1R7VA

Glycosyltransferase a in complex with 3-amino-acceptor analog inhibitor
Total Genus 80
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
80
sequence length
283
structure length
263
Chain Sequence
MVSLPRMVYPQPKVLTPCRKDVLVVTPWLAPIVWEGTFNIDILNEQFRLQNTTIGLTVFAIKKYVAFLKLFLETAEKHFMVGHRVHYYVFTDQPAAVPRVTLGTGRQLSVLEVCERRFLSEVDYLVCVDVDMEFRDHVGVEILTPLFGTLHPGFYGSSREAFTYERRPQSQAYIPKDEGDFYYLGGFFGGSVQEVQRLTRACHQAMMVDQANGIEAVWHDESHLNKYLLRHKPTKVLSPEYLWDQQLLGWPAVLRKLRFTAVP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Glycoprotein-fucosylgalactoside alpha-N-acetylgalactosaminyl
publication title The influence of an intramolecular hydrogen bond in differential recognition of inhibitory acceptor analogs by human ABO(H) blood group A and B glycosyltransferases
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 80
structure length 263
sequence length 283
ec nomenclature ec 2.4.1.37: Fucosylgalactoside 3-alpha-galactosyltransferase.
pdb deposition date 2003-10-22
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.550.10 Alpha Beta Alpha-Beta Complex Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A 1r7vA00
5C47A 3U2UA 4FRAA 3I0GA 3Q7UA 1O0RA 2FYBA 4KNRA 2YCMA 2ICYA 3ZF8A 3SX5A 1H5SB 3PNNA 1ZJ1A 2VS3A 4FQWA 5C3BA 3V8YA 4KC1A 1G0RA 1LL3A 4EEMA 1HV9A 2NXVA 1FO8A 1H7FA 1S4OA 1V82A 2I7BA 2JCJA 1QGQA 2VS5A 3JUJA 4FCUA 1R81A 5CQPA 1H7EA 1HM9A 3R3IA 3EE5A 4AYJA 1FGGA 5C49A 4XWIA 3OC9A 4YS8A 3V0MA 5C4EA 2ZU8A 1FRWA 2PA4A 3PKPA 1GWVA 5L6SA 3E26A 1FOAA 1LZ7A 1WT2A 2ICXA 2RJ6A 2VSIA 5FU0A 4EE4A 4FCEA 4KRVA 3D5NA 1PZYB 1JYLA 3IOIA 2AM3A 3I0EA 1HM0A 3OGZA 3FOQA 1FG5N 1TVYA 1MC3A 1H7HA 2JCLA 1WT0A 2I5KA 2Y4JA 1S4PA 1GQCA 1HJJA 2X5ZA 1H5TA 3ZGGA 1G97A 2V0LA 5FV9A 3ZGFA 3OAMA 5CMFX 4D11C 3NGWA 4P02A 3V8ZA 4ASYA 3CKVA 4Y6NA 1ON8A 2Y7AA 1SS9A 4AYLA 1G8OA 5CMJA 1Z90A 1VZUA 4C2SA 2AESA 4P00A 4MNDA 1NKHB 5C3AA 1YP2A 2D0JA 5I1FA 4EE5A 2OEGA 1G9RA 3T7MA 1R7UA 2OI5A 3CKOA 4ASJA 5AJOA 1VGZA 4NAKA 2V0IA 1VH3A 1GA8A 1HM8A 5EIYA 3D98A 4UEGA 3I0HA 4KPXA 2WAWA 3POLA 3V91A 1O7QA 4Y7FA 1W77A 4FRHA 1XHBA 4GBPA 3TZTA 4ARWA 1NHEB 1NWGB 1EZIA 2MZBA 4D11A 3V0PA 4B4MA 4AC3A 3CGXA 4EEOA 1EYRA 2Z86A 1VPAA 4JD0A 1V83A 4B4GA 4HO3A 2YC5A 2YESA 3DJ4A 1NF5B 4FRBA 4KXOA 2ZU7A 2BO7A 3DUVA 1H5RB 1VM8A 4J18A 1H4DA 4M28A 2RJ0A 4EE3A 2WVLA 5C4BA 1QG8A 3CKNA 1FR8A 4ZDQA 4G3QA 5IDTA 1V84A 1H7LA 2GGQA 1MP4A 2VS4A 4HO0A 4G87A 3I0IX 1VGUA 2Z87A 3N9WA 5C36A 4FRDA 3SXBA 3I0LA 3ZLKA 4IRQA 4G3PA 2YQHA 4HO8A 4E1KA 2OI6A 4Y64A 5DDTA 2OI7A 2XMHA 2RIXA 5CMHA 3QVBA 1H5SC 2D7RA 5FTSA 3TQDA 1VICA 1ZJ2A 2YQJA 4Y7VA 3USQA 2WGZA 5JQQA 1R7XA 3O3PA 4EEGA 5DDVA 2AM4A 3RMVA 4M2AA 1TW5A 2ZU9A 1K4VA 2RJ9A 1YROB 1ZI5A 2VFZA 1GQ9A 5J49A 5C4FA 1YP3A 1ON6A 4FRQA 3CKQA 3SX8A 4M2BA 4B2XA 2P73A 1NQIB 2V0HA 2Q4JA 2RJ7A 4M4KA 3LW6A 3JUKA 2WVKA 2YQSA 3OH2A 2W0WA 2BO4A 2APCA 1R7YA 2A8UA 2E8BA 4KC2A 4B5BA 1ZDGA 2RJ5A 2BO8A 3V0LA 2FYDB 4FRLA 1VGTA 2WE9A 3V0NA 3OH1A 1LZ0A 3D8VA 4Y7UA 3FWWA 4Y7GA 2RJ1A 5C4CA 1ZI3A 4BMAA 4MYBA 5CMIA 4LW6A 4KT7A 4KC4A 3K8DA 3ZLLA 2PX7A 3JTJA 1INJA 4Y9XA 1GWWA 4BQHA 1OMXA 1LL2A 4B3UA 2XWLA 4DECA 3V90A 3RSBA 5IFYA 3SX7A 5EJZA 5FTVA 4FRMA 2RIYA 2RJ4A 3U0XA 3SXGA 1IIMA 1H7GA 1LL0A 4NAIA 2VXMA 5IDSA 2OEFA 2RJ8A 1G95A 4CJCA 2Y4MA 2AE7A 1LZJA 3I0DA 4NANA 2O1HA 4HOCA 4JISA 1ZCVA 1ZDFA 4AAWA 2UX8A 2VSHA 3V0OA 1FZWA 2Y6PA 2FY7A 2I5EA 3F1YA 1XZ6A 1ZCYA 2X60A 4HO9A 3U2VA 1W57A 2PGVA 2GGOA 2XWMA 3ST8A 3K8EA 1WT1A 1VH1A 3V0QA 4K6RA 1FWYA 5L6VA 2P72A 3CU0A 1G93A 3I0FA 1GX0A 1TW1A 3F1CA 2WVMA 1I52A 3OH0A 3R2WA 3SPTA 1NMMB 4HO2A 3BRKX 4D0TA 1VGWA 2RITA 2V0JA 5HS2A 1JYKA 5C1GA 4B4BA 2VXLA 1JVGA 3U2TA 3SXCA 1G1LA 1FR9A 1FXJA 2E3DA 2DPWA 1R7VA 1O7OA 1H5TB 4B2WA 2FFVA 4KQLA 3OH3A 2XMEA 5CQNX 1YP4A 1ZIZA 3CKJA 4HO4A 1R82A 4KNXA 5C48A 5EJ1A 5CMGX 1H4EA 4LW3A 3I0JA 1R7TA 1H5SD 1IINA 1H5RA 1R80A 2A8WA 2CU2A 3Q4SA 4D0ZA 4IRPA 1JV3A 4R7PA 1JVDA 3E25A 1JV1A 1LZIA 3GUEA 3T7OA 1TZFA 1FXOA 2RIZA 5FYEA 2FYAA 2YC3A 2AGDA 1H5SA 3IOJA 4HO5A 1INIA 4Y63A 1WT3A 3DK5A 1ZI4A 3SXAA 2BO6A 3USRA 3OKRA 2JCKA 2W0VA 2X5SA 4CJ8A 1ZHJA 3I0CA 1OMZA 2P6WA 3IOHA 4L41C 2Y4KA 2XWNA 3KIAA 1ZCTA 4EEAA 1ZI1A 1ZCUA 1LVWA 3BCVA 3U0YA 4FRPA 2WEEA 3U2WA 2PGYA 1HJLA 2FYCB 1ZJ3A 1FGXA 5C3DA 5C1HA 1G2VA 1ZJPA 1KWSA 1MP5A 5FUHA 5C1LA 5C4DA 1GX4A 3T7NA 1H7TA 2Y4LA 1FO9A 1H7QA 2VD4A 2AH9A 1PZTA 4Y6UA 3U2XA 2QGIA 2O1GA 4HO6A 1VZXA 2O1FA 5CQOA 5FU8A 2FFUA 1QWJA 3OH4A 3SX3A 5CQLX 2X65A 1H4CA 2D7IA 3HL3A 5CQMX 1ZJ0A 4Y7TA 2QH5A 5BXCA 1S4NA 1E5KA 4NALA 2QKXA 1WSZA 1VZTA 2AM5A 2JCOA 4G3SA 4CVHA 4HG6A 4B42A 1ZJOA 1OQMB 4FREA 2V0KA 3Q80A 3I0KA 4Y62A 3SXDA 1W55A 3RMWA 4DE7A 4DDZA 1G23A 4KPZA 2YQCA 5AJPA 4ECMA 4EVWA 5C8RA 5C38A 1H3MA 1G3LA 4CJBA 4FROA 1O23B 3PKQA 1MP3A 1WVCA 5AJNA 3SXEA 4HCQA 4D48A 1QGSA 2AECA
chains in the Genus database with same CATH superfamily
5C47A 3U2UA 4FRAA 3I0GA 3Q7UA 1O0RA 2FYBA 4KNRA 2YCMA 2ICYA 3ZF8A 3SX5A 1H5SB 3PNNA 1ZJ1A 2VS3A 4FQWA 5C3BA 3V8YA 4KC1A 1G0RA 1LL3A 4EEMA 1HV9A 2NXVA 1FO8A 1H7FA 1S4OA 1V82A 2I7BA 2JCJA 1QGQA 2VS5A 3JUJA 4FCUA 1R81A 5CQPA 1H7EA 1HM9A 3R3IA 3EE5A 4AYJA 1FGGA 5C49A 4XWIA 3OC9A 4YS8A 3V0MA 5C4EA 2ZU8A 1FRWA 2PA4A 3PKPA 1GWVA 5L6SA 3E26A 1FOAA 1LZ7A 1WT2A 2ICXA 2RJ6A 2VSIA 5FU0A 4EE4A 4FCEA 4KRVA 3D5NA 1PZYB 1JYLA 3IOIA 2AM3A 3I0EA 1HM0A 3OGZA 3FOQA 1FG5N 1TVYA 1MC3A 1H7HA 2VK9A 2JCLA 1WT0A 2I5KA 2Y4JA 1S4PA 1GQCA 1HJJA 2X5ZA 1H5TA 3ZGGA 1G97A 2V0LA 5FV9A 3ZGFA 3OAMA 5CMFX 4D11C 3NGWA 4P02A 3V8ZA 4ASYA 3CKVA 4Y6NA 1ON8A 2Y7AA 1SS9A 4AYLA 1G8OA 5CMJA 1Z90A 1VZUA 4C2SA 2AESA 4P00A 4MNDA 1NKHB 5C3AA 1YP2A 2D0JA 5I1FA 4EE5A 2OEGA 1G9RA 3T7MA 1R7UA 2OI5A 3CKOA 4ASJA 5D92A 5AJOA 1VGZA 4NAKA 2V0IA 1VH3A 1GA8A 1HM8A 5EIYA 3D98A 4UEGA 3I0HA 4KPXA 2WAWA 3POLA 3V91A 1O7QA 4Y7FA 1W77A 4FRHA 1XHBA 2J0AA 4GBPA 3TZTA 4ARWA 1NHEB 1NWGB 1EZIA 2MZBA 4D11A 3V0PA 5D91A 4B4MA 4AC3A 3CGXA 4EEOA 1EYRA 2Z86A 1VPAA 4JD0A 1V83A 4B4GA 4HO3A 2YC5A 2YESA 3DJ4A 1NF5B 4FRBA 4KXOA 2ZU7A 2BO7A 3DUVA 1H5RB 1VM8A 4J18A 1H4DA 4M28A 2RJ0A 4EE3A 2WVLA 5C4BA 1QG8A 3CKNA 1FR8A 4ZDQA 4G3QA 5IDTA 1V84A 1H7LA 2GGQA 1MP4A 2VS4A 4HO0A 4G87A 3I0IX 1VGUA 2Z87A 3N9WA 5C36A 4FRDA 3SXBA 3I0LA 4MIXA 3ZLKA 4IRQA 4G3PA 2YQHA 4HO8A 4E1KA 2OI6A 4Y64A 5DDTA 2OI7A 2XMHA 2RIXA 5CMHA 3QVBA 1H5SC 2D7RA 5FTSA 3TQDA 1VICA 1ZJ2A 2YQJA 4Y7VA 3USQA 2WGZA 5JQQA 1R7XA 3O3PA 4EEGA 5DDVA 2AM4A 3RMVA 4M2AA 1TW5A 2ZU9A 1K4VA 2RJ9A 1YROB 1ZI5A 2VFZA 1GQ9A 5J49A 5C4FA 1YP3A 1ON6A 2J0BA 4FRQA 3CKQA 3SX8A 4M2BA 4B2XA 2P73A 1NQIB 2V0HA 2Q4JA 2RJ7A 4M4KA 3LW6A 3JUKA 2WVKA 2YQSA 3OH2A 2W0WA 2BO4A 2APCA 1R7YA 2A8UA 2E8BA 4KC2A 4B5BA 1ZDGA 2RJ5A 2BO8A 3V0LA 2FYDB 4FRLA 1VGTA 2WE9A 3V0NA 3OH1A 1LZ0A 3D8VA 4Y7UA 3FWWA 4Y7GA 2RJ1A 5C4CA 1ZI3A 4BMAA 4MYBA 5CMIA 4O6MA 4LW6A 4KT7A 4KC4A 3K8DA 3ZLLA 2PX7A 3JTJA 1INJA 4Y9XA 1GWWA 2C0NA 4BQHA 1OMXA 1LL2A 4B3UA 2XWLA 4DECA 3V90A 3RSBA 5IFYA 3SX7A 5EJZA 5FTVA 4FRMA 2RIYA 2RJ4A 3U0XA 3SXGA 1IIMA 1H7GA 1LL0A 4NAIA 2VXMA 5IDSA 2OEFA 2RJ8A 1G95A 4CJCA 2Y4MA 2AE7A 1LZJA 3I0DA 4NANA 2O1HA 4HOCA 4JISA 1ZCVA 1ZDFA 4AAWA 2UX8A 2VSHA 3V0OA 1FZWA 2Y6PA 2FY7A 2I5EA 3F1YA 1XZ6A 1ZCYA 2X60A 4HO9A 3U2VA 1W57A 2PGVA 2GGOA 2XWMA 3ST8A 3K8EA 1WT1A 1VH1A 3V0QA 4K6RA 1FWYA 5L6VA 2P72A 3CU0A 1G93A 3I0FA 1GX0A 1TW1A 3F1CA 2WVMA 1I52A 3OH0A 3R2WA 3SPTA 1NMMB 4HO2A 3BRKX 4D0TA 1VGWA 2RITA 2V0JA 5HS2A 1JYKA 5C1GA 4B4BA 2VXLA 1JVGA 3U2TA 3SXCA 1G1LA 1FR9A 1FXJA 2E3DA 2DPWA 1R7VA 1O7OA 1H5TB 4B2WA 2FFVA 4KQLA 3OH3A 2XMEA 5CQNX 1YP4A 1ZIZA 3CKJA 4HO4A 1R82A 4KNXA 5C48A 5EJ1A 5CMGX 1H4EA 4LW3A 4Q7CA 3I0JA 1R7TA 1H5SD 1IINA 1H5RA 1R80A 2A8WA 2CU2A 3Q4SA 4D0ZA 4IRPA 1JV3A 4R7PA 1JVDA 3E25A 1JV1A 1LZIA 3GUEA 3T7OA 1TZFA 1FXOA 2RIZA 5FYEA 2FYAA 2YC3A 2AGDA 1H5SA 3IOJA 4HO5A 1INIA 4Y63A 1WT3A 3DK5A 1ZI4A 3SXAA 2BO6A 3USRA 3OKRA 2JCKA 2W0VA 2X5SA 4CJ8A 1ZHJA 3I0CA 1OMZA 2P6WA 3IOHA 4L41C 2Y4KA 2XWNA 3KIAA 1ZCTA 4EEAA 1ZI1A 1ZCUA 1LVWA 3BCVA 3U0YA 4FRPA 2WEEA 3U2WA 2PGYA 1HJLA 2FYCB 1ZJ3A 1FGXA 5C3DA 5C1HA 1G2VA 1ZJPA 1KWSA 1MP5A 5FUHA 5C1LA 5C4DA 1GX4A 3T7NA 1H7TA 2Y4LA 1FO9A 1H7QA 2VD4A 2AH9A 1PZTA 4Y6UA 3U2XA 2QGIA 2O1GA 4HO6A 1VZXA 2O1FA 5CQOA 5FU8A 2FFUA 1QWJA 3OH4A 3SX3A 5CQLX 2X65A 1H4CA 2D7IA 3HL3A 5CQMX 1ZJ0A 4Y7TA 2QH5A 5BXCA 1S4NA 1E5KA 4NALA 2QKXA 1WSZA 1VZTA 2AM5A 2JCOA 4G3SA 4CVHA 4HG6A 4B42A 1ZJOA 1OQMB 4FREA 2V0KA 3Q80A 3I0KA 4Y62A 3SXDA 1W55A 3RMWA 4DE7A 4DDZA 1G23A 4KPZA 2YQCA 5AJPA 4ECMA 4EVWA 5C8RA 5C38A 1H3MA 1G3LA 4FIYA 4CJBA 4FROA 1O23B 3PKQA 4O6NA 1MP3A 1WVCA 4FIXA 5AJNA 3SXEA 4HCQA 4D48A 1QGSA 2AECA
chains in the Genus database with same CATH topology
5C47A 3U2UA 4FRAA 3I0GA 3Q7UA 1O0RA 2FYBA 4KNRA 2YCMA 2ICYA 3ZF8A 3SX5A 1H5SB 3PNNA 1ZJ1A 2VS3A 4FQWA 5C3BA 3V8YA 4KC1A 1G0RA 1LL3A 4EEMA 1HV9A 2NXVA 1FO8A 1H7FA 1S4OA 1V82A 2I7BA 2JCJA 1QGQA 2VS5A 3JUJA 4FCUA 1R81A 5CQPA 1H7EA 1HM9A 3R3IA 3EE5A 4AYJA 1FGGA 5C49A 4XWIA 3OC9A 4YS8A 3V0MA 5C4EA 2ZU8A 1FRWA 2PA4A 3PKPA 1GWVA 5L6SA 3E26A 1FOAA 1LZ7A 1WT2A 2ICXA 2RJ6A 2VSIA 5FU0A 4EE4A 4FCEA 4KRVA 3D5NA 1PZYB 1JYLA 3IOIA 2AM3A 3I0EA 1HM0A 3OGZA 3FOQA 1FG5N 1TVYA 1MC3A 1H7HA 2VK9A 2JCLA 1WT0A 2I5KA 2Y4JA 1S4PA 1GQCA 1HJJA 2X5ZA 1H5TA 3ZGGA 1G97A 2V0LA 5FV9A 3ZGFA 3OAMA 5CMFX 4D11C 3NGWA 4P02A 3V8ZA 4ASYA 3CKVA 4Y6NA 1ON8A 2Y7AA 1SS9A 4AYLA 1G8OA 5CMJA 1Z90A 1VZUA 4C2SA 2AESA 4P00A 4MNDA 1NKHB 5C3AA 1YP2A 2D0JA 5I1FA 4EE5A 2OEGA 1G9RA 3T7MA 1R7UA 2OI5A 3CKOA 4ASJA 5D92A 5AJOA 1VGZA 4NAKA 2V0IA 1VH3A 1GA8A 1HM8A 5EIYA 3D98A 4UEGA 3I0HA 4KPXA 2WAWA 3POLA 3V91A 1O7QA 4Y7FA 1W77A 4FRHA 1XHBA 2J0AA 4GBPA 3TZTA 4ARWA 1NHEB 1NWGB 1EZIA 2MZBA 4D11A 3V0PA 5D91A 4B4MA 4AC3A 3CGXA 4EEOA 1EYRA 2Z86A 1VPAA 4JD0A 1V83A 4B4GA 4HO3A 2YC5A 2YESA 3DJ4A 1NF5B 4FRBA 4KXOA 2ZU7A 2BO7A 3DUVA 1H5RB 1VM8A 4J18A 1H4DA 4M28A 2RJ0A 4EE3A 2WVLA 5C4BA 1QG8A 3CKNA 1FR8A 4ZDQA 4G3QA 5IDTA 1V84A 1H7LA 2GGQA 1MP4A 2VS4A 4HO0A 4G87A 3I0IX 1VGUA 2Z87A 3N9WA 5C36A 4FRDA 3SXBA 3I0LA 4MIXA 3ZLKA 4IRQA 4G3PA 2YQHA 4HO8A 4E1KA 2OI6A 4Y64A 5DDTA 2OI7A 2XMHA 2RIXA 5CMHA 3QVBA 1H5SC 2D7RA 5FTSA 3TQDA 1VICA 1ZJ2A 2YQJA 4Y7VA 3USQA 2WGZA 5JQQA 1R7XA 3O3PA 4EEGA 5DDVA 2AM4A 3RMVA 4M2AA 1TW5A 2ZU9A 1K4VA 2RJ9A 1YROB 1ZI5A 2VFZA 1GQ9A 5J49A 5C4FA 1YP3A 1ON6A 2J0BA 4FRQA 3CKQA 3SX8A 4M2BA 4B2XA 2P73A 1NQIB 2V0HA 2Q4JA 2RJ7A 4M4KA 3LW6A 3JUKA 2WVKA 2YQSA 3OH2A 2W0WA 2BO4A 2APCA 1R7YA 2A8UA 2E8BA 4KC2A 4B5BA 1ZDGA 2RJ5A 2BO8A 3V0LA 2FYDB 4FRLA 1VGTA 2WE9A 3V0NA 3OH1A 1LZ0A 3D8VA 4Y7UA 3FWWA 4Y7GA 2RJ1A 5C4CA 1ZI3A 4BMAA 4MYBA 5CMIA 4O6MA 4LW6A 4KT7A 4KC4A 3K8DA 3ZLLA 2PX7A 3JTJA 1INJA 4Y9XA 1GWWA 2C0NA 4BQHA 1OMXA 1LL2A 4B3UA 2XWLA 4DECA 3V90A 3RSBA 5IFYA 3SX7A 5EJZA 5FTVA 4FRMA 2RIYA 2RJ4A 3U0XA 3SXGA 1IIMA 1H7GA 1LL0A 4NAIA 2VXMA 5IDSA 2OEFA 2RJ8A 1G95A 4CJCA 2Y4MA 2AE7A 1LZJA 3I0DA 4NANA 2O1HA 4HOCA 4JISA 1ZCVA 1ZDFA 4AAWA 2UX8A 2VSHA 3V0OA 1FZWA 2Y6PA 2FY7A 2I5EA 3F1YA 1XZ6A 1ZCYA 2X60A 4HO9A 3U2VA 1W57A 2PGVA 2GGOA 2XWMA 3ST8A 3K8EA 1WT1A 1VH1A 3V0QA 4K6RA 1FWYA 5L6VA 2P72A 3CU0A 1G93A 3I0FA 1GX0A 1TW1A 3F1CA 2WVMA 1I52A 3OH0A 3R2WA 3SPTA 1NMMB 4HO2A 3BRKX 4D0TA 1VGWA 2RITA 2V0JA 5HS2A 1JYKA 5C1GA 4B4BA 2VXLA 1JVGA 3U2TA 3SXCA 1G1LA 1FR9A 1FXJA 2E3DA 2DPWA 1R7VA 1O7OA 1H5TB 4B2WA 2FFVA 4KQLA 3OH3A 2XMEA 5CQNX 1YP4A 1ZIZA 3CKJA 4HO4A 1R82A 4KNXA 5C48A 5EJ1A 5CMGX 1H4EA 4LW3A 4Q7CA 3I0JA 1R7TA 1H5SD 1IINA 1H5RA 1R80A 2A8WA 2CU2A 3Q4SA 4D0ZA 4IRPA 1JV3A 4R7PA 1JVDA 3E25A 1JV1A 1LZIA 3GUEA 3T7OA 1TZFA 1FXOA 2RIZA 5FYEA 2FYAA 2YC3A 2AGDA 1H5SA 3IOJA 4HO5A 1INIA 4Y63A 1WT3A 3DK5A 1ZI4A 3SXAA 2BO6A 3USRA 3OKRA 2JCKA 2W0VA 2X5SA 4CJ8A 1ZHJA 3I0CA 1OMZA 2P6WA 3IOHA 4L41C 2Y4KA 2XWNA 3KIAA 1ZCTA 4EEAA 1ZI1A 1ZCUA 1LVWA 3BCVA 3U0YA 4FRPA 2WEEA 3U2WA 2PGYA 1HJLA 2FYCB 1ZJ3A 1FGXA 5C3DA 5C1HA 1G2VA 1ZJPA 1KWSA 1MP5A 5FUHA 5C1LA 5C4DA 1GX4A 3T7NA 1H7TA 2Y4LA 1FO9A 1H7QA 2VD4A 2AH9A 1PZTA 4Y6UA 3U2XA 2QGIA 2O1GA 4HO6A 1VZXA 2O1FA 5CQOA 5FU8A 2FFUA 1QWJA 3OH4A 3SX3A 5CQLX 2X65A 1H4CA 2D7IA 3HL3A 5CQMX 1ZJ0A 4Y7TA 2QH5A 5BXCA 1S4NA 1E5KA 4NALA 2QKXA 1WSZA 1VZTA 2AM5A 2JCOA 4G3SA 4CVHA 4HG6A 4B42A 1ZJOA 1OQMB 4FREA 2V0KA 3Q80A 3I0KA 4Y62A 3SXDA 1W55A 3RMWA 4DE7A 4DDZA 1G23A 4KPZA 2YQCA 5AJPA 4ECMA 4EVWA 5C8RA 5C38A 1H3MA 1G3LA 4FIYA 4CJBA 4FROA 1O23B 3PKQA 4O6NA 1MP3A 1WVCA 4FIXA 5AJNA 3SXEA 4HCQA 4D48A 1QGSA 2AECA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5C47 A;  3U2U A;  4FRA A;  3I0G A;  3Q7U A;  1O0R A;  2FYB A;  4KNR A;  2YCM A;  2ICY A;  3ZF8 A;  3SX5 A;  1H5S B;  3PNN A;  1ZJ1 A;  2VS3 A;  4FQW A;  5C3B A;  3V8Y A;  4KC1 A;  1G0R A;  1LL3 A;  4EEM A;  1HV9 A;  2NXV A;  1FO8 A;  1H7F A;  1S4O A;  1V82 A;  2I7B A;  2JCJ A;  1QGQ A;  2VS5 A;  3JUJ A;  4FCU A;  1R81 A;  5CQP A;  1H7E A;  1HM9 A;  3R3I A;  3EE5 A;  4AYJ A;  1FGG A;  5C49 A;  4XWI A;  3OC9 A;  4YS8 A;  3V0M A;  5C4E A;  2ZU8 A;  1FRW A;  2PA4 A;  3PKP A;  1GWV A;  5L6S A;  3E26 A;  1FOA A;  1LZ7 A;  1WT2 A;  2ICX A;  2RJ6 A;  2VSI A;  5FU0 A;  4EE4 A;  4FCE A;  4KRV A;  3D5N A;  1PZY B;  1JYL A;  3IOI A;  2AM3 A;  3I0E A;  1HM0 A;  3OGZ A;  3FOQ A;  1FG5 N;  1TVY A;  1MC3 A;  1H7H A;  2JCL A;  1WT0 A;  2I5K A;  2Y4J A;  1S4P A;  1GQC A;  1HJJ A;  2X5Z A;  1H5T A;  3ZGG A;  1G97 A;  2V0L A;  5FV9 A;  3ZGF A;  3OAM A;  5CMF X;  4D11 C;  3NGW A;  4P02 A;  3V8Z A;  4ASY A;  3CKV A;  4Y6N A;  1ON8 A;  2Y7A A;  1SS9 A;  4AYL A;  1G8O A;  5CMJ A;  1Z90 A;  1VZU A;  4C2S A;  2AES A;  4P00 A;  4MND A;  1NKH B;  5C3A A;  1YP2 A;  2D0J A;  5I1F A;  4EE5 A;  2OEG A;  1G9R A;  3T7M A;  1R7U A;  2OI5 A;  3CKO A;  4ASJ A;  5AJO A;  1VGZ A;  4NAK A;  2V0I A;  1VH3 A;  1GA8 A;  1HM8 A;  5EIY A;  3D98 A;  4UEG A;  3I0H A;  4KPX A;  2WAW A;  3POL A;  3V91 A;  1O7Q A;  4Y7F A;  1W77 A;  4FRH A;  1XHB A;  4GBP A;  3TZT A;  4ARW A;  1NHE B;  1NWG B;  1EZI A;  2MZB A;  4D11 A;  3V0P A;  4B4M A;  4AC3 A;  3CGX A;  4EEO A;  1EYR A;  2Z86 A;  1VPA A;  4JD0 A;  1V83 A;  4B4G A;  4HO3 A;  2YC5 A;  2YES A;  3DJ4 A;  1NF5 B;  4FRB A;  4KXO A;  2ZU7 A;  2BO7 A;  3DUV A;  1H5R B;  1VM8 A;  4J18 A;  1H4D A;  4M28 A;  2RJ0 A;  4EE3 A;  2WVL A;  5C4B A;  1QG8 A;  3CKN A;  1FR8 A;  4ZDQ A;  4G3Q A;  5IDT A;  1V84 A;  1H7L A;  2GGQ A;  1MP4 A;  2VS4 A;  4HO0 A;  4G87 A;  3I0I X;  1VGU A;  2Z87 A;  3N9W A;  5C36 A;  4FRD A;  3SXB A;  3I0L A;  3ZLK A;  4IRQ A;  4G3P A;  2YQH A;  4HO8 A;  4E1K A;  2OI6 A;  4Y64 A;  5DDT A;  2OI7 A;  2XMH A;  2RIX A;  5CMH A;  3QVB A;  1H5S C;  2D7R A;  5FTS A;  3TQD A;  1VIC A;  1ZJ2 A;  2YQJ A;  4Y7V A;  3USQ A;  2WGZ A;  5JQQ A;  1R7X A;  3O3P A;  4EEG A;  5DDV A;  2AM4 A;  3RMV A;  4M2A A;  1TW5 A;  2ZU9 A;  1K4V A;  2RJ9 A;  1YRO B;  1ZI5 A;  2VFZ A;  1GQ9 A;  5J49 A;  5C4F A;  1YP3 A;  1ON6 A;  4FRQ A;  3CKQ A;  3SX8 A;  4M2B A;  4B2X A;  2P73 A;  1NQI B;  2V0H A;  2Q4J A;  2RJ7 A;  4M4K A;  3LW6 A;  3JUK A;  2WVK A;  2YQS A;  3OH2 A;  2W0W A;  2BO4 A;  2APC A;  1R7Y A;  2A8U A;  2E8B A;  4KC2 A;  4B5B A;  1ZDG A;  2RJ5 A;  2BO8 A;  3V0L A;  2FYD B;  4FRL A;  1VGT A;  2WE9 A;  3V0N A;  3OH1 A;  1LZ0 A;  3D8V A;  4Y7U A;  3FWW A;  4Y7G A;  2RJ1 A;  5C4C A;  1ZI3 A;  4BMA A;  4MYB A;  5CMI A;  4LW6 A;  4KT7 A;  4KC4 A;  3K8D A;  3ZLL A;  2PX7 A;  3JTJ A;  1INJ A;  4Y9X A;  1GWW A;  4BQH A;  1OMX A;  1LL2 A;  4B3U A;  2XWL A;  4DEC A;  3V90 A;  3RSB A;  5IFY A;  3SX7 A;  5EJZ A;  5FTV A;  4FRM A;  2RIY A;  2RJ4 A;  3U0X A;  3SXG A;  1IIM A;  1H7G A;  1LL0 A;  4NAI A;  2VXM A;  5IDS A;  2OEF A;  2RJ8 A;  1G95 A;  4CJC A;  2Y4M A;  2AE7 A;  1LZJ A;  3I0D A;  4NAN A;  2O1H A;  4HOC A;  4JIS A;  1ZCV A;  1ZDF A;  4AAW A;  2UX8 A;  2VSH A;  3V0O A;  1FZW A;  2Y6P A;  2FY7 A;  2I5E A;  3F1Y A;  1XZ6 A;  1ZCY A;  2X60 A;  4HO9 A;  3U2V A;  1W57 A;  2PGV A;  2GGO A;  2XWM A;  3ST8 A;  3K8E A;  1WT1 A;  1VH1 A;  3V0Q A;  4K6R A;  1FWY A;  5L6V A;  2P72 A;  3CU0 A;  1G93 A;  3I0F A;  1GX0 A;  1TW1 A;  3F1C A;  2WVM A;  1I52 A;  3OH0 A;  3R2W A;  3SPT A;  1NMM B;  4HO2 A;  3BRK X;  4D0T A;  1VGW A;  2RIT A;  2V0J A;  5HS2 A;  1JYK A;  5C1G A;  4B4B A;  2VXL A;  1JVG A;  3U2T A;  3SXC A;  1G1L A;  1FR9 A;  1FXJ A;  2E3D A;  2DPW A;  1R7V A;  1O7O A;  1H5T B;  4B2W A;  2FFV A;  4KQL A;  3OH3 A;  2XME A;  5CQN X;  1YP4 A;  1ZIZ A;  3CKJ A;  4HO4 A;  1R82 A;  4KNX A;  5C48 A;  5EJ1 A;  5CMG X;  1H4E A;  4LW3 A;  3I0J A;  1R7T A;  1H5S D;  1IIN A;  1H5R A;  1R80 A;  2A8W A;  2CU2 A;  3Q4S A;  4D0Z A;  4IRP A;  1JV3 A;  4R7P A;  1JVD A;  3E25 A;  1JV1 A;  1LZI A;  3GUE A;  3T7O A;  1TZF A;  1FXO A;  2RIZ A;  5FYE A;  2FYA A;  2YC3 A;  2AGD A;  1H5S A;  3IOJ A;  4HO5 A;  1INI A;  4Y63 A;  1WT3 A;  3DK5 A;  1ZI4 A;  3SXA A;  2BO6 A;  3USR A;  3OKR A;  2JCK A;  2W0V A;  2X5S A;  4CJ8 A;  1ZHJ A;  3I0C A;  1OMZ A;  2P6W A;  3IOH A;  4L41 C;  2Y4K A;  2XWN A;  3KIA A;  1ZCT A;  4EEA A;  1ZI1 A;  1ZCU A;  1LVW A;  3BCV A;  3U0Y A;  4FRP A;  2WEE A;  3U2W A;  2PGY A;  1HJL A;  2FYC B;  1ZJ3 A;  1FGX A;  5C3D A;  5C1H A;  1G2V A;  1ZJP A;  1KWS A;  1MP5 A;  5FUH A;  5C1L A;  5C4D A;  1GX4 A;  3T7N A;  1H7T A;  2Y4L A;  1FO9 A;  1H7Q A;  2VD4 A;  2AH9 A;  1PZT A;  4Y6U A;  3U2X A;  2QGI A;  2O1G A;  4HO6 A;  1VZX A;  2O1F A;  5CQO A;  5FU8 A;  2FFU A;  1QWJ A;  3OH4 A;  3SX3 A;  5CQL X;  2X65 A;  1H4C A;  2D7I A;  3HL3 A;  5CQM X;  1ZJ0 A;  4Y7T A;  2QH5 A;  5BXC A;  1S4N A;  1E5K A;  4NAL A;  2QKX A;  1WSZ A;  1VZT A;  2AM5 A;  2JCO A;  4G3S A;  4CVH A;  4HG6 A;  4B42 A;  1ZJO A;  1OQM B;  4FRE A;  2V0K A;  3Q80 A;  3I0K A;  4Y62 A;  3SXD A;  1W55 A;  3RMW A;  4DE7 A;  4DDZ A;  1G23 A;  4KPZ A;  2YQC A;  5AJP A;  4ECM A;  4EVW A;  5C8R A;  5C38 A;  1H3M A;  1G3L A;  4CJB A;  4FRO A;  1O23 B;  3PKQ A;  1MP3 A;  1WVC A;  5AJN A;  3SXE A;  4HCQ A;  4D48 A;  1QGS A;  2AEC A; 
#chains in the Genus database with same CATH topology
 5C47 A;  3U2U A;  4FRA A;  3I0G A;  3Q7U A;  1O0R A;  2FYB A;  4KNR A;  2YCM A;  2ICY A;  3ZF8 A;  3SX5 A;  1H5S B;  3PNN A;  1ZJ1 A;  2VS3 A;  4FQW A;  5C3B A;  3V8Y A;  4KC1 A;  1G0R A;  1LL3 A;  4EEM A;  1HV9 A;  2NXV A;  1FO8 A;  1H7F A;  1S4O A;  1V82 A;  2I7B A;  2JCJ A;  1QGQ A;  2VS5 A;  3JUJ A;  4FCU A;  1R81 A;  5CQP A;  1H7E A;  1HM9 A;  3R3I A;  3EE5 A;  4AYJ A;  1FGG A;  5C49 A;  4XWI A;  3OC9 A;  4YS8 A;  3V0M A;  5C4E A;  2ZU8 A;  1FRW A;  2PA4 A;  3PKP A;  1GWV A;  5L6S A;  3E26 A;  1FOA A;  1LZ7 A;  1WT2 A;  2ICX A;  2RJ6 A;  2VSI A;  5FU0 A;  4EE4 A;  4FCE A;  4KRV A;  3D5N A;  1PZY B;  1JYL A;  3IOI A;  2AM3 A;  3I0E A;  1HM0 A;  3OGZ A;  3FOQ A;  1FG5 N;  1TVY A;  1MC3 A;  1H7H A;  2VK9 A;  2JCL A;  1WT0 A;  2I5K A;  2Y4J A;  1S4P A;  1GQC A;  1HJJ A;  2X5Z A;  1H5T A;  3ZGG A;  1G97 A;  2V0L A;  5FV9 A;  3ZGF A;  3OAM A;  5CMF X;  4D11 C;  3NGW A;  4P02 A;  3V8Z A;  4ASY A;  3CKV A;  4Y6N A;  1ON8 A;  2Y7A A;  1SS9 A;  4AYL A;  1G8O A;  5CMJ A;  1Z90 A;  1VZU A;  4C2S A;  2AES A;  4P00 A;  4MND A;  1NKH B;  5C3A A;  1YP2 A;  2D0J A;  5I1F A;  4EE5 A;  2OEG A;  1G9R A;  3T7M A;  1R7U A;  2OI5 A;  3CKO A;  4ASJ A;  5D92 A;  5AJO A;  1VGZ A;  4NAK A;  2V0I A;  1VH3 A;  1GA8 A;  1HM8 A;  5EIY A;  3D98 A;  4UEG A;  3I0H A;  4KPX A;  2WAW A;  3POL A;  3V91 A;  1O7Q A;  4Y7F A;  1W77 A;  4FRH A;  1XHB A;  2J0A A;  4GBP A;  3TZT A;  4ARW A;  1NHE B;  1NWG B;  1EZI A;  2MZB A;  4D11 A;  3V0P A;  5D91 A;  4B4M A;  4AC3 A;  3CGX A;  4EEO A;  1EYR A;  2Z86 A;  1VPA A;  4JD0 A;  1V83 A;  4B4G A;  4HO3 A;  2YC5 A;  2YES A;  3DJ4 A;  1NF5 B;  4FRB A;  4KXO A;  2ZU7 A;  2BO7 A;  3DUV A;  1H5R B;  1VM8 A;  4J18 A;  1H4D A;  4M28 A;  2RJ0 A;  4EE3 A;  2WVL A;  5C4B A;  1QG8 A;  3CKN A;  1FR8 A;  4ZDQ A;  4G3Q A;  5IDT A;  1V84 A;  1H7L A;  2GGQ A;  1MP4 A;  2VS4 A;  4HO0 A;  4G87 A;  3I0I X;  1VGU A;  2Z87 A;  3N9W A;  5C36 A;  4FRD A;  3SXB A;  3I0L A;  4MIX A;  3ZLK A;  4IRQ A;  4G3P A;  2YQH A;  4HO8 A;  4E1K A;  2OI6 A;  4Y64 A;  5DDT A;  2OI7 A;  2XMH A;  2RIX A;  5CMH A;  3QVB A;  1H5S C;  2D7R A;  5FTS A;  3TQD A;  1VIC A;  1ZJ2 A;  2YQJ A;  4Y7V A;  3USQ A;  2WGZ A;  5JQQ A;  1R7X A;  3O3P A;  4EEG A;  5DDV A;  2AM4 A;  3RMV A;  4M2A A;  1TW5 A;  2ZU9 A;  1K4V A;  2RJ9 A;  1YRO B;  1ZI5 A;  2VFZ A;  1GQ9 A;  5J49 A;  5C4F A;  1YP3 A;  1ON6 A;  2J0B A;  4FRQ A;  3CKQ A;  3SX8 A;  4M2B A;  4B2X A;  2P73 A;  1NQI B;  2V0H A;  2Q4J A;  2RJ7 A;  4M4K A;  3LW6 A;  3JUK A;  2WVK A;  2YQS A;  3OH2 A;  2W0W A;  2BO4 A;  2APC A;  1R7Y A;  2A8U A;  2E8B A;  4KC2 A;  4B5B A;  1ZDG A;  2RJ5 A;  2BO8 A;  3V0L A;  2FYD B;  4FRL A;  1VGT A;  2WE9 A;  3V0N A;  3OH1 A;  1LZ0 A;  3D8V A;  4Y7U A;  3FWW A;  4Y7G A;  2RJ1 A;  5C4C A;  1ZI3 A;  4BMA A;  4MYB A;  5CMI A;  4O6M A;  4LW6 A;  4KT7 A;  4KC4 A;  3K8D A;  3ZLL A;  2PX7 A;  3JTJ A;  1INJ A;  4Y9X A;  1GWW A;  2C0N A;  4BQH A;  1OMX A;  1LL2 A;  4B3U A;  2XWL A;  4DEC A;  3V90 A;  3RSB A;  5IFY A;  3SX7 A;  5EJZ A;  5FTV A;  4FRM A;  2RIY A;  2RJ4 A;  3U0X A;  3SXG A;  1IIM A;  1H7G A;  1LL0 A;  4NAI A;  2VXM A;  5IDS A;  2OEF A;  2RJ8 A;  1G95 A;  4CJC A;  2Y4M A;  2AE7 A;  1LZJ A;  3I0D A;  4NAN A;  2O1H A;  4HOC A;  4JIS A;  1ZCV A;  1ZDF A;  4AAW A;  2UX8 A;  2VSH A;  3V0O A;  1FZW A;  2Y6P A;  2FY7 A;  2I5E A;  3F1Y A;  1XZ6 A;  1ZCY A;  2X60 A;  4HO9 A;  3U2V A;  1W57 A;  2PGV A;  2GGO A;  2XWM A;  3ST8 A;  3K8E A;  1WT1 A;  1VH1 A;  3V0Q A;  4K6R A;  1FWY A;  5L6V A;  2P72 A;  3CU0 A;  1G93 A;  3I0F A;  1GX0 A;  1TW1 A;  3F1C A;  2WVM A;  1I52 A;  3OH0 A;  3R2W A;  3SPT A;  1NMM B;  4HO2 A;  3BRK X;  4D0T A;  1VGW A;  2RIT A;  2V0J A;  5HS2 A;  1JYK A;  5C1G A;  4B4B A;  2VXL A;  1JVG A;  3U2T A;  3SXC A;  1G1L A;  1FR9 A;  1FXJ A;  2E3D A;  2DPW A;  1R7V A;  1O7O A;  1H5T B;  4B2W A;  2FFV A;  4KQL A;  3OH3 A;  2XME A;  5CQN X;  1YP4 A;  1ZIZ A;  3CKJ A;  4HO4 A;  1R82 A;  4KNX A;  5C48 A;  5EJ1 A;  5CMG X;  1H4E A;  4LW3 A;  4Q7C A;  3I0J A;  1R7T A;  1H5S D;  1IIN A;  1H5R A;  1R80 A;  2A8W A;  2CU2 A;  3Q4S A;  4D0Z A;  4IRP A;  1JV3 A;  4R7P A;  1JVD A;  3E25 A;  1JV1 A;  1LZI A;  3GUE A;  3T7O A;  1TZF A;  1FXO A;  2RIZ A;  5FYE A;  2FYA A;  2YC3 A;  2AGD A;  1H5S A;  3IOJ A;  4HO5 A;  1INI A;  4Y63 A;  1WT3 A;  3DK5 A;  1ZI4 A;  3SXA A;  2BO6 A;  3USR A;  3OKR A;  2JCK A;  2W0V A;  2X5S A;  4CJ8 A;  1ZHJ A;  3I0C A;  1OMZ A;  2P6W A;  3IOH A;  4L41 C;  2Y4K A;  2XWN A;  3KIA A;  1ZCT A;  4EEA A;  1ZI1 A;  1ZCU A;  1LVW A;  3BCV A;  3U0Y A;  4FRP A;  2WEE A;  3U2W A;  2PGY A;  1HJL A;  2FYC B;  1ZJ3 A;  1FGX A;  5C3D A;  5C1H A;  1G2V A;  1ZJP A;  1KWS A;  1MP5 A;  5FUH A;  5C1L A;  5C4D A;  1GX4 A;  3T7N A;  1H7T A;  2Y4L A;  1FO9 A;  1H7Q A;  2VD4 A;  2AH9 A;  1PZT A;  4Y6U A;  3U2X A;  2QGI A;  2O1G A;  4HO6 A;  1VZX A;  2O1F A;  5CQO A;  5FU8 A;  2FFU A;  1QWJ A;  3OH4 A;  3SX3 A;  5CQL X;  2X65 A;  1H4C A;  2D7I A;  3HL3 A;  5CQM X;  1ZJ0 A;  4Y7T A;  2QH5 A;  5BXC A;  1S4N A;  1E5K A;  4NAL A;  2QKX A;  1WSZ A;  1VZT A;  2AM5 A;  2JCO A;  4G3S A;  4CVH A;  4HG6 A;  4B42 A;  1ZJO A;  1OQM B;  4FRE A;  2V0K A;  3Q80 A;  3I0K A;  4Y62 A;  3SXD A;  1W55 A;  3RMW A;  4DE7 A;  4DDZ A;  1G23 A;  4KPZ A;  2YQC A;  5AJP A;  4ECM A;  4EVW A;  5C8R A;  5C38 A;  1H3M A;  1G3L A;  4FIY A;  4CJB A;  4FRO A;  1O23 B;  3PKQ A;  4O6N A;  1MP3 A;  1WVC A;  4FIX A;  5AJN A;  3SXE A;  4HCQ A;  4D48 A;  1QGS A;  2AEC A; 
#chains in the Genus database with same CATH homology
 5C47 A;  3U2U A;  4FRA A;  3I0G A;  3Q7U A;  1O0R A;  2FYB A;  4KNR A;  2YCM A;  2ICY A;  3ZF8 A;  3SX5 A;  1H5S B;  3PNN A;  1ZJ1 A;  2VS3 A;  4FQW A;  5C3B A;  3V8Y A;  4KC1 A;  1G0R A;  1LL3 A;  4EEM A;  1HV9 A;  2NXV A;  1FO8 A;  1H7F A;  1S4O A;  1V82 A;  2I7B A;  2JCJ A;  1QGQ A;  2VS5 A;  3JUJ A;  4FCU A;  1R81 A;  5CQP A;  1H7E A;  1HM9 A;  3R3I A;  3EE5 A;  4AYJ A;  1FGG A;  5C49 A;  4XWI A;  3OC9 A;  4YS8 A;  3V0M A;  5C4E A;  2ZU8 A;  1FRW A;  2PA4 A;  3PKP A;  1GWV A;  5L6S A;  3E26 A;  1FOA A;  1LZ7 A;  1WT2 A;  2ICX A;  2RJ6 A;  2VSI A;  5FU0 A;  4EE4 A;  4FCE A;  4KRV A;  3D5N A;  1PZY B;  1JYL A;  3IOI A;  2AM3 A;  3I0E A;  1HM0 A;  3OGZ A;  3FOQ A;  1FG5 N;  1TVY A;  1MC3 A;  1H7H A;  2VK9 A;  2JCL A;  1WT0 A;  2I5K A;  2Y4J A;  1S4P A;  1GQC A;  1HJJ A;  2X5Z A;  1H5T A;  3ZGG A;  1G97 A;  2V0L A;  5FV9 A;  3ZGF A;  3OAM A;  5CMF X;  4D11 C;  3NGW A;  4P02 A;  3V8Z A;  4ASY A;  3CKV A;  4Y6N A;  1ON8 A;  2Y7A A;  1SS9 A;  4AYL A;  1G8O A;  5CMJ A;  1Z90 A;  1VZU A;  4C2S A;  2AES A;  4P00 A;  4MND A;  1NKH B;  5C3A A;  1YP2 A;  2D0J A;  5I1F A;  4EE5 A;  2OEG A;  1G9R A;  3T7M A;  1R7U A;  2OI5 A;  3CKO A;  4ASJ A;  5D92 A;  5AJO A;  1VGZ A;  4NAK A;  2V0I A;  1VH3 A;  1GA8 A;  1HM8 A;  5EIY A;  3D98 A;  4UEG A;  3I0H A;  4KPX A;  2WAW A;  3POL A;  3V91 A;  1O7Q A;  4Y7F A;  1W77 A;  4FRH A;  1XHB A;  2J0A A;  4GBP A;  3TZT A;  4ARW A;  1NHE B;  1NWG B;  1EZI A;  2MZB A;  4D11 A;  3V0P A;  5D91 A;  4B4M A;  4AC3 A;  3CGX A;  4EEO A;  1EYR A;  2Z86 A;  1VPA A;  4JD0 A;  1V83 A;  4B4G A;  4HO3 A;  2YC5 A;  2YES A;  3DJ4 A;  1NF5 B;  4FRB A;  4KXO A;  2ZU7 A;  2BO7 A;  3DUV A;  1H5R B;  1VM8 A;  4J18 A;  1H4D A;  4M28 A;  2RJ0 A;  4EE3 A;  2WVL A;  5C4B A;  1QG8 A;  3CKN A;  1FR8 A;  4ZDQ A;  4G3Q A;  5IDT A;  1V84 A;  1H7L A;  2GGQ A;  1MP4 A;  2VS4 A;  4HO0 A;  4G87 A;  3I0I X;  1VGU A;  2Z87 A;  3N9W A;  5C36 A;  4FRD A;  3SXB A;  3I0L A;  4MIX A;  3ZLK A;  4IRQ A;  4G3P A;  2YQH A;  4HO8 A;  4E1K A;  2OI6 A;  4Y64 A;  5DDT A;  2OI7 A;  2XMH A;  2RIX A;  5CMH A;  3QVB A;  1H5S C;  2D7R A;  5FTS A;  3TQD A;  1VIC A;  1ZJ2 A;  2YQJ A;  4Y7V A;  3USQ A;  2WGZ A;  5JQQ A;  1R7X A;  3O3P A;  4EEG A;  5DDV A;  2AM4 A;  3RMV A;  4M2A A;  1TW5 A;  2ZU9 A;  1K4V A;  2RJ9 A;  1YRO B;  1ZI5 A;  2VFZ A;  1GQ9 A;  5J49 A;  5C4F A;  1YP3 A;  1ON6 A;  2J0B A;  4FRQ A;  3CKQ A;  3SX8 A;  4M2B A;  4B2X A;  2P73 A;  1NQI B;  2V0H A;  2Q4J A;  2RJ7 A;  4M4K A;  3LW6 A;  3JUK A;  2WVK A;  2YQS A;  3OH2 A;  2W0W A;  2BO4 A;  2APC A;  1R7Y A;  2A8U A;  2E8B A;  4KC2 A;  4B5B A;  1ZDG A;  2RJ5 A;  2BO8 A;  3V0L A;  2FYD B;  4FRL A;  1VGT A;  2WE9 A;  3V0N A;  3OH1 A;  1LZ0 A;  3D8V A;  4Y7U A;  3FWW A;  4Y7G A;  2RJ1 A;  5C4C A;  1ZI3 A;  4BMA A;  4MYB A;  5CMI A;  4O6M A;  4LW6 A;  4KT7 A;  4KC4 A;  3K8D A;  3ZLL A;  2PX7 A;  3JTJ A;  1INJ A;  4Y9X A;  1GWW A;  2C0N A;  4BQH A;  1OMX A;  1LL2 A;  4B3U A;  2XWL A;  4DEC A;  3V90 A;  3RSB A;  5IFY A;  3SX7 A;  5EJZ A;  5FTV A;  4FRM A;  2RIY A;  2RJ4 A;  3U0X A;  3SXG A;  1IIM A;  1H7G A;  1LL0 A;  4NAI A;  2VXM A;  5IDS A;  2OEF A;  2RJ8 A;  1G95 A;  4CJC A;  2Y4M A;  2AE7 A;  1LZJ A;  3I0D A;  4NAN A;  2O1H A;  4HOC A;  4JIS A;  1ZCV A;  1ZDF A;  4AAW A;  2UX8 A;  2VSH A;  3V0O A;  1FZW A;  2Y6P A;  2FY7 A;  2I5E A;  3F1Y A;  1XZ6 A;  1ZCY A;  2X60 A;  4HO9 A;  3U2V A;  1W57 A;  2PGV A;  2GGO A;  2XWM A;  3ST8 A;  3K8E A;  1WT1 A;  1VH1 A;  3V0Q A;  4K6R A;  1FWY A;  5L6V A;  2P72 A;  3CU0 A;  1G93 A;  3I0F A;  1GX0 A;  1TW1 A;  3F1C A;  2WVM A;  1I52 A;  3OH0 A;  3R2W A;  3SPT A;  1NMM B;  4HO2 A;  3BRK X;  4D0T A;  1VGW A;  2RIT A;  2V0J A;  5HS2 A;  1JYK A;  5C1G A;  4B4B A;  2VXL A;  1JVG A;  3U2T A;  3SXC A;  1G1L A;  1FR9 A;  1FXJ A;  2E3D A;  2DPW A;  1R7V A;  1O7O A;  1H5T B;  4B2W A;  2FFV A;  4KQL A;  3OH3 A;  2XME A;  5CQN X;  1YP4 A;  1ZIZ A;  3CKJ A;  4HO4 A;  1R82 A;  4KNX A;  5C48 A;  5EJ1 A;  5CMG X;  1H4E A;  4LW3 A;  4Q7C A;  3I0J A;  1R7T A;  1H5S D;  1IIN A;  1H5R A;  1R80 A;  2A8W A;  2CU2 A;  3Q4S A;  4D0Z A;  4IRP A;  1JV3 A;  4R7P A;  1JVD A;  3E25 A;  1JV1 A;  1LZI A;  3GUE A;  3T7O A;  1TZF A;  1FXO A;  2RIZ A;  5FYE A;  2FYA A;  2YC3 A;  2AGD A;  1H5S A;  3IOJ A;  4HO5 A;  1INI A;  4Y63 A;  1WT3 A;  3DK5 A;  1ZI4 A;  3SXA A;  2BO6 A;  3USR A;  3OKR A;  2JCK A;  2W0V A;  2X5S A;  4CJ8 A;  1ZHJ A;  3I0C A;  1OMZ A;  2P6W A;  3IOH A;  4L41 C;  2Y4K A;  2XWN A;  3KIA A;  1ZCT A;  4EEA A;  1ZI1 A;  1ZCU A;  1LVW A;  3BCV A;  3U0Y A;  4FRP A;  2WEE A;  3U2W A;  2PGY A;  1HJL A;  2FYC B;  1ZJ3 A;  1FGX A;  5C3D A;  5C1H A;  1G2V A;  1ZJP A;  1KWS A;  1MP5 A;  5FUH A;  5C1L A;  5C4D A;  1GX4 A;  3T7N A;  1H7T A;  2Y4L A;  1FO9 A;  1H7Q A;  2VD4 A;  2AH9 A;  1PZT A;  4Y6U A;  3U2X A;  2QGI A;  2O1G A;  4HO6 A;  1VZX A;  2O1F A;  5CQO A;  5FU8 A;  2FFU A;  1QWJ A;  3OH4 A;  3SX3 A;  5CQL X;  2X65 A;  1H4C A;  2D7I A;  3HL3 A;  5CQM X;  1ZJ0 A;  4Y7T A;  2QH5 A;  5BXC A;  1S4N A;  1E5K A;  4NAL A;  2QKX A;  1WSZ A;  1VZT A;  2AM5 A;  2JCO A;  4G3S A;  4CVH A;  4HG6 A;  4B42 A;  1ZJO A;  1OQM B;  4FRE A;  2V0K A;  3Q80 A;  3I0K A;  4Y62 A;  3SXD A;  1W55 A;  3RMW A;  4DE7 A;  4DDZ A;  1G23 A;  4KPZ A;  2YQC A;  5AJP A;  4ECM A;  4EVW A;  5C8R A;  5C38 A;  1H3M A;  1G3L A;  4FIY A;  4CJB A;  4FRO A;  1O23 B;  3PKQ A;  4O6N A;  1MP3 A;  1WVC A;  4FIX A;  5AJN A;  3SXE A;  4HCQ A;  4D48 A;  1QGS A;  2AEC A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...