;  1H5T A;  1H5S B;  2Q4J A;  3E26 A;  3I0J A;  4G87 A;  1ZJ3 A;  4KPZ A;  2QGI A;  3ST8 A;  2XWN A;  1ON8 A;  3OH4 A;  3T7M A;  2RIY A;  1OMX A;  5C8R A;  2RJ6 A;  1NKH B;  1ZDG A;  2VS3 A;  3BCV A;  3O3P A;  2X60 A;  2RJ4 A;  1O7Q A;  2J0B A;  5CQM X;  3PKQ A;  1VH3 A;  1R7T A;  4LW6 A;  4Q7C A;  4FRA A;  2NXV A;  1VZU A;  2YCM A;  1H7H A;  3SXB A;  4G3S A;  2VXM A;  1FRW A;  1LZ7 A;  2D7I A;  4Y7G A;  4P00 A;  2AGD A;  1I52 A;  1HM8 A;  5BXC A;  2OI5 A;  5CMH A;  4HCQ A;  3USQ A;  1G8O A;  4FCE A;  4B42 A;  3N9W A;  5IDS A;  5C4E A;  1H7Q A;  5CMJ A;  5C4B A;  2JCK A;  5FYE A;  1W55 A;  3CGX A;  1HJL A;  4D0Z A;  1HJJ A;  2RJ0 A;  5DDT A;  5JQQ A;  5C47 A;  5J49 A;  4KQL A;  1MP5 A;  1TW1 A;  5C4F A;  3R2W A;  4UEG A;  4CVH A;  4Y9X A;  4D0T A;  4FRE A;  1OQM B;  2Y4J A;  3POL A;  3CKV A;  3I0L A;  1NQI B;  1PZY B;  4Y7F A;  2E8B A;  3SX3 A;  3OAM A;  1O23 B;  3R3I A;  3SXA A;  1MC3 A;  1IIN A;  5C1G A;  1E5K A;  1G95 A;  1G3L A;  3U0Y A;  5C48 A;  1ZI3 A;  1JV1 A;  2VD4 A;  1VPA A;  2AE7 A;  2FYD B;  2Y4L A;  2V0L A;  3QVB A;  2VS4 A;  4DEC A;  2GGQ A;  3FWW A;  4GBP A;  3KIA A;  5AJN A;  5C3B A;  5C3A A;  1Z90 A;  3ZF8 A;  4EE3 A;  2WE9 A;  1G1L A;  1H7E A;  5C49 A;  4YS8 A;  4J18 A;  1TW5 A;  4NAK A;  1NF5 B;  1QGS A;  1VGT A;  4HO9 A;  2W0W A;  2XWM A;  4KC1 A;  1LL3 A;  1H7G A;  1EZI A;  1ZDF A;  4ECM A;  1YP3 A;  1H4E A;  3V0Q A;  3BRK X;  2P73 A;  1V83 A;  1FR9 A;  5L6S A;  3RMV A;  2X5Z A;  3CKN A;  4Y7U A;  5CQN X;  4B4G A;  5C36 A;  4Y63 A;  5FUH A;  2RIX A;  3I0C A;  2I5E A;  4FIX A;  2VXL A;  4G3Q A;  4C2S A;  3ZGF A;  2O1F A;  2Y4M A;  3U2U A;  1FXO A;  3FOQ A;  1HV9 A;  1ZIZ A;  2PGV A;  1FOA A;  1ZCV A;  3HL3 A;  1ZCU A;  1FO8 A;  1YRO B;  1H7L A;  4JD0 A;  3SX7 A;  2VK9 A;  4HO4 A;  2ICY A;  1YP4 A;  1W57 A;  2VFZ A;  2BO4 A;  2Y7A A;  1S4P A;  1JVG A;  3SX8 A;  1VM8 A;  5CQO A;  2OI7 A;  4E1K A;  1FWY A;  3CKJ A;  2XME A;  1G0R A;  4CJB A;  1SS9 A;  4ASY A;  5C3D A;  1V84 A;  1G23 A;  1H7F A;  4O6M A;  1WT2 A;  2W0V A;  5CMF X;  2VSH A;  1NMM B;  5FU0 A;  1G97 A;  1VGW A;  2APC A;  5D92 A;  4EE5 A;  1ZJ0 A;  1R82 A;  1GX0 A;  2BO8 A;  3I0G A;  5C4C A;  4KRV A;  2OEG A;  2E3D A;  3OH2 A;  4EEO A;  4DDZ A;  4FIY A;  3U2X A;  1V82 A;  1XZ6 A;  2FYC B;  4L41 C;  3JTJ A;  1H5R A;  2YQH A;  4FQW A;  3V0N A;  2Y4K A;  3E25 A;  2OI6 A;  5EIY A;  5EJZ A;  2WGZ A;  2XWL A;  2DPW A;  4MYB A;  2AH9 A;  2YQS A;  1G9R A;  2AM4 A;  3IOJ A;  4D11 A;  5C38 A;  5L6V A;  1IIM A;  4AYJ A;  2FFV A;  3CU0 A;  2QH5 A;  1NWG B;  2PGY A;  4B5B A;  3V0M A;  1JYL A;  3DK5 A;  1QGQ A;  4B2W A;  2ZU9 A;  1H4D A;  4D48 A;  1GWV A;  2I5K A;  3U0X A;  1VH1 A;  1H5T B;  1ON6 A;  1VZT A;  3F1Y A;  1H5S D;  1H5S A;  3SPT A;  1GX4 A;  2I7B A;  2OEF A;  2YES A;  4AAW A;  3D98 A;  2XMH A;  4Y7T A;  5CMG X;  4KPX A;  4IRP A;  4FRL A;  2AM3 A;  4Y6N A;  2GGO A;  1FGG A;  1R7Y A;  3CKQ A;  3IOH A;  1INJ A;  3OH0 A;  1JV3 A;  2PA4 A;  4DE7 A;  2Z86 A;  4CJC A;  1ZCT A;  4BMA A;  3LW6 A;  1WVC A;  2ZU7 A;  1FXJ A;  2X65 A;  1FZW A;  2AEC A;  4FRD A;  4HO5 A;  4M4K A;  3T7N A;  2FY7 A;  4M2A A;  4FRM A;  3I0F A;  3OH1 A;  4MIX A;  3USR A;  1TVY A;  5I1F A;  2RJ1 A;  1MP4 A;  1R7X A;  4FRB A;  5AJP A;  5IFY A;  5AJO A;  4KNX A;  4EVW A;  2RIT A;  2RJ5 A;  1R7U A;  3D5N A;  1PZT A;  5FV9 A;  1LL2 A;  2JCO A;  1NHE B;  1GQC A;  1G93 A;  3K8D A;  1WT0 A;  1EYR A;  4M2B A;  1H5S C;  2D0J A;  1O7O A;  2UX8 A;  1G2V A;  2YC3 A;  3I0K A;  3JUJ A;  4Y7V A;  4FRO A;  2BO7 A;  2WAW A;  2QKX A;  1ZHJ A;  1R80 A;  4P02 A;  4Y62 A;  1ZI1 A;  3PKP A;  2V0K A;  3ZLK A;  1S4O A;  4NAI A;  3PNN A;  1ZJ1 A;  1GWW A;  4ZDQ A;  2O1G A;  5DDV A;  3T7O A;  3TZT A; 
#chains in the Genus database with same CATH homology
 2AES A;  3JUK A;  4FRQ A;  4M28 A;  4HG6 A;  1JYK A;  3V91 A;  3V0O A;  2YQJ A;  1YP2 A;  4NAL A;  1HM0 A;  4B2X A;  3EE5 A;  1ZCY A;  1LVW A;  1H4C A;  4B4M A;  4ARW A;  4XWI A;  2D7R A;  3SXD A;  2V0H A;  1TZF A;  4HO3 A;  3V0L A;  3OH3 A;  1VIC A;  4KT7 A;  3U2W A;  3Q7U A;  2BO6 A;  1K4V A;  1FGX A;  1JVD A;  3V8Y A;  2C0N A;  3SXG A;  4FCU A;  1MP3 A;  4AYL A;  3V0P A;  2ICX A;  4EEA A;  3OC9 A;  1FR8 A;  3CKO A;  3U2V A;  4IRQ A;  1QG8 A;  3I0H A;  2Y6P A;  2A8U A;  3Q4S A;  2A8W A;  3V90 A;  4AC3 A;  1VGZ A;  3I0I X;  4FRH A;  1R7V A;  1FG5 N;  2MZB A;  4EEM A;  1WT3 A;  1ZJO A;  4EEG A;  2JCJ A;  2VSI A;  4EE4 A;  1XHB A;  1LL0 A;  2RJ8 A;  1WT1 A;  2WVM A;  5FU8 A;  1R81 A;  4HOC A;  2FYA A;  1H7T A;  3TQD A;  2VS5 A;  2P6W A;  4K6R A;  1W77 A;  4HO2 A;  1WSZ A;  5CQL X;  1GA8 A;  2RJ9 A;  1H3M A;  2WVL A;  3SXC A;  3ZLL A;  2RIZ A;  5CMI A;  4B3U A;  4R7P A;  3DUV A;  2O1H A;  3I0E A;  2X5S A;  4G3P A;  2WEE A;  4Y64 A;  3DJ4 A;  5FTS A;  2V0I A;  3I0D A;  3SXE A;  5IDT A;  1LZ0 A;  3IOI A;  4FRP A;  4D11 C;  1ZJP A;  4HO6 A;  3NGW A;  4KNR A;  1S4N A;  1KWS A;  3V8Z A;  4KC4 A;  2YC5 A;  4BQH A;  2PX7 A;  3ZGG A;  2FYB A;  1INI A;  1H5R B;  5CQP A;  1VZX A;  3GUE A;  4Y6U A;  4KC2 A;  5C1L A;  3Q80 A;  1HM9 A;  1ZI5 A;  2J0A A;  4HO8 A;  3RSB A;  5HS2 A;  5EJ1 A;  2P72 A;  3SX5 A;  2YQC A;  3U2T A;  3F1C A;  3OKR A;  5FTV A;  1LZI A;  4LW3 A;  1VGU A;  1O0R A;  2WVK A;  1FO9 A;  2RJ7 A;  2Z87 A;  5D91 A;  4NAN A;  1QWJ A;  5C1H A;  2ZU8 A;  3OGZ A;  4KXO A;  1ZI4 A;  4CJ8 A;  5C4D A;  3D8V A;  4O6N A;  2JCL A;  4HO0 A;  3K8E A;  4B4B A;  1ZJ2 A;  2FFU A;  4JIS A;  1OMZ A;  2AM5 A;  4MND A;  1LZJ A;  4ASJ A;  2CU2 A;  1GQ9 A;  3RMW A;  2V0J A;  1H5T A;  1H5S B;  2Q4J A;  3E26 A;  3I0J A;  4G87 A;  1ZJ3 A;  4KPZ A;  2QGI A;  3ST8 A;  2XWN A;  1ON8 A;  3OH4 A;  3T7M A;  2RIY A;  1OMX A;  5C8R A;  2RJ6 A;  1NKH B;  1ZDG A;  2VS3 A;  3BCV A;  3O3P A;  2X60 A;  2RJ4 A;  1O7Q A;  2J0B A;  5CQM X;  3PKQ A;  1VH3 A;  1R7T A;  4LW6 A;  4Q7C A;  4FRA A;  2NXV A;  1VZU A;  2YCM A;  1H7H A;  3SXB A;  4G3S A;  2VXM A;  1FRW A;  1LZ7 A;  2D7I A;  4Y7G A;  4P00 A;  2AGD A;  1I52 A;  1HM8 A;  5BXC A;  2OI5 A;  5CMH A;  4HCQ A;  3USQ A;  1G8O A;  4FCE A;  4B42 A;  3N9W A;  5IDS A;  5C4E A;  1H7Q A;  5CMJ A;  5C4B A;  2JCK A;  5FYE A;  1W55 A;  3CGX A;  1HJL A;  4D0Z A;  1HJJ A;  2RJ0 A;  5DDT A;  5JQQ A;  5C47 A;  5J49 A;  4KQL A;  1MP5 A;  1TW1 A;  5C4F A;  3R2W A;  4UEG A;  4CVH A;  4Y9X A;  4D0T A;  4FRE A;  1OQM B;  2Y4J A;  3POL A;  3CKV A;  3I0L A;  1NQI B;  1PZY B;  4Y7F A;  2E8B A;  3SX3 A;  3OAM A;  1O23 B;  3R3I A;  3SXA A;  1MC3 A;  1IIN A;  5C1G A;  1E5K A;  1G95 A;  1G3L A;  3U0Y A;  5C48 A;  1ZI3 A;  1JV1 A;  2VD4 A;  1VPA A;  2AE7 A;  2FYD B;  2Y4L A;  2V0L A;  3QVB A;  2VS4 A;  4DEC A;  2GGQ A;  3FWW A;  4GBP A;  3KIA A;  5AJN A;  5C3B A;  5C3A A;  1Z90 A;  3ZF8 A;  4EE3 A;  2WE9 A;  1G1L A;  1H7E A;  5C49 A;  4YS8 A;  4J18 A;  1TW5 A;  4NAK A;  1NF5 B;  1QGS A;  1VGT A;  4HO9 A;  2W0W A;  2XWM A;  4KC1 A;  1LL3 A;  1H7G A;  1EZI A;  1ZDF A;  4ECM A;  1YP3 A;  1H4E A;  3V0Q A;  3BRK X;  2P73 A;  1V83 A;  1FR9 A;  5L6S A;  3RMV A;  2X5Z A;  3CKN A;  4Y7U A;  5CQN X;  4B4G A;  5C36 A;  4Y63 A;  5FUH A;  2RIX A;  3I0C A;  2I5E A;  4FIX A;  2VXL A;  4G3Q A;  4C2S A;  3ZGF A;  2O1F A;  2Y4M A;  3U2U A;  1FXO A;  3FOQ A;  1HV9 A;  1ZIZ A;  2PGV A;  1FOA A;  1ZCV A;  3HL3 A;  1ZCU A;  1FO8 A;  1YRO B;  1H7L A;  4JD0 A;  3SX7 A;  2VK9 A;  4HO4 A;  2ICY A;  1YP4 A;  1W57 A;  2VFZ A;  2BO4 A;  2Y7A A;  1S4P A;  1JVG A;  3SX8 A;  1VM8 A;  5CQO A;  2OI7 A;  4E1K A;  1FWY A;  3CKJ A;  2XME A;  1G0R A;  4CJB A;  1SS9 A;  4ASY A;  5C3D A;  1V84 A;  1G23 A;  1H7F A;  4O6M A;  1WT2 A;  2W0V A;  5CMF X;  2VSH A;  1NMM B;  5FU0 A;  1G97 A;  1VGW A;  2APC A;  5D92 A;  4EE5 A;  1ZJ0 A;  1R82 A;  1GX0 A;  2BO8 A;  3I0G A;  5C4C A;  4KRV A;  2OEG A;  2E3D A;  3OH2 A;  4EEO A;  4DDZ A;  4FIY A;  3U2X A;  1V82 A;  1XZ6 A;  2FYC B;  4L41 C;  3JTJ A;  1H5R A;  2YQH A;  4FQW A;  3V0N A;  2Y4K A;  3E25 A;  2OI6 A;  5EIY A;  5EJZ A;  2WGZ A;  2XWL A;  2DPW A;  4MYB A;  2AH9 A;  2YQS A;  1G9R A;  2AM4 A;  3IOJ A;  4D11 A;  5C38 A;  5L6V A;  1IIM A;  4AYJ A;  2FFV A;  3CU0 A;  2QH5 A;  1NWG B;  2PGY A;  4B5B A;  3V0M A;  1JYL A;  3DK5 A;  1QGQ A;  4B2W A;  2ZU9 A;  1H4D A;  4D48 A;  1GWV A;  2I5K A;  3U0X A;  1VH1 A;  1H5T B;  1ON6 A;  1VZT A;  3F1Y A;  1H5S D;  1H5S A;  3SPT A;  1GX4 A;  2I7B A;  2OEF A;  2YES A;  4AAW A;  3D98 A;  2XMH A;  4Y7T A;  5CMG X;  4KPX A;  4IRP A;  4FRL A;  2AM3 A;  4Y6N A;  2GGO A;  1FGG A;  1R7Y A;  3CKQ A;  3IOH A;  1INJ A;  3OH0 A;  1JV3 A;  2PA4 A;  4DE7 A;  2Z86 A;  4CJC A;  1ZCT A;  4BMA A;  3LW6 A;  1WVC A;  2ZU7 A;  1FXJ A;  2X65 A;  1FZW A;  2AEC A;  4FRD A;  4HO5 A;  4M4K A;  3T7N A;  2FY7 A;  4M2A A;  4FRM A;  3I0F A;  3OH1 A;  4MIX A;  3USR A;  1TVY A;  5I1F A;  2RJ1 A;  1MP4 A;  1R7X A;  4FRB A;  5AJP A;  5IFY A;  5AJO A;  4KNX A;  4EVW A;  2RIT A;  2RJ5 A;  1R7U A;  3D5N A;  1PZT A;  5FV9 A;  1LL2 A;  2JCO A;  1NHE B;  1GQC A;  1G93 A;  3K8D A;  1WT0 A;  1EYR A;  4M2B A;  1H5S C;  2D0J A;  1O7O A;  2UX8 A;  1G2V A;  2YC3 A;  3I0K A;  3JUJ A;  4Y7V A;  4FRO A;  2BO7 A;  2WAW A;  2QKX A;  1ZHJ A;  1R80 A;  4P02 A;  4Y62 A;  1ZI1 A;  3PKP A;  2V0K A;  3ZLK A;  1S4O A;  4NAI A;  3PNN A;  1ZJ1 A;  1GWW A;  4ZDQ A;  2O1G A;  5DDV A;  3T7O A;  3TZT A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...