1R7VA

Glycosyltransferase a in complex with 3-amino-acceptor analog inhibitor
Total Genus 80
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
80
sequence length
283
structure length
263
Chain Sequence
MVSLPRMVYPQPKVLTPCRKDVLVVTPWLAPIVWEGTFNIDILNEQFRLQNTTIGLTVFAIKKYVAFLKLFLETAEKHFMVGHRVHYYVFTDQPAAVPRVTLGTGRQLSVLEVCERRFLSEVDYLVCVDVDMEFRDHVGVEILTPLFGTLHPGFYGSSREAFTYERRPQSQAYIPKDEGDFYYLGGFFGGSVQEVQRLTRACHQAMMVDQANGIEAVWHDESHLNKYLLRHKPTKVLSPEYLWDQQLLGWPAVLRKLRFTAVP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords Glycoprotein-fucosylgalactoside alpha-N-acetylgalactosaminyl
publication title The influence of an intramolecular hydrogen bond in differential recognition of inhibitory acceptor analogs by human ABO(H) blood group A and B glycosyltransferases
pubmed doi rcsb
source organism Homo sapiens
total genus 80
structure length 263
sequence length 283
ec nomenclature ec 2.4.1.37: Fucosylgalactoside 3-alpha-galactosyltransferase.
pdb deposition date 2003-10-22
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.550.10 Alpha Beta Alpha-Beta Complex Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A 1r7vA00
3F1YA 1ZCUA 1FWYA 3RSBA 4IRQA 3IOHA 4ASJA 1H4CA 1GA8A 1ZJOA 1NMMB 4NANA 2RJ9A 1VZTA 5FTSA 2FYBA 2XWMA 3I0LA 4EVWA 1W55A 3SX7A 2ZU9A 4L41C 2VS3A 1MP3A 4DE7A 1G2VA 2O1GA 5CMGX 2ICXA 4Y7UA 1LZIA 4AC3A 1H5RA 4R7PA 3U2XA 3OGZA 1LZ0A 3V0LA 3IOJA 1V82A 4KRVA 2OI7A 2AE7A 4KNXA 1FR8A 2YQHA 2QGIA 1G9RA 2AM4A 3QVBA 4MNDA 4ARWA 2V0IA 3V8YA 1QGSA 3I0IX 2Y4JA 5AJPA 3D5NA 1GQCA 3RMWA 1O0RA 2Z87A 1SS9A 3V90A 2DPWA 1H5SD 2JCOA 4DDZA 3DUVA 2RJ1A 3Q4SA 3R3IA 1KWSA 4Y7VA 5C8RA 3I0GA 2BO8A 3DK5A 2VS4A 2O1HA 5IDSA 2VSHA 1ZJ3A 2YCMA 1VH3A 4J18A 3ZLLA 1XHBA 4B2WA 4XWIA 2X5ZA 5C36A 4Y7TA 4FRBA 4BMAA 3K8EA 4HOCA 1ZI3A 2E8BA 4G3SA 3OH3A 3V0OA 4CVHA 5IFYA 2BO7A 3V0NA 4KPXA 1NF5B 2BO4A 1H5TB 4FQWA 4KC2A 5I1FA 1R7YA 3DJ4A 4D0ZA 2YQSA 4YS8A 4B5BA 2Y4KA 1MP5A 1OMXA 4G3PA 3FWWA 1JYKA 5AJOA 1HJJA 1MP4A 3D8VA 3U0XA 1FG5N 1H5SA 4D11A 3I0HA 1QG8A 2V0JA 2YC5A 2RJ0A 5FU8A 2VSIA 4Y6UA 1VPAA 3KIAA 3OH1A 3T7NA 1H5SB 3Q80A 1FZWA 2I7BA 4CJBA 5CQOA 4D48A 3SXAA 2I5EA 4EEGA 2Y4LA 4UEGA 5CMFX 2OI6A 2VD4A 1S4NA 1ZCVA 1R7TA 2AGDA 1K4VA 5CQMX 3IOIA 2WVKA 2CU2A 2X65A 5C3AA 3D98A 5CQNX 4KXOA 1VH1A 1EYRA 5C4EA 1LL0A 1O7QA 5AJNA 2FYDB 4Y7GA 4EE3A 3CU0A 2V0LA 1TZFA 1G1LA 1ZJ2A 1V84A 1INJA 4FRHA 2JCKA 3SXCA 1MC3A 4ECMA 2AH9A 5FU0A 3SX8A 4E1KA 3NGWA 1WT3A 4KQLA 2WVMA 1PZYB 4HO2A 2WGZA 1HM0A 5EIYA 1TW1A 2RJ4A 3I0CA 4NALA 3EE5A 2RITA 4ZDQA 2RJ8A 3U2WA 2P72A 1H3MA 2WEEA 2XWNA 2D0JA 3PNNA 3TQDA 2NXVA 4FREA 1VZUA 2ICYA 4KNRA 2AM3A 4B3UA 3U2VA 3I0KA 2D7RA 4EE5A 4Y62A 4C2SA 4M4KA 3V0MA 4B2XA 2AM5A 1VGUA 4AYJA 4M28A 1ZCYA 4HG6A 5C47A 1H5SC 3JTJA 4D11C 1YP2A 3USQA 1VGTA 4HO4A 3N9WA 4D0TA 1H4DA 3JUKA 5J49A 2OEFA 3CKOA 5C3BA 1IIMA 1LZJA 2P6WA 2XWLA 1H5TA 1S4OA 2W0VA 4HO5A 3USRA 3LW6A 1JV1A 5C4CA 2X5SA 1OQMB 2XMEA 1WT2A 4Y6NA 5EJZA 1LL3A 5IDTA 1QWJA 5CMIA 1G3LA 4EEAA 1VGWA 1ZDFA 1H7TA 2RJ6A 1TW5A 2ZU7A 2I5KA 1H7HA 1WT1A 3U2UA 2GGOA 3E26A 1R80A 4B4GA 1GX4A 4IRPA 1ON6A 3SXEA 2RIZA 2PGVA 4FRAA 3ZF8A 5C49A 1G95A 2VXLA 3I0DA 1YP3A 1VGZA 2PX7A 3OC9A 5FV9A 3ZLKA 4JD0A 3V0QA 1ZHJA 4FRQA 1H7GA 4KT7A 5CQPA 1JYLA 1R7UA 3ST8A 3Q7UA 4P02A 1R7XA 1FGGA 1S4PA 2W0WA 1ZI5A 5C4DA 2FYAA 5DDVA 3I0FA 1HV9A 5HS2A 1ZCTA 1FRWA 2A8UA 2E3DA 3CKJA 3HL3A 4FROA 2D7IA 4Y64A 4FRPA 4HO6A 5C1GA 5C48A 4M2BA 3SXGA 5C38A 1H7EA 2QKXA 5CQLX 1VZXA 5JQQA 2Y7AA 4CJCA 1ZIZA 2WVLA 2FFVA 2AESA 5CMHA 1LL2A 4MYBA 5FYEA 1WT0A 2PGYA 1JVGA 2VXMA 4BQHA 1R81A 2A8WA 2XMHA 3OH0A 2Y6PA 5EJ1A 1VM8A 5L6SA 1WSZA 2GGQA 2OEGA 2RJ7A 1LZ7A 4HO3A 4M2AA 3ZGGA 1R7VA 4G87A 3SPTA 2V0KA 5C3DA 3JUJA 2FYCB 3CKVA 1LVWA 4HCQA 5BXCA 4B42A 1G23A 2JCJA 5L6VA 2APCA 2RIYA 4KPZA 4FRMA 1O7OA 3K8DA 2PA4A 2WAWA 2V0HA 1FGXA 1H7QA 4FRLA 4JISA 4LW3A 2RIXA 1FXJA 1ZJ0A 2Y4MA 1EZIA 1TVYA 2X60A 3OAMA 1H7FA 1R82A 1W57A 1H7LA 3FOQA 2RJ5A 4EEOA 4DECA 1G93A 1G97A 4HO8A 4EE4A 2YQJA 4CJ8A 3R2WA 5FTVA 1HM9A 3SXBA 4Y63A 2JCLA 5C4FA 3SX3A 1NHEB 3U0YA 1JV3A 1VICA 1H5RB 3E25A 4B4MA 1HJLA 3F1CA 4FCUA 2YQCA 2MZBA 1Z90A 3I0JA 2VS5A 5C1HA 4NAKA 1WVCA 1FR9A 4ASYA 1NWGB 1ZI4A 1GX0A 3BRKX 3T7OA 1QGQA 1INIA 3PKPA 3OH4A 1E5KA 2VFZA 1GQ9A 1IINA 1ZJ1A 5CMJA 5C4BA 3PKQA 1XZ6A 3V91A 3CGXA 1G0RA 1FXOA 3V0PA 1FO9A 3SX5A 3CKNA 2UX8A 2Z86A 4HO0A 1FOAA 2YESA 2FY7A 1I52A 4AAWA 2BO6A 1YROB 4HO9A 1ZJPA 1ZDGA 4G3QA 3CKQA 3BCVA 4KC4A 3ZGFA 1YP4A 5FUHA 5DDTA 1ZI1A 4LW6A 2FFUA 2YC3A 4AYLA 3TZTA 1FO8A 1NKHB 3OKRA 4GBPA 4K6RA 1ON8A 3I0EA 2ZU8A 4KC1A 3V8ZA 1NQIB 2P73A 4P00A 2QH5A 4Y7FA 4NAIA 3O3PA 3GUEA 4FRDA 1JVDA 3T7MA 4B4BA 1O23B 5C1LA 3U2TA 3SXDA 2Q4JA 1V83A 2WE9A 1H4EA 1OMZA 4EEMA 3POLA 1G8OA 2O1FA 1W77A 3OH2A 2OI5A 4FCEA 2AECA 1GWVA 1PZTA 3RMVA 1GWWA 1HM8A 4Y9XA
chains in the Genus database with same CATH superfamily
3F1YA 1ZCUA 1FWYA 3RSBA 4IRQA 3IOHA 4ASJA 1H4CA 1GA8A 1ZJOA 1NMMB 4NANA 2RJ9A 1VZTA 5FTSA 2FYBA 2XWMA 3I0LA 4EVWA 1W55A 3SX7A 2ZU9A 4L41C 2VS3A 1MP3A 4DE7A 1G2VA 2O1GA 5CMGX 2ICXA 4Y7UA 1LZIA 4AC3A 1H5RA 4R7PA 3U2XA 3OGZA 1LZ0A 3V0LA 3IOJA 1V82A 4KRVA 2OI7A 2AE7A 4KNXA 1FR8A 2YQHA 2QGIA 1G9RA 2AM4A 3QVBA 4MNDA 4ARWA 2V0IA 3V8YA 1QGSA 3I0IX 2Y4JA 5AJPA 3D5NA 1GQCA 3RMWA 1O0RA 2Z87A 1SS9A 3V90A 2DPWA 1H5SD 2JCOA 4DDZA 3DUVA 2RJ1A 3Q4SA 3R3IA 1KWSA 4Y7VA 5C8RA 3I0GA 2BO8A 3DK5A 2VS4A 2O1HA 5IDSA 2VSHA 1ZJ3A 2YCMA 1VH3A 4J18A 3ZLLA 1XHBA 4B2WA 4XWIA 2X5ZA 5C36A 4Y7TA 4FRBA 4BMAA 3K8EA 4HOCA 1ZI3A 2E8BA 4G3SA 4O6NA 3OH3A 3V0OA 4CVHA 5IFYA 2BO7A 3V0NA 4KPXA 1NF5B 2BO4A 1H5TB 4FQWA 4KC2A 5I1FA 1R7YA 3DJ4A 4D0ZA 2YQSA 4YS8A 4B5BA 2Y4KA 1MP5A 1OMXA 4G3PA 3FWWA 1JYKA 5AJOA 1HJJA 1MP4A 3D8VA 3U0XA 1FG5N 4O6MA 1H5SA 4D11A 3I0HA 1QG8A 2V0JA 2YC5A 2RJ0A 5FU8A 2VSIA 4Y6UA 1VPAA 3KIAA 3OH1A 3T7NA 1H5SB 3Q80A 1FZWA 2I7BA 4CJBA 5CQOA 4D48A 3SXAA 2I5EA 4EEGA 2Y4LA 4UEGA 5CMFX 2OI6A 5D92A 2VD4A 1S4NA 1ZCVA 1R7TA 2AGDA 1K4VA 5CQMX 3IOIA 2WVKA 2CU2A 2X65A 5C3AA 3D98A 5CQNX 4KXOA 1VH1A 1EYRA 5C4EA 1LL0A 1O7QA 5AJNA 2FYDB 4Y7GA 4EE3A 3CU0A 2V0LA 1TZFA 1G1LA 1ZJ2A 1V84A 1INJA 4FRHA 2JCKA 3SXCA 1MC3A 4ECMA 2AH9A 5FU0A 3SX8A 4E1KA 3NGWA 1WT3A 4KQLA 2WVMA 1PZYB 4HO2A 2WGZA 1HM0A 5EIYA 1TW1A 2RJ4A 3I0CA 4NALA 3EE5A 2RITA 4ZDQA 2RJ8A 3U2WA 2P72A 1H3MA 2WEEA 2XWNA 2D0JA 3PNNA 3TQDA 2NXVA 4FREA 1VZUA 2ICYA 4KNRA 2AM3A 4B3UA 3U2VA 3I0KA 2D7RA 4EE5A 4Y62A 4C2SA 4M4KA 3V0MA 4B2XA 2AM5A 1VGUA 4AYJA 4M28A 1ZCYA 4HG6A 5C47A 1H5SC 3JTJA 4D11C 1YP2A 3USQA 1VGTA 4HO4A 3N9WA 4D0TA 1H4DA 3JUKA 5J49A 2OEFA 3CKOA 5C3BA 1IIMA 1LZJA 2P6WA 2XWLA 1H5TA 1S4OA 2W0VA 4HO5A 3USRA 3LW6A 1JV1A 5C4CA 2X5SA 1OQMB 2XMEA 1WT2A 4Y6NA 5EJZA 1LL3A 5IDTA 1QWJA 5CMIA 1G3LA 4EEAA 1VGWA 1ZDFA 1H7TA 2RJ6A 1TW5A 2ZU7A 2I5KA 1H7HA 1WT1A 3U2UA 2GGOA 3E26A 1R80A 4B4GA 1GX4A 4IRPA 1ON6A 3SXEA 2RIZA 2PGVA 4FRAA 3ZF8A 5C49A 1G95A 2VXLA 3I0DA 1YP3A 1VGZA 2PX7A 3OC9A 5FV9A 3ZLKA 4JD0A 3V0QA 1ZHJA 4FRQA 1H7GA 4KT7A 5CQPA 1JYLA 1R7UA 3ST8A 3Q7UA 4P02A 1R7XA 1FGGA 1S4PA 2W0WA 1ZI5A 5C4DA 2FYAA 5DDVA 3I0FA 1HV9A 5HS2A 1ZCTA 1FRWA 2A8UA 2E3DA 3CKJA 3HL3A 4FROA 2D7IA 4Y64A 4FRPA 4HO6A 5C1GA 5C48A 4M2BA 4MIXA 3SXGA 5C38A 1H7EA 2QKXA 5CQLX 1VZXA 5JQQA 2Y7AA 4CJCA 1ZIZA 2WVLA 2FFVA 2AESA 5CMHA 1LL2A 4MYBA 5FYEA 1WT0A 2PGYA 1JVGA 2VXMA 4BQHA 1R81A 2A8WA 2XMHA 3OH0A 2Y6PA 5EJ1A 1VM8A 5L6SA 1WSZA 2GGQA 2OEGA 2RJ7A 1LZ7A 4HO3A 4M2AA 3ZGGA 1R7VA 4G87A 3SPTA 2V0KA 5C3DA 3JUJA 2FYCB 3CKVA 1LVWA 4HCQA 5BXCA 4B42A 1G23A 2JCJA 4FIXA 5L6VA 2APCA 2RIYA 4KPZA 4FRMA 1O7OA 3K8DA 2PA4A 2WAWA 5D91A 2V0HA 1FGXA 1H7QA 4FRLA 4JISA 4LW3A 2RIXA 1FXJA 1ZJ0A 2Y4MA 1EZIA 1TVYA 2X60A 3OAMA 1H7FA 1R82A 1W57A 1H7LA 3FOQA 2RJ5A 4EEOA 4DECA 1G93A 1G97A 4HO8A 4EE4A 2YQJA 4CJ8A 3R2WA 5FTVA 1HM9A 3SXBA 4Y63A 2JCLA 5C4FA 3SX3A 1NHEB 3U0YA 1JV3A 1VICA 1H5RB 3E25A 4B4MA 1HJLA 3F1CA 4FCUA 4FIYA 2YQCA 2MZBA 1Z90A 3I0JA 2VS5A 5C1HA 4NAKA 1WVCA 1FR9A 4ASYA 1NWGB 1ZI4A 1GX0A 3BRKX 3T7OA 1QGQA 1INIA 3PKPA 3OH4A 1E5KA 2VFZA 1GQ9A 1IINA 1ZJ1A 5CMJA 5C4BA 3PKQA 1XZ6A 3V91A 2C0NA 3CGXA 1G0RA 1FXOA 3V0PA 1FO9A 3SX5A 2J0AA 3CKNA 2UX8A 2Z86A 4HO0A 1FOAA 2YESA 2FY7A 1I52A 4AAWA 2BO6A 1YROB 2J0BA 1ZJPA 4HO9A 1ZDGA 4G3QA 3CKQA 3BCVA 4KC4A 3ZGFA 2VK9A 4Q7CA 1YP4A 5FUHA 5DDTA 1ZI1A 4LW6A 2FFUA 2YC3A 4AYLA 3TZTA 1FO8A 1NKHB 3OKRA 4GBPA 4K6RA 1ON8A 3I0EA 2ZU8A 4KC1A 3V8ZA 1NQIB 2P73A 4P00A 2QH5A 4Y7FA 4NAIA 3O3PA 3GUEA 4FRDA 1JVDA 3T7MA 4B4BA 1O23B 5C1LA 3U2TA 3SXDA 2Q4JA 1V83A 2WE9A 1H4EA 1OMZA 4EEMA 3POLA 1G8OA 2O1FA 1W77A 3OH2A 2OI5A 4FCEA 2AECA 1GWVA 1PZTA 3RMVA 1GWWA 1HM8A 4Y9XA
chains in the Genus database with same CATH topology
3F1YA 1ZCUA 1FWYA 3RSBA 4IRQA 3IOHA 4ASJA 1H4CA 1GA8A 1ZJOA 1NMMB 4NANA 2RJ9A 1VZTA 5FTSA 2FYBA 2XWMA 3I0LA 4EVWA 1W55A 3SX7A 2ZU9A 4L41C 2VS3A 1MP3A 4DE7A 1G2VA 2O1GA 5CMGX 2ICXA 4Y7UA 1LZIA 4AC3A 1H5RA 4R7PA 3U2XA 3OGZA 1LZ0A 3V0LA 3IOJA 1V82A 4KRVA 2OI7A 2AE7A 4KNXA 1FR8A 2YQHA 2QGIA 1G9RA 2AM4A 3QVBA 4MNDA 4ARWA 2V0IA 3V8YA 1QGSA 3I0IX 2Y4JA 5AJPA 3D5NA 1GQCA 3RMWA 1O0RA 2Z87A 1SS9A 3V90A 2DPWA 1H5SD 2JCOA 4DDZA 3DUVA 2RJ1A 3Q4SA 3R3IA 1KWSA 4Y7VA 5C8RA 3I0GA 2BO8A 3DK5A 2VS4A 2O1HA 5IDSA 2VSHA 1ZJ3A 2YCMA 1VH3A 4J18A 3ZLLA 1XHBA 4B2WA 4XWIA 2X5ZA 5C36A 4Y7TA 4FRBA 4BMAA 3K8EA 4HOCA 1ZI3A 2E8BA 4G3SA 4O6NA 3OH3A 3V0OA 4CVHA 5IFYA 2BO7A 3V0NA 4KPXA 1NF5B 2BO4A 1H5TB 4FQWA 4KC2A 5I1FA 1R7YA 3DJ4A 4D0ZA 2YQSA 4YS8A 4B5BA 2Y4KA 1MP5A 1OMXA 4G3PA 3FWWA 1JYKA 5AJOA 1HJJA 1MP4A 3D8VA 3U0XA 1FG5N 4O6MA 1H5SA 4D11A 3I0HA 1QG8A 2V0JA 2YC5A 2RJ0A 5FU8A 2VSIA 4Y6UA 1VPAA 3KIAA 3OH1A 3T7NA 1H5SB 3Q80A 1FZWA 2I7BA 4CJBA 5CQOA 4D48A 3SXAA 2I5EA 4EEGA 2Y4LA 4UEGA 5CMFX 2OI6A 5D92A 2VD4A 1S4NA 1ZCVA 1R7TA 2AGDA 1K4VA 5CQMX 3IOIA 2WVKA 2CU2A 2X65A 5C3AA 3D98A 5CQNX 4KXOA 1VH1A 1EYRA 5C4EA 1LL0A 1O7QA 5AJNA 2FYDB 4Y7GA 4EE3A 3CU0A 2V0LA 1TZFA 1G1LA 1ZJ2A 1V84A 1INJA 4FRHA 2JCKA 3SXCA 1MC3A 4ECMA 2AH9A 5FU0A 3SX8A 4E1KA 3NGWA 1WT3A 4KQLA 2WVMA 1PZYB 4HO2A 2WGZA 1HM0A 5EIYA 1TW1A 2RJ4A 3I0CA 4NALA 3EE5A 2RITA 4ZDQA 2RJ8A 3U2WA 2P72A 1H3MA 2WEEA 2XWNA 2D0JA 3PNNA 3TQDA 2NXVA 4FREA 1VZUA 2ICYA 4KNRA 2AM3A 4B3UA 3U2VA 3I0KA 2D7RA 4EE5A 4Y62A 4C2SA 4M4KA 3V0MA 4B2XA 2AM5A 1VGUA 4AYJA 4M28A 1ZCYA 4HG6A 5C47A 1H5SC 3JTJA 4D11C 1YP2A 3USQA 1VGTA 4HO4A 3N9WA 4D0TA 1H4DA 3JUKA 5J49A 2OEFA 3CKOA 5C3BA 1IIMA 1LZJA 2P6WA 2XWLA 1H5TA 1S4OA 2W0VA 4HO5A 3USRA 3LW6A 1JV1A 5C4CA 2X5SA 1OQMB 2XMEA 1WT2A 4Y6NA 5EJZA 1LL3A 5IDTA 1QWJA 5CMIA 1G3LA 4EEAA 1VGWA 1ZDFA 1H7TA 2RJ6A 1TW5A 2ZU7A 2I5KA 1H7HA 1WT1A 3U2UA 2GGOA 3E26A 1R80A 4B4GA 1GX4A 4IRPA 1ON6A 3SXEA 2RIZA 2PGVA 4FRAA 3ZF8A 5C49A 1G95A 2VXLA 3I0DA 1YP3A 1VGZA 2PX7A 3OC9A 5FV9A 3ZLKA 4JD0A 3V0QA 1ZHJA 4FRQA 1H7GA 4KT7A 5CQPA 1JYLA 1R7UA 3ST8A 3Q7UA 4P02A 1R7XA 1FGGA 1S4PA 2W0WA 1ZI5A 5C4DA 2FYAA 5DDVA 3I0FA 1HV9A 5HS2A 1ZCTA 1FRWA 2A8UA 2E3DA 3CKJA 3HL3A 4FROA 2D7IA 4Y64A 4FRPA 4HO6A 5C1GA 5C48A 4M2BA 4MIXA 3SXGA 5C38A 1H7EA 2QKXA 5CQLX 1VZXA 5JQQA 2Y7AA 4CJCA 1ZIZA 2WVLA 2FFVA 2AESA 5CMHA 1LL2A 4MYBA 5FYEA 1WT0A 2PGYA 1JVGA 2VXMA 4BQHA 1R81A 2A8WA 2XMHA 3OH0A 2Y6PA 5EJ1A 1VM8A 5L6SA 1WSZA 2GGQA 2OEGA 2RJ7A 1LZ7A 4HO3A 4M2AA 3ZGGA 1R7VA 4G87A 3SPTA 2V0KA 5C3DA 3JUJA 2FYCB 3CKVA 1LVWA 4HCQA 5BXCA 4B42A 1G23A 2JCJA 4FIXA 5L6VA 2APCA 2RIYA 4KPZA 4FRMA 1O7OA 3K8DA 2PA4A 2WAWA 5D91A 2V0HA 1FGXA 1H7QA 4FRLA 4JISA 4LW3A 2RIXA 1FXJA 1ZJ0A 2Y4MA 1EZIA 1TVYA 2X60A 3OAMA 1H7FA 1R82A 1W57A 1H7LA 3FOQA 2RJ5A 4EEOA 4DECA 1G93A 1G97A 4HO8A 4EE4A 2YQJA 4CJ8A 3R2WA 5FTVA 1HM9A 3SXBA 4Y63A 2JCLA 5C4FA 3SX3A 1NHEB 3U0YA 1JV3A 1VICA 1H5RB 3E25A 4B4MA 1HJLA 3F1CA 4FCUA 4FIYA 2YQCA 2MZBA 1Z90A 3I0JA 2VS5A 5C1HA 4NAKA 1WVCA 1FR9A 4ASYA 1NWGB 1ZI4A 1GX0A 3BRKX 3T7OA 1QGQA 1INIA 3PKPA 3OH4A 1E5KA 2VFZA 1GQ9A 1IINA 1ZJ1A 5CMJA 5C4BA 3PKQA 1XZ6A 3V91A 2C0NA 3CGXA 1G0RA 1FXOA 3V0PA 1FO9A 3SX5A 2J0AA 3CKNA 2UX8A 2Z86A 4HO0A 1FOAA 2YESA 2FY7A 1I52A 4AAWA 2BO6A 1YROB 2J0BA 1ZJPA 4HO9A 1ZDGA 4G3QA 3CKQA 3BCVA 4KC4A 3ZGFA 2VK9A 4Q7CA 1YP4A 5FUHA 5DDTA 1ZI1A 4LW6A 2FFUA 2YC3A 4AYLA 3TZTA 1FO8A 1NKHB 3OKRA 4GBPA 4K6RA 1ON8A 3I0EA 2ZU8A 4KC1A 3V8ZA 1NQIB 2P73A 4P00A 2QH5A 4Y7FA 4NAIA 3O3PA 3GUEA 4FRDA 1JVDA 3T7MA 4B4BA 1O23B 5C1LA 3U2TA 3SXDA 2Q4JA 1V83A 2WE9A 1H4EA 1OMZA 4EEMA 3POLA 1G8OA 2O1FA 1W77A 3OH2A 2OI5A 4FCEA 2AECA 1GWVA 1PZTA 3RMVA 1GWWA 1HM8A 4Y9XA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3F1Y A;  1ZCU A;  1FWY A;  3RSB A;  4IRQ A;  3IOH A;  4ASJ A;  1H4C A;  1GA8 A;  1ZJO A;  1NMM B;  4NAN A;  2RJ9 A;  1VZT A;  5FTS A;  2FYB A;  2XWM A;  3I0L A;  4EVW A;  1W55 A;  3SX7 A;  2ZU9 A;  4L41 C;  2VS3 A;  1MP3 A;  4DE7 A;  1G2V A;  2O1G A;  5CMG X;  2ICX A;  4Y7U A;  1LZI A;  4AC3 A;  1H5R A;  4R7P A;  3U2X A;  3OGZ A;  1LZ0 A;  3V0L A;  3IOJ A;  1V82 A;  4KRV A;  2OI7 A;  2AE7 A;  4KNX A;  1FR8 A;  2YQH A;  2QGI A;  1G9R A;  2AM4 A;  3QVB A;  4MND A;  4ARW A;  2V0I A;  3V8Y A;  1QGS A;  3I0I X;  2Y4J A;  5AJP A;  3D5N A;  1GQC A;  3RMW A;  1O0R A;  2Z87 A;  1SS9 A;  3V90 A;  2DPW A;  1H5S D;  2JCO A;  4DDZ A;  3DUV A;  2RJ1 A;  3Q4S A;  3R3I A;  1KWS A;  4Y7V A;  5C8R A;  3I0G A;  2BO8 A;  3DK5 A;  2VS4 A;  2O1H A;  5IDS A;  2VSH A;  1ZJ3 A;  2YCM A;  1VH3 A;  4J18 A;  3ZLL A;  1XHB A;  4B2W A;  4XWI A;  2X5Z A;  5C36 A;  4Y7T A;  4FRB A;  4BMA A;  3K8E A;  4HOC A;  1ZI3 A;  2E8B A;  4G3S A;  3OH3 A;  3V0O A;  4CVH A;  5IFY A;  2BO7 A;  3V0N A;  4KPX A;  1NF5 B;  2BO4 A;  1H5T B;  4FQW A;  4KC2 A;  5I1F A;  1R7Y A;  3DJ4 A;  4D0Z A;  2YQS A;  4YS8 A;  4B5B A;  2Y4K A;  1MP5 A;  1OMX A;  4G3P A;  3FWW A;  1JYK A;  5AJO A;  1HJJ A;  1MP4 A;  3D8V A;  3U0X A;  1FG5 N;  1H5S A;  4D11 A;  3I0H A;  1QG8 A;  2V0J A;  2YC5 A;  2RJ0 A;  5FU8 A;  2VSI A;  4Y6U A;  1VPA A;  3KIA A;  3OH1 A;  3T7N A;  1H5S B;  3Q80 A;  1FZW A;  2I7B A;  4CJB A;  5CQO A;  4D48 A;  3SXA A;  2I5E A;  4EEG A;  2Y4L A;  4UEG A;  5CMF X;  2OI6 A;  2VD4 A;  1S4N A;  1ZCV A;  1R7T A;  2AGD A;  1K4V A;  5CQM X;  3IOI A;  2WVK A;  2CU2 A;  2X65 A;  5C3A A;  3D98 A;  5CQN X;  4KXO A;  1VH1 A;  1EYR A;  5C4E A;  1LL0 A;  1O7Q A;  5AJN A;  2FYD B;  4Y7G A;  4EE3 A;  3CU0 A;  2V0L A;  1TZF A;  1G1L A;  1ZJ2 A;  1V84 A;  1INJ A;  4FRH A;  2JCK A;  3SXC A;  1MC3 A;  4ECM A;  2AH9 A;  5FU0 A;  3SX8 A;  4E1K A;  3NGW A;  1WT3 A;  4KQL A;  2WVM A;  1PZY B;  4HO2 A;  2WGZ A;  1HM0 A;  5EIY A;  1TW1 A;  2RJ4 A;  3I0C A;  4NAL A;  3EE5 A;  2RIT A;  4ZDQ A;  2RJ8 A;  3U2W A;  2P72 A;  1H3M A;  2WEE A;  2XWN A;  2D0J A;  3PNN A;  3TQD A;  2NXV A;  4FRE A;  1VZU A;  2ICY A;  4KNR A;  2AM3 A;  4B3U A;  3U2V A;  3I0K A;  2D7R A;  4EE5 A;  4Y62 A;  4C2S A;  4M4K A;  3V0M A;  4B2X A;  2AM5 A;  1VGU A;  4AYJ A;  4M28 A;  1ZCY A;  4HG6 A;  5C47 A;  1H5S C;  3JTJ A;  4D11 C;  1YP2 A;  3USQ A;  1VGT A;  4HO4 A;  3N9W A;  4D0T A;  1H4D A;  3JUK A;  5J49 A;  2OEF A;  3CKO A;  5C3B A;  1IIM A;  1LZJ A;  2P6W A;  2XWL A;  1H5T A;  1S4O A;  2W0V A;  4HO5 A;  3USR A;  3LW6 A;  1JV1 A;  5C4C A;  2X5S A;  1OQM B;  2XME A;  1WT2 A;  4Y6N A;  5EJZ A;  1LL3 A;  5IDT A;  1QWJ A;  5CMI A;  1G3L A;  4EEA A;  1VGW A;  1ZDF A;  1H7T A;  2RJ6 A;  1TW5 A;  2ZU7 A;  2I5K A;  1H7H A;  1WT1 A;  3U2U A;  2GGO A;  3E26 A;  1R80 A;  4B4G A;  1GX4 A;  4IRP A;  1ON6 A;  3SXE A;  2RIZ A;  2PGV A;  4FRA A;  3ZF8 A;  5C49 A;  1G95 A;  2VXL A;  3I0D A;  1YP3 A;  1VGZ A;  2PX7 A;  3OC9 A;  5FV9 A;  3ZLK A;  4JD0 A;  3V0Q A;  1ZHJ A;  4FRQ A;  1H7G A;  4KT7 A;  5CQP A;  1JYL A;  1R7U A;  3ST8 A;  3Q7U A;  4P02 A;  1R7X A;  1FGG A;  1S4P A;  2W0W A;  1ZI5 A;  5C4D A;  2FYA A;  5DDV A;  3I0F A;  1HV9 A;  5HS2 A;  1ZCT A;  1FRW A;  2A8U A;  2E3D A;  3CKJ A;  3HL3 A;  4FRO A;  2D7I A;  4Y64 A;  4FRP A;  4HO6 A;  5C1G A;  5C48 A;  4M2B A;  3SXG A;  5C38 A;  1H7E A;  2QKX A;  5CQL X;  1VZX A;  5JQQ A;  2Y7A A;  4CJC A;  1ZIZ A;  2WVL A;  2FFV A;  2AES A;  5CMH A;  1LL2 A;  4MYB A;  5FYE A;  1WT0 A;  2PGY A;  1JVG A;  2VXM A;  4BQH A;  1R81 A;  2A8W A;  2XMH A;  3OH0 A;  2Y6P A;  5EJ1 A;  1VM8 A;  5L6S A;  1WSZ A;  2GGQ A;  2OEG A;  2RJ7 A;  1LZ7 A;  4HO3 A;  4M2A A;  3ZGG A;  1R7V A;  4G87 A;  3SPT A;  2V0K A;  5C3D A;  3JUJ A;  2FYC B;  3CKV A;  1LVW A;  4HCQ A;  5BXC A;  4B42 A;  1G23 A;  2JCJ A;  5L6V A;  2APC A;  2RIY A;  4KPZ A;  4FRM A;  1O7O A;  3K8D A;  2PA4 A;  2WAW A;  2V0H A;  1FGX A;  1H7Q A;  4FRL A;  4JIS A;  4LW3 A;  2RIX A;  1FXJ A;  1ZJ0 A;  2Y4M A;  1EZI A;  1TVY A;  2X60 A;  3OAM A;  1H7F A;  1R82 A;  1W57 A;  1H7L A;  3FOQ A;  2RJ5 A;  4EEO A;  4DEC A;  1G93 A;  1G97 A;  4HO8 A;  4EE4 A;  2YQJ A;  4CJ8 A;  3R2W A;  5FTV A;  1HM9 A;  3SXB A;  4Y63 A;  2JCL A;  5C4F A;  3SX3 A;  1NHE B;  3U0Y A;  1JV3 A;  1VIC A;  1H5R B;  3E25 A;  4B4M A;  1HJL A;  3F1C A;  4FCU A;  2YQC A;  2MZB A;  1Z90 A;  3I0J A;  2VS5 A;  5C1H A;  4NAK A;  1WVC A;  1FR9 A;  4ASY A;  1NWG B;  1ZI4 A;  1GX0 A;  3BRK X;  3T7O A;  1QGQ A;  1INI A;  3PKP A;  3OH4 A;  1E5K A;  2VFZ A;  1GQ9 A;  1IIN A;  1ZJ1 A;  5CMJ A;  5C4B A;  3PKQ A;  1XZ6 A;  3V91 A;  3CGX A;  1G0R A;  1FXO A;  3V0P A;  1FO9 A;  3SX5 A;  3CKN A;  2UX8 A;  2Z86 A;  4HO0 A;  1FOA A;  2YES A;  2FY7 A;  1I52 A;  4AAW A;  2BO6 A;  1YRO B;  4HO9 A;  1ZJP A;  1ZDG A;  4G3Q A;  3CKQ A;  3BCV A;  4KC4 A;  3ZGF A;  1YP4 A;  5FUH A;  5DDT A;  1ZI1 A;  4LW6 A;  2FFU A;  2YC3 A;  4AYL A;  3TZT A;  1FO8 A;  1NKH B;  3OKR A;  4GBP A;  4K6R A;  1ON8 A;  3I0E A;  2ZU8 A;  4KC1 A;  3V8Z A;  1NQI B;  2P73 A;  4P00 A;  2QH5 A;  4Y7F A;  4NAI A;  3O3P A;  3GUE A;  4FRD A;  1JVD A;  3T7M A;  4B4B A;  1O23 B;  5C1L A;  3U2T A;  3SXD A;  2Q4J A;  1V83 A;  2WE9 A;  1H4E A;  1OMZ A;  4EEM A;  3POL A;  1G8O A;  2O1F A;  1W77 A;  3OH2 A;  2OI5 A;  4FCE A;  2AEC A;  1GWV A;  1PZT A;  3RMV A;  1GWW A;  1HM8 A;  4Y9X A; 
#chains in the Genus database with same CATH topology
 3F1Y A;  1ZCU A;  1FWY A;  3RSB A;  4IRQ A;  3IOH A;  4ASJ A;  1H4C A;  1GA8 A;  1ZJO A;  1NMM B;  4NAN A;  2RJ9 A;  1VZT A;  5FTS A;  2FYB A;  2XWM A;  3I0L A;  4EVW A;  1W55 A;  3SX7 A;  2ZU9 A;  4L41 C;  2VS3 A;  1MP3 A;  4DE7 A;  1G2V A;  2O1G A;  5CMG X;  2ICX A;  4Y7U A;  1LZI A;  4AC3 A;  1H5R A;  4R7P A;  3U2X A;  3OGZ A;  1LZ0 A;  3V0L A;  3IOJ A;  1V82 A;  4KRV A;  2OI7 A;  2AE7 A;  4KNX A;  1FR8 A;  2YQH A;  2QGI A;  1G9R A;  2AM4 A;  3QVB A;  4MND A;  4ARW A;  2V0I A;  3V8Y A;  1QGS A;  3I0I X;  2Y4J A;  5AJP A;  3D5N A;  1GQC A;  3RMW A;  1O0R A;  2Z87 A;  1SS9 A;  3V90 A;  2DPW A;  1H5S D;  2JCO A;  4DDZ A;  3DUV A;  2RJ1 A;  3Q4S A;  3R3I A;  1KWS A;  4Y7V A;  5C8R A;  3I0G A;  2BO8 A;  3DK5 A;  2VS4 A;  2O1H A;  5IDS A;  2VSH A;  1ZJ3 A;  2YCM A;  1VH3 A;  4J18 A;  3ZLL A;  1XHB A;  4B2W A;  4XWI A;  2X5Z A;  5C36 A;  4Y7T A;  4FRB A;  4BMA A;  3K8E A;  4HOC A;  1ZI3 A;  2E8B A;  4G3S A;  4O6N A;  3OH3 A;  3V0O A;  4CVH A;  5IFY A;  2BO7 A;  3V0N A;  4KPX A;  1NF5 B;  2BO4 A;  1H5T B;  4FQW A;  4KC2 A;  5I1F A;  1R7Y A;  3DJ4 A;  4D0Z A;  2YQS A;  4YS8 A;  4B5B A;  2Y4K A;  1MP5 A;  1OMX A;  4G3P A;  3FWW A;  1JYK A;  5AJO A;  1HJJ A;  1MP4 A;  3D8V A;  3U0X A;  1FG5 N;  4O6M A;  1H5S A;  4D11 A;  3I0H A;  1QG8 A;  2V0J A;  2YC5 A;  2RJ0 A;  5FU8 A;  2VSI A;  4Y6U A;  1VPA A;  3KIA A;  3OH1 A;  3T7N A;  1H5S B;  3Q80 A;  1FZW A;  2I7B A;  4CJB A;  5CQO A;  4D48 A;  3SXA A;  2I5E A;  4EEG A;  2Y4L A;  4UEG A;  5CMF X;  2OI6 A;  5D92 A;  2VD4 A;  1S4N A;  1ZCV A;  1R7T A;  2AGD A;  1K4V A;  5CQM X;  3IOI A;  2WVK A;  2CU2 A;  2X65 A;  5C3A A;  3D98 A;  5CQN X;  4KXO A;  1VH1 A;  1EYR A;  5C4E A;  1LL0 A;  1O7Q A;  5AJN A;  2FYD B;  4Y7G A;  4EE3 A;  3CU0 A;  2V0L A;  1TZF A;  1G1L A;  1ZJ2 A;  1V84 A;  1INJ A;  4FRH A;  2JCK A;  3SXC A;  1MC3 A;  4ECM A;  2AH9 A;  5FU0 A;  3SX8 A;  4E1K A;  3NGW A;  1WT3 A;  4KQL A;  2WVM A;  1PZY B;  4HO2 A;  2WGZ A;  1HM0 A;  5EIY A;  1TW1 A;  2RJ4 A;  3I0C A;  4NAL A;  3EE5 A;  2RIT A;  4ZDQ A;  2RJ8 A;  3U2W A;  2P72 A;  1H3M A;  2WEE A;  2XWN A;  2D0J A;  3PNN A;  3TQD A;  2NXV A;  4FRE A;  1VZU A;  2ICY A;  4KNR A;  2AM3 A;  4B3U A;  3U2V A;  3I0K A;  2D7R A;  4EE5 A;  4Y62 A;  4C2S A;  4M4K A;  3V0M A;  4B2X A;  2AM5 A;  1VGU A;  4AYJ A;  4M28 A;  1ZCY A;  4HG6 A;  5C47 A;  1H5S C;  3JTJ A;  4D11 C;  1YP2 A;  3USQ A;  1VGT A;  4HO4 A;  3N9W A;  4D0T A;  1H4D A;  3JUK A;  5J49 A;  2OEF A;  3CKO A;  5C3B A;  1IIM A;  1LZJ A;  2P6W A;  2XWL A;  1H5T A;  1S4O A;  2W0V A;  4HO5 A;  3USR A;  3LW6 A;  1JV1 A;  5C4C A;  2X5S A;  1OQM B;  2XME A;  1WT2 A;  4Y6N A;  5EJZ A;  1LL3 A;  5IDT A;  1QWJ A;  5CMI A;  1G3L A;  4EEA A;  1VGW A;  1ZDF A;  1H7T A;  2RJ6 A;  1TW5 A;  2ZU7 A;  2I5K A;  1H7H A;  1WT1 A;  3U2U A;  2GGO A;  3E26 A;  1R80 A;  4B4G A;  1GX4 A;  4IRP A;  1ON6 A;  3SXE A;  2RIZ A;  2PGV A;  4FRA A;  3ZF8 A;  5C49 A;  1G95 A;  2VXL A;  3I0D A;  1YP3 A;  1VGZ A;  2PX7 A;  3OC9 A;  5FV9 A;  3ZLK A;  4JD0 A;  3V0Q A;  1ZHJ A;  4FRQ A;  1H7G A;  4KT7 A;  5CQP A;  1JYL A;  1R7U A;  3ST8 A;  3Q7U A;  4P02 A;  1R7X A;  1FGG A;  1S4P A;  2W0W A;  1ZI5 A;  5C4D A;  2FYA A;  5DDV A;  3I0F A;  1HV9 A;  5HS2 A;  1ZCT A;  1FRW A;  2A8U A;  2E3D A;  3CKJ A;  3HL3 A;  4FRO A;  2D7I A;  4Y64 A;  4FRP A;  4HO6 A;  5C1G A;  5C48 A;  4M2B A;  4MIX A;  3SXG A;  5C38 A;  1H7E A;  2QKX A;  5CQL X;  1VZX A;  5JQQ A;  2Y7A A;  4CJC A;  1ZIZ A;  2WVL A;  2FFV A;  2AES A;  5CMH A;  1LL2 A;  4MYB A;  5FYE A;  1WT0 A;  2PGY A;  1JVG A;  2VXM A;  4BQH A;  1R81 A;  2A8W A;  2XMH A;  3OH0 A;  2Y6P A;  5EJ1 A;  1VM8 A;  5L6S A;  1WSZ A;  2GGQ A;  2OEG A;  2RJ7 A;  1LZ7 A;  4HO3 A;  4M2A A;  3ZGG A;  1R7V A;  4G87 A;  3SPT A;  2V0K A;  5C3D A;  3JUJ A;  2FYC B;  3CKV A;  1LVW A;  4HCQ A;  5BXC A;  4B42 A;  1G23 A;  2JCJ A;  4FIX A;  5L6V A;  2APC A;  2RIY A;  4KPZ A;  4FRM A;  1O7O A;  3K8D A;  2PA4 A;  2WAW A;  5D91 A;  2V0H A;  1FGX A;  1H7Q A;  4FRL A;  4JIS A;  4LW3 A;  2RIX A;  1FXJ A;  1ZJ0 A;  2Y4M A;  1EZI A;  1TVY A;  2X60 A;  3OAM A;  1H7F A;  1R82 A;  1W57 A;  1H7L A;  3FOQ A;  2RJ5 A;  4EEO A;  4DEC A;  1G93 A;  1G97 A;  4HO8 A;  4EE4 A;  2YQJ A;  4CJ8 A;  3R2W A;  5FTV A;  1HM9 A;  3SXB A;  4Y63 A;  2JCL A;  5C4F A;  3SX3 A;  1NHE B;  3U0Y A;  1JV3 A;  1VIC A;  1H5R B;  3E25 A;  4B4M A;  1HJL A;  3F1C A;  4FCU A;  4FIY A;  2YQC A;  2MZB A;  1Z90 A;  3I0J A;  2VS5 A;  5C1H A;  4NAK A;  1WVC A;  1FR9 A;  4ASY A;  1NWG B;  1ZI4 A;  1GX0 A;  3BRK X;  3T7O A;  1QGQ A;  1INI A;  3PKP A;  3OH4 A;  1E5K A;  2VFZ A;  1GQ9 A;  1IIN A;  1ZJ1 A;  5CMJ A;  5C4B A;  3PKQ A;  1XZ6 A;  3V91 A;  2C0N A;  3CGX A;  1G0R A;  1FXO A;  3V0P A;  1FO9 A;  3SX5 A;  2J0A A;  3CKN A;  2UX8 A;  2Z86 A;  4HO0 A;  1FOA A;  2YES A;  2FY7 A;  1I52 A;  4AAW A;  2BO6 A;  1YRO B;  2J0B A;  1ZJP A;  4HO9 A;  1ZDG A;  4G3Q A;  3CKQ A;  3BCV A;  4KC4 A;  3ZGF A;  2VK9 A;  4Q7C A;  1YP4 A;  5FUH A;  5DDT A;  1ZI1 A;  4LW6 A;  2FFU A;  2YC3 A;  4AYL A;  3TZT A;  1FO8 A;  1NKH B;  3OKR A;  4GBP A;  4K6R A;  1ON8 A;  3I0E A;  2ZU8 A;  4KC1 A;  3V8Z A;  1NQI B;  2P73 A;  4P00 A;  2QH5 A;  4Y7F A;  4NAI A;  3O3P A;  3GUE A;  4FRD A;  1JVD A;  3T7M A;  4B4B A;  1O23 B;  5C1L A;  3U2T A;  3SXD A;  2Q4J A;  1V83 A;  2WE9 A;  1H4E A;  1OMZ A;  4EEM A;  3POL A;  1G8O A;  2O1F A;  1W77 A;  3OH2 A;  2OI5 A;  4FCE A;  2AEC A;  1GWV A;  1PZT A;  3RMV A;  1GWW A;  1HM8 A;  4Y9X A; 
#chains in the Genus database with same CATH homology
 3F1Y A;  1ZCU A;  1FWY A;  3RSB A;  4IRQ A;  3IOH A;  4ASJ A;  1H4C A;  1GA8 A;  1ZJO A;  1NMM B;  4NAN A;  2RJ9 A;  1VZT A;  5FTS A;  2FYB A;  2XWM A;  3I0L A;  4EVW A;  1W55 A;  3SX7 A;  2ZU9 A;  4L41 C;  2VS3 A;  1MP3 A;  4DE7 A;  1G2V A;  2O1G A;  5CMG X;  2ICX A;  4Y7U A;  1LZI A;  4AC3 A;  1H5R A;  4R7P A;  3U2X A;  3OGZ A;  1LZ0 A;  3V0L A;  3IOJ A;  1V82 A;  4KRV A;  2OI7 A;  2AE7 A;  4KNX A;  1FR8 A;  2YQH A;  2QGI A;  1G9R A;  2AM4 A;  3QVB A;  4MND A;  4ARW A;  2V0I A;  3V8Y A;  1QGS A;  3I0I X;  2Y4J A;  5AJP A;  3D5N A;  1GQC A;  3RMW A;  1O0R A;  2Z87 A;  1SS9 A;  3V90 A;  2DPW A;  1H5S D;  2JCO A;  4DDZ A;  3DUV A;  2RJ1 A;  3Q4S A;  3R3I A;  1KWS A;  4Y7V A;  5C8R A;  3I0G A;  2BO8 A;  3DK5 A;  2VS4 A;  2O1H A;  5IDS A;  2VSH A;  1ZJ3 A;  2YCM A;  1VH3 A;  4J18 A;  3ZLL A;  1XHB A;  4B2W A;  4XWI A;  2X5Z A;  5C36 A;  4Y7T A;  4FRB A;  4BMA A;  3K8E A;  4HOC A;  1ZI3 A;  2E8B A;  4G3S A;  4O6N A;  3OH3 A;  3V0O A;  4CVH A;  5IFY A;  2BO7 A;  3V0N A;  4KPX A;  1NF5 B;  2BO4 A;  1H5T B;  4FQW A;  4KC2 A;  5I1F A;  1R7Y A;  3DJ4 A;  4D0Z A;  2YQS A;  4YS8 A;  4B5B A;  2Y4K A;  1MP5 A;  1OMX A;  4G3P A;  3FWW A;  1JYK A;  5AJO A;  1HJJ A;  1MP4 A;  3D8V A;  3U0X A;  1FG5 N;  4O6M A;  1H5S A;  4D11 A;  3I0H A;  1QG8 A;  2V0J A;  2YC5 A;  2RJ0 A;  5FU8 A;  2VSI A;  4Y6U A;  1VPA A;  3KIA A;  3OH1 A;  3T7N A;  1H5S B;  3Q80 A;  1FZW A;  2I7B A;  4CJB A;  5CQO A;  4D48 A;  3SXA A;  2I5E A;  4EEG A;  2Y4L A;  4UEG A;  5CMF X;  2OI6 A;  5D92 A;  2VD4 A;  1S4N A;  1ZCV A;  1R7T A;  2AGD A;  1K4V A;  5CQM X;  3IOI A;  2WVK A;  2CU2 A;  2X65 A;  5C3A A;  3D98 A;  5CQN X;  4KXO A;  1VH1 A;  1EYR A;  5C4E A;  1LL0 A;  1O7Q A;  5AJN A;  2FYD B;  4Y7G A;  4EE3 A;  3CU0 A;  2V0L A;  1TZF A;  1G1L A;  1ZJ2 A;  1V84 A;  1INJ A;  4FRH A;  2JCK A;  3SXC A;  1MC3 A;  4ECM A;  2AH9 A;  5FU0 A;  3SX8 A;  4E1K A;  3NGW A;  1WT3 A;  4KQL A;  2WVM A;  1PZY B;  4HO2 A;  2WGZ A;  1HM0 A;  5EIY A;  1TW1 A;  2RJ4 A;  3I0C A;  4NAL A;  3EE5 A;  2RIT A;  4ZDQ A;  2RJ8 A;  3U2W A;  2P72 A;  1H3M A;  2WEE A;  2XWN A;  2D0J A;  3PNN A;  3TQD A;  2NXV A;  4FRE A;  1VZU A;  2ICY A;  4KNR A;  2AM3 A;  4B3U A;  3U2V A;  3I0K A;  2D7R A;  4EE5 A;  4Y62 A;  4C2S A;  4M4K A;  3V0M A;  4B2X A;  2AM5 A;  1VGU A;  4AYJ A;  4M28 A;  1ZCY A;  4HG6 A;  5C47 A;  1H5S C;  3JTJ A;  4D11 C;  1YP2 A;  3USQ A;  1VGT A;  4HO4 A;  3N9W A;  4D0T A;  1H4D A;  3JUK A;  5J49 A;  2OEF A;  3CKO A;  5C3B A;  1IIM A;  1LZJ A;  2P6W A;  2XWL A;  1H5T A;  1S4O A;  2W0V A;  4HO5 A;  3USR A;  3LW6 A;  1JV1 A;  5C4C A;  2X5S A;  1OQM B;  2XME A;  1WT2 A;  4Y6N A;  5EJZ A;  1LL3 A;  5IDT A;  1QWJ A;  5CMI A;  1G3L A;  4EEA A;  1VGW A;  1ZDF A;  1H7T A;  2RJ6 A;  1TW5 A;  2ZU7 A;  2I5K A;  1H7H A;  1WT1 A;  3U2U A;  2GGO A;  3E26 A;  1R80 A;  4B4G A;  1GX4 A;  4IRP A;  1ON6 A;  3SXE A;  2RIZ A;  2PGV A;  4FRA A;  3ZF8 A;  5C49 A;  1G95 A;  2VXL A;  3I0D A;  1YP3 A;  1VGZ A;  2PX7 A;  3OC9 A;  5FV9 A;  3ZLK A;  4JD0 A;  3V0Q A;  1ZHJ A;  4FRQ A;  1H7G A;  4KT7 A;  5CQP A;  1JYL A;  1R7U A;  3ST8 A;  3Q7U A;  4P02 A;  1R7X A;  1FGG A;  1S4P A;  2W0W A;  1ZI5 A;  5C4D A;  2FYA A;  5DDV A;  3I0F A;  1HV9 A;  5HS2 A;  1ZCT A;  1FRW A;  2A8U A;  2E3D A;  3CKJ A;  3HL3 A;  4FRO A;  2D7I A;  4Y64 A;  4FRP A;  4HO6 A;  5C1G A;  5C48 A;  4M2B A;  4MIX A;  3SXG A;  5C38 A;  1H7E A;  2QKX A;  5CQL X;  1VZX A;  5JQQ A;  2Y7A A;  4CJC A;  1ZIZ A;  2WVL A;  2FFV A;  2AES A;  5CMH A;  1LL2 A;  4MYB A;  5FYE A;  1WT0 A;  2PGY A;  1JVG A;  2VXM A;  4BQH A;  1R81 A;  2A8W A;  2XMH A;  3OH0 A;  2Y6P A;  5EJ1 A;  1VM8 A;  5L6S A;  1WSZ A;  2GGQ A;  2OEG A;  2RJ7 A;  1LZ7 A;  4HO3 A;  4M2A A;  3ZGG A;  1R7V A;  4G87 A;  3SPT A;  2V0K A;  5C3D A;  3JUJ A;  2FYC B;  3CKV A;  1LVW A;  4HCQ A;  5BXC A;  4B42 A;  1G23 A;  2JCJ A;  4FIX A;  5L6V A;  2APC A;  2RIY A;  4KPZ A;  4FRM A;  1O7O A;  3K8D A;  2PA4 A;  2WAW A;  5D91 A;  2V0H A;  1FGX A;  1H7Q A;  4FRL A;  4JIS A;  4LW3 A;  2RIX A;  1FXJ A;  1ZJ0 A;  2Y4M A;  1EZI A;  1TVY A;  2X60 A;  3OAM A;  1H7F A;  1R82 A;  1W57 A;  1H7L A;  3FOQ A;  2RJ5 A;  4EEO A;  4DEC A;  1G93 A;  1G97 A;  4HO8 A;  4EE4 A;  2YQJ A;  4CJ8 A;  3R2W A;  5FTV A;  1HM9 A;  3SXB A;  4Y63 A;  2JCL A;  5C4F A;  3SX3 A;  1NHE B;  3U0Y A;  1JV3 A;  1VIC A;  1H5R B;  3E25 A;  4B4M A;  1HJL A;  3F1C A;  4FCU A;  4FIY A;  2YQC A;  2MZB A;  1Z90 A;  3I0J A;  2VS5 A;  5C1H A;  4NAK A;  1WVC A;  1FR9 A;  4ASY A;  1NWG B;  1ZI4 A;  1GX0 A;  3BRK X;  3T7O A;  1QGQ A;  1INI A;  3PKP A;  3OH4 A;  1E5K A;  2VFZ A;  1GQ9 A;  1IIN A;  1ZJ1 A;  5CMJ A;  5C4B A;  3PKQ A;  1XZ6 A;  3V91 A;  2C0N A;  3CGX A;  1G0R A;  1FXO A;  3V0P A;  1FO9 A;  3SX5 A;  2J0A A;  3CKN A;  2UX8 A;  2Z86 A;  4HO0 A;  1FOA A;  2YES A;  2FY7 A;  1I52 A;  4AAW A;  2BO6 A;  1YRO B;  2J0B A;  1ZJP A;  4HO9 A;  1ZDG A;  4G3Q A;  3CKQ A;  3BCV A;  4KC4 A;  3ZGF A;  2VK9 A;  4Q7C A;  1YP4 A;  5FUH A;  5DDT A;  1ZI1 A;  4LW6 A;  2FFU A;  2YC3 A;  4AYL A;  3TZT A;  1FO8 A;  1NKH B;  3OKR A;  4GBP A;  4K6R A;  1ON8 A;  3I0E A;  2ZU8 A;  4KC1 A;  3V8Z A;  1NQI B;  2P73 A;  4P00 A;  2QH5 A;  4Y7F A;  4NAI A;  3O3P A;  3GUE A;  4FRD A;  1JVD A;  3T7M A;  4B4B A;  1O23 B;  5C1L A;  3U2T A;  3SXD A;  2Q4J A;  1V83 A;  2WE9 A;  1H4E A;  1OMZ A;  4EEM A;  3POL A;  1G8O A;  2O1F A;  1W77 A;  3OH2 A;  2OI5 A;  4FCE A;  2AEC A;  1GWV A;  1PZT A;  3RMV A;  1GWW A;  1HM8 A;  4Y9X A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...