4FROA

Crystal structure of bbbb+udp+gal at ph 9.0 with mpd as the cryoprotectant
Total Genus 79
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
79
sequence length
278
structure length
276
Chain Sequence
MVYPQPKVLTPCRKDVLVVTPWLAPIVWEGTFNIDILNEQFRLQNTTIGLTVFAIKKYVAFLKLFLETAEKHFMVGHRVHYYVFTDQPAAVPRVTLGTGRQLSVLEVGAYKRWQDVSMRRMEMISCERRFLSEVDYLVCVDVDMEFRDHVGVEILTPLFGTLHPSFYGSSREAFTYERRPQSQAYIPKDEGDFYYMGAFFGGSVQEVQRLTRACHQAMMVDQANGIEAVWHDESHLNKYLLRHKPTKVLSPEYLWDQQLLGWPAVLRKLRFTAVPK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords Histo-blood group ABO system transferase
publication title pH-induced conformational changes in human ABO(H) blood group glycosyltransferases confirm the importance of electrostatic interactions in the formation of the semi-closed state.
pubmed doi rcsb
source organism Homo sapiens
total genus 79
structure length 276
sequence length 278
ec nomenclature ec 2.4.1.37: Fucosylgalactoside 3-alpha-galactosyltransferase.
pdb deposition date 2012-06-26
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.550.10 Alpha Beta Alpha-Beta Complex Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A 4froA00
1FGXA 3F1YA 3IOIA 1H4DA 1GQ9A 2P72A 1LZ0A 2RJ1A 1S4NA 3SXBA 4AYJA 1ZCYA 1ZJ1A 1NKHB 2AM3A 5IFYA 1R82A 2W0VA 3OH0A 1W77A 3I0LA 1NWGB 3U2UA 2WGZA 5C38A 4EEAA 1G23A 2O1GA 1SS9A 4HO6A 2QKXA 1H7LA 5CQPA 5DDTA 5IDSA 1O7OA 2Y7AA 3N9WA 4LW3A 1FO8A 1NQIB 2A8UA 1TW1A 1H3MA 3NGWA 4M4KA 4FREA 2O1HA 5FU0A 1LL3A 2RITA 4GBPA 5J49A 1G8OA 3LW6A 2OEGA 4J18A 1O0RA 1H4EA 4FCUA 1INIA 4AC3A 4EEOA 1IINA 4B2WA 1XHBA 3D5NA 4NAKA 2XWMA 4CJBA 3V8ZA 4HO2A 2FYAA 4G3SA 5I1FA 1GWVA 2W0WA 3Q7UA 4KRVA 5CQNX 1INJA 2VS5A 1R80A 1R7UA 4IRQA 1ZJOA 4FROA 3D98A 4D11C 3DK5A 4CVHA 2X60A 2VXMA 3JUJA 4HO0A 2PX7A 1ZI5A 1H7FA 1G2VA 2YC5A 5C36A 5CQOA 4B4GA 4XWIA 3V0LA 1EZIA 2ZU7A 3CKOA 2AGDA 4G3QA 2MZBA 3CKQA 5CQLX 2D0JA 1XZ6A 3HL3A 1G93A 4M28A 1R81A 4G3PA 3SX5A 3U0XA 1ZJ0A 4KXOA 2ICXA 4ASYA 2X5ZA 2WEEA 4EEGA 5C1HA 3IOJA 1MP5A 1S4PA 3K8DA 2AH9A 4C2SA 5AJPA 2APCA 5CMIA 1FZWA 1ON6A 3SXGA 1WSZA 3ZLKA 4CJ8A 1H7GA 3OC9A 5C1LA 2Q4JA 3OKRA 1JV1A 1VICA 3DUVA 3CKJA 1YP3A 2ZU8A 5C48A 3OGZA 3SX3A 2A8WA 2V0KA 2NXVA 3POLA 1FOAA 1H4CA 3V91A 3U2WA 4HO5A 4HO9A 1H5SB 2FYCB 4IRPA 2YC3A 1H5SC 2RJ7A 2DPWA 3R2WA 4MYBA 1IIMA 3V0OA 5C3DA 3O3PA 1R7TA 3PKQA 4HOCA 1ZCVA 4FQWA 1TW5A 2V0IA 3RMVA 4BQHA 1FXOA 4ECMA 4B2XA 3PKPA 4FCEA 4FRBA 2Y4LA 4EE4A 1JV3A 1G97A 2YQCA 1W55A 2WVKA 1G3LA 1ZCUA 2RIYA 1JVDA 1GA8A 2X5SA 5AJNA 1V84A 2P73A 3CGXA 3U0YA 3I0FA 1LL2A 3SXEA 1VZXA 2PGYA 4K6RA 2E3DA 1ZI1A 2FY7A 3BRKX 3OH2A 1JVGA 3OH3A 2YQJA 1KWSA 1ON8A 5C8RA 4EE5A 3I0DA 2WVLA 2X65A 1G95A 3DJ4A 3JUKA 5FTSA 4P02A 2I7BA 4Y7VA 1FRWA 1VGTA 3EE5A 5C4DA 3ST8A 1ZI3A 1GQCA 4FRPA 1MP3A 2Z86A 2RJ6A 4UEGA 2RJ0A 1O23B 5JQQA 2QH5A 2BO4A 5CMHA 3V0NA 2VFZA 4B3UA 5IDTA 4FRQA 2XMEA 3FOQA 3ZGFA 1H5TA 2QGIA 4D11A 5AJOA 3SXCA 1VH1A 3ZGGA 1O7QA 4ZDQA 1GX4A 2RJ8A 3D8VA 4EEMA 4KC2A 3K8EA 1H5RA 1ZI4A 2VSIA 1E5KA 3ZLLA 3JTJA 5FUHA 4NALA 1ZCTA 5EJZA 4FRLA 2FFVA 3I0CA 3E25A 2O1FA 3U2XA 1QG8A 1FO9A 2Y6PA 1NMMB 2V0HA 2Y4KA 2BO8A 1G0RA 3T7MA 3I0EA 1V82A 3V8YA 3I0KA 5FYEA 1MC3A 2I5KA 4FRDA 5L6VA 4KC4A 2I5EA 1VH3A 4KC1A 3RMWA 1ZJPA 1HJLA 1K4VA 2YCMA 2YESA 1ZJ3A 4L41C 1VM8A 4R7PA 4Y7TA 5FTVA 4EE3A 1VGZA 2V0JA 2OI7A 2XWNA 2RJ4A 3R3IA 2VS4A 4B4MA 4B42A 1HM0A 4AAWA 2V0LA 1G1LA 1H5SA 1FGGA 1WT2A 1JYKA 1QWJA 3OH4A 1S4OA 5C3AA 5CMFX 1VGUA 2VS3A 1H5SD 2RJ9A 2Y4JA 4KPXA 2AM4A 4KNXA 1FXJA 1NF5B 3Q80A 3V0QA 2CU2A 4YS8A 3SXDA 3QVBA 3USRA 2WE9A 5FV9A 2OI5A 1H7TA 4HG6A 3I0IX 2WAWA 4Y9XA 1LZ7A 4HO8A 1FWYA 4FRMA 1R7VA 3F1CA 4HO3A 3T7OA 2AESA 3T7NA 4JD0A 4D0ZA 2JCLA 2D7IA 3KIAA 2D7RA 1H7HA 2PGVA 1WT1A 1OMZA 5C1GA 2FFUA 4DECA 2AECA 2FYBA 2PA4A 5EIYA 1WT0A 3SXAA 3SX8A 4LW6A 1I52A 3GUEA 1LL0A 2Y4MA 1W57A 3I0JA 1YROB 2GGOA 2XWLA 4HO4A 4D0TA 5C49A 4B4BA 2BO7A 1HJJA 3OAMA 2E8BA 2JCJA 1NHEB 4BMAA 2FYDB 3V90A 4CJCA 1FR8A 2P6WA 5C47A 5C3BA 1VZTA 4DDZA 1VZUA 1LZJA 2VXLA 1FR9A 4P00A 4KNRA 5FU8A 1WVCA 1QGQA 1YP4A 1ZJ2A 5CQMX 1ZIZA 3OH1A 1LVWA 1HV9A 4NANA 3SX7A 4NAIA 1VGWA 2OEFA 5EJ1A 2BO6A 1HM9A 2VSHA 4M2AA 1VPAA 4MNDA 5C4EA 3CKVA 1JYLA 2VD4A 4FRAA 3PNNA 1MP4A 3CU0A 1OQMB 5L6SA 1OMXA 3USQA 1ZDGA 2XMHA 3I0HA 4G87A 4Y6NA 4Y7FA 4Y7UA 5BXCA 4FRHA 1GX0A 1HM8A 3SPTA 2GGQA 3BCVA 1H5TB 1G9RA 2WVMA 4B5BA 4D48A 1PZTA 5CMJA 4HCQA 2JCKA 3U2VA 2OI6A 1WT3A 1H5RB 3I0GA 2AE7A 4KQLA 1TVYA 5HS2A 1ZDFA 5CMGX 4JISA 1GWWA 5DDVA 1EYRA 3V0PA 4DE7A 1R7XA 1H7EA 5C4BA 4Y63A 2AM5A 1R7YA 2ZU9A 4KPZA 5C4CA 4KT7A 4ASJA 4EVWA 4Y6UA 1TZFA 4Y62A 4Y64A 2RIXA 5C4FA 1FG5N 2ICYA 2RJ5A 1V83A 4Y7GA 1Z90A 1PZYB 1QGSA 3U2TA 1LZIA 4E1KA 4AYLA 3IOHA 2YQHA 2YQSA 4ARWA 2UX8A 1YP2A 3E26A 1H7QA 2Z87A 2JCOA 2RIZA 4M2BA 3CKNA 3TQDA 3TZTA 3ZF8A 3RSBA 3Q4SA 3FWWA 3V0MA 1ZHJA
chains in the Genus database with same CATH superfamily
1FGXA 3F1YA 3IOIA 1H4DA 1GQ9A 2P72A 1LZ0A 2RJ1A 1S4NA 3SXBA 4AYJA 1ZCYA 1ZJ1A 1NKHB 2AM3A 5IFYA 1R82A 2W0VA 3OH0A 1W77A 3I0LA 1NWGB 3U2UA 2WGZA 5C38A 4EEAA 4O6MA 1G23A 2O1GA 1SS9A 4HO6A 2QKXA 1H7LA 5CQPA 5DDTA 5IDSA 1O7OA 2Y7AA 3N9WA 4LW3A 1FO8A 1NQIB 2A8UA 1TW1A 4FIXA 1H3MA 3NGWA 4M4KA 4FREA 2O1HA 5FU0A 1LL3A 2RITA 4GBPA 5J49A 1G8OA 3LW6A 2OEGA 4J18A 1O0RA 1H4EA 4FCUA 1INIA 4AC3A 5D91A 4EEOA 1IINA 4B2WA 1XHBA 3D5NA 4NAKA 2XWMA 4CJBA 3V8ZA 4HO2A 2FYAA 4G3SA 5I1FA 1GWVA 2W0WA 3Q7UA 4KRVA 5CQNX 1INJA 2VS5A 1R80A 1R7UA 4O6NA 4IRQA 1ZJOA 4FROA 3D98A 4D11C 3DK5A 4CVHA 2X60A 2VXMA 3JUJA 4HO0A 2PX7A 1ZI5A 1H7FA 1G2VA 2YC5A 5C36A 5CQOA 4B4GA 4XWIA 3V0LA 1EZIA 2ZU7A 3CKOA 2AGDA 4G3QA 2MZBA 3CKQA 5CQLX 2D0JA 1XZ6A 3HL3A 1G93A 4M28A 1R81A 4G3PA 3SX5A 3U0XA 1ZJ0A 4KXOA 2ICXA 4ASYA 2X5ZA 2WEEA 4EEGA 5C1HA 3IOJA 1MP5A 1S4PA 3K8DA 2AH9A 4C2SA 5AJPA 2APCA 5CMIA 1FZWA 1ON6A 3SXGA 1WSZA 3ZLKA 4CJ8A 1H7GA 3OC9A 5C1LA 2Q4JA 3OKRA 1JV1A 4MIXA 1VICA 3DUVA 3CKJA 1YP3A 2ZU8A 5C48A 2VK9A 3OGZA 3SX3A 2A8WA 2V0KA 2NXVA 3POLA 1FOAA 1H4CA 3V91A 3U2WA 4HO5A 4HO9A 1H5SB 2FYCB 4IRPA 2YC3A 1H5SC 2RJ7A 2DPWA 3R2WA 4MYBA 1IIMA 3V0OA 5C3DA 3O3PA 1R7TA 3PKQA 4HOCA 1ZCVA 2J0BA 1TW5A 2V0IA 4FQWA 3RMVA 4BQHA 1FXOA 4ECMA 4B2XA 3PKPA 4FCEA 4FRBA 2Y4LA 4EE4A 1JV3A 1G97A 2YQCA 1W55A 2WVKA 1G3LA 1ZCUA 2RIYA 1JVDA 1GA8A 2X5SA 5AJNA 1V84A 2P73A 3CGXA 3U0YA 3I0FA 1LL2A 3SXEA 1VZXA 2PGYA 4K6RA 2E3DA 1ZI1A 2FY7A 3BRKX 3OH2A 1JVGA 3OH3A 2YQJA 1KWSA 1ON8A 5C8RA 4EE5A 3I0DA 2WVLA 2X65A 1G95A 3DJ4A 3JUKA 5FTSA 4P02A 2I7BA 4Y7VA 1FRWA 1VGTA 3EE5A 5C4DA 3ST8A 1ZI3A 1GQCA 4FRPA 1MP3A 2Z86A 2RJ6A 4UEGA 2RJ0A 1O23B 5JQQA 2QH5A 2BO4A 5CMHA 3V0NA 2VFZA 4B3UA 5IDTA 4FRQA 2XMEA 3FOQA 3ZGFA 1H5TA 2QGIA 4D11A 5AJOA 3SXCA 1VH1A 3ZGGA 1O7QA 4ZDQA 1GX4A 2RJ8A 3D8VA 4EEMA 4KC2A 3K8EA 1H5RA 1ZI4A 2VSIA 1E5KA 3ZLLA 3JTJA 5FUHA 4NALA 1ZCTA 5EJZA 4FRLA 2FFVA 3I0CA 3E25A 2O1FA 3U2XA 1QG8A 1FO9A 2Y6PA 1NMMB 2V0HA 2Y4KA 2BO8A 1G0RA 3T7MA 3I0EA 1V82A 3V8YA 3I0KA 5FYEA 1MC3A 2I5KA 4FRDA 5L6VA 4KC4A 2I5EA 1VH3A 4KC1A 3RMWA 1ZJPA 1HJLA 1K4VA 2YCMA 2YESA 1ZJ3A 4L41C 1VM8A 4R7PA 4Y7TA 5FTVA 4EE3A 4FIYA 1VGZA 2V0JA 2OI7A 2XWNA 2RJ4A 3R3IA 2VS4A 4B4MA 4B42A 1HM0A 4AAWA 2V0LA 1G1LA 1H5SA 1FGGA 1WT2A 1JYKA 1QWJA 3OH4A 1S4OA 5C3AA 5CMFX 1VGUA 2VS3A 1H5SD 2RJ9A 2Y4JA 4KPXA 2AM4A 4KNXA 1FXJA 1NF5B 3Q80A 3V0QA 2CU2A 4YS8A 3SXDA 3QVBA 3USRA 2WE9A 5FV9A 2OI5A 1H7TA 4HG6A 3I0IX 2WAWA 4Y9XA 1LZ7A 4HO8A 1FWYA 4FRMA 1R7VA 3F1CA 5D92A 4HO3A 3T7OA 2AESA 3T7NA 4JD0A 4D0ZA 2JCLA 2D7IA 3KIAA 2D7RA 1H7HA 2PGVA 1WT1A 1OMZA 5C1GA 2FFUA 4DECA 2AECA 2FYBA 2PA4A 5EIYA 1WT0A 3SXAA 4Q7CA 3SX8A 4LW6A 1I52A 3GUEA 1LL0A 2Y4MA 1W57A 3I0JA 1YROB 2GGOA 2XWLA 4HO4A 4D0TA 5C49A 4B4BA 2BO7A 1HJJA 3OAMA 2E8BA 2JCJA 1NHEB 4BMAA 2FYDB 3V90A 4CJCA 1FR8A 2P6WA 5C47A 5C3BA 1VZTA 4DDZA 1VZUA 1LZJA 2VXLA 1FR9A 4P00A 4KNRA 5FU8A 1WVCA 1QGQA 1YP4A 1ZJ2A 5CQMX 1ZIZA 3OH1A 1LVWA 1HV9A 4NANA 3SX7A 4NAIA 1VGWA 2OEFA 5EJ1A 2BO6A 1HM9A 2VSHA 4M2AA 1VPAA 4MNDA 5C4EA 3CKVA 1JYLA 2VD4A 4FRAA 3PNNA 1MP4A 3CU0A 1OQMB 5L6SA 1OMXA 3USQA 1ZDGA 2XMHA 3I0HA 4G87A 4Y6NA 4Y7FA 4Y7UA 5BXCA 4FRHA 1GX0A 1HM8A 2C0NA 3SPTA 2GGQA 3BCVA 1H5TB 1G9RA 2WVMA 4B5BA 4D48A 1PZTA 5CMJA 4HCQA 2JCKA 3U2VA 2OI6A 1WT3A 1H5RB 3I0GA 2AE7A 4KQLA 1TVYA 5HS2A 1ZDFA 5CMGX 4JISA 1GWWA 5DDVA 1EYRA 3V0PA 4DE7A 1R7XA 1H7EA 5C4BA 4Y63A 2AM5A 1R7YA 2ZU9A 4KPZA 2J0AA 5C4CA 4KT7A 4ASJA 4EVWA 4Y6UA 1TZFA 4Y62A 4Y64A 2RIXA 5C4FA 1FG5N 2ICYA 2RJ5A 1V83A 4Y7GA 1Z90A 1PZYB 1QGSA 3U2TA 1LZIA 4E1KA 4AYLA 3IOHA 2YQHA 2YQSA 4ARWA 2UX8A 1YP2A 3E26A 1H7QA 2Z87A 2JCOA 2RIZA 4M2BA 3CKNA 3TQDA 3TZTA 3ZF8A 3RSBA 3Q4SA 3FWWA 3V0MA 1ZHJA
chains in the Genus database with same CATH topology
1FGXA 3F1YA 3IOIA 1H4DA 1GQ9A 2P72A 1LZ0A 2RJ1A 1S4NA 3SXBA 4AYJA 1ZCYA 1ZJ1A 1NKHB 2AM3A 5IFYA 1R82A 2W0VA 3OH0A 1W77A 3I0LA 1NWGB 3U2UA 2WGZA 5C38A 4EEAA 4O6MA 1G23A 2O1GA 1SS9A 4HO6A 2QKXA 1H7LA 5CQPA 5DDTA 5IDSA 1O7OA 2Y7AA 3N9WA 4LW3A 1FO8A 1NQIB 2A8UA 1TW1A 4FIXA 1H3MA 3NGWA 4M4KA 4FREA 2O1HA 5FU0A 1LL3A 2RITA 4GBPA 5J49A 1G8OA 3LW6A 2OEGA 4J18A 1O0RA 1H4EA 4FCUA 1INIA 4AC3A 5D91A 4EEOA 1IINA 4B2WA 1XHBA 3D5NA 4NAKA 2XWMA 4CJBA 3V8ZA 4HO2A 2FYAA 4G3SA 5I1FA 1GWVA 2W0WA 3Q7UA 4KRVA 5CQNX 1INJA 2VS5A 1R80A 1R7UA 4O6NA 4IRQA 1ZJOA 4FROA 3D98A 4D11C 3DK5A 4CVHA 2X60A 2VXMA 3JUJA 4HO0A 2PX7A 1ZI5A 1H7FA 1G2VA 2YC5A 5C36A 5CQOA 4B4GA 4XWIA 3V0LA 1EZIA 2ZU7A 3CKOA 2AGDA 4G3QA 2MZBA 3CKQA 5CQLX 2D0JA 1XZ6A 3HL3A 1G93A 4M28A 1R81A 4G3PA 3SX5A 3U0XA 1ZJ0A 4KXOA 2ICXA 4ASYA 2X5ZA 2WEEA 4EEGA 5C1HA 3IOJA 1MP5A 1S4PA 3K8DA 2AH9A 4C2SA 5AJPA 2APCA 5CMIA 1FZWA 1ON6A 3SXGA 1WSZA 3ZLKA 4CJ8A 1H7GA 3OC9A 5C1LA 2Q4JA 3OKRA 1JV1A 4MIXA 1VICA 3DUVA 3CKJA 1YP3A 2ZU8A 5C48A 2VK9A 3OGZA 3SX3A 2A8WA 2V0KA 2NXVA 3POLA 1FOAA 1H4CA 3V91A 3U2WA 4HO5A 4HO9A 1H5SB 2FYCB 4IRPA 2YC3A 1H5SC 2RJ7A 2DPWA 3R2WA 4MYBA 1IIMA 3V0OA 5C3DA 3O3PA 1R7TA 3PKQA 4HOCA 1ZCVA 2J0BA 1TW5A 2V0IA 4FQWA 3RMVA 4BQHA 1FXOA 4ECMA 4B2XA 3PKPA 4FCEA 4FRBA 2Y4LA 4EE4A 1JV3A 1G97A 2YQCA 1W55A 2WVKA 1G3LA 1ZCUA 2RIYA 1JVDA 1GA8A 2X5SA 5AJNA 1V84A 2P73A 3CGXA 3U0YA 3I0FA 1LL2A 3SXEA 1VZXA 2PGYA 4K6RA 2E3DA 1ZI1A 2FY7A 3BRKX 3OH2A 1JVGA 3OH3A 2YQJA 1KWSA 1ON8A 5C8RA 4EE5A 3I0DA 2WVLA 2X65A 1G95A 3DJ4A 3JUKA 5FTSA 4P02A 2I7BA 4Y7VA 1FRWA 1VGTA 3EE5A 5C4DA 3ST8A 1ZI3A 1GQCA 4FRPA 1MP3A 2Z86A 2RJ6A 4UEGA 2RJ0A 1O23B 5JQQA 2QH5A 2BO4A 5CMHA 3V0NA 2VFZA 4B3UA 5IDTA 4FRQA 2XMEA 3FOQA 3ZGFA 1H5TA 2QGIA 4D11A 5AJOA 3SXCA 1VH1A 3ZGGA 1O7QA 4ZDQA 1GX4A 2RJ8A 3D8VA 4EEMA 4KC2A 3K8EA 1H5RA 1ZI4A 2VSIA 1E5KA 3ZLLA 3JTJA 5FUHA 4NALA 1ZCTA 5EJZA 4FRLA 2FFVA 3I0CA 3E25A 2O1FA 3U2XA 1QG8A 1FO9A 2Y6PA 1NMMB 2V0HA 2Y4KA 2BO8A 1G0RA 3T7MA 3I0EA 1V82A 3V8YA 3I0KA 5FYEA 1MC3A 2I5KA 4FRDA 5L6VA 4KC4A 2I5EA 1VH3A 4KC1A 3RMWA 1ZJPA 1HJLA 1K4VA 2YCMA 2YESA 1ZJ3A 4L41C 1VM8A 4R7PA 4Y7TA 5FTVA 4EE3A 4FIYA 1VGZA 2V0JA 2OI7A 2XWNA 2RJ4A 3R3IA 2VS4A 4B4MA 4B42A 1HM0A 4AAWA 2V0LA 1G1LA 1H5SA 1FGGA 1WT2A 1JYKA 1QWJA 3OH4A 1S4OA 5C3AA 5CMFX 1VGUA 2VS3A 1H5SD 2RJ9A 2Y4JA 4KPXA 2AM4A 4KNXA 1FXJA 1NF5B 3Q80A 3V0QA 2CU2A 4YS8A 3SXDA 3QVBA 3USRA 2WE9A 5FV9A 2OI5A 1H7TA 4HG6A 3I0IX 2WAWA 4Y9XA 1LZ7A 4HO8A 1FWYA 4FRMA 1R7VA 3F1CA 5D92A 4HO3A 3T7OA 2AESA 3T7NA 4JD0A 4D0ZA 2JCLA 2D7IA 3KIAA 2D7RA 1H7HA 2PGVA 1WT1A 1OMZA 5C1GA 2FFUA 4DECA 2AECA 2FYBA 2PA4A 5EIYA 1WT0A 3SXAA 4Q7CA 3SX8A 4LW6A 1I52A 3GUEA 1LL0A 2Y4MA 1W57A 3I0JA 1YROB 2GGOA 2XWLA 4HO4A 4D0TA 5C49A 4B4BA 2BO7A 1HJJA 3OAMA 2E8BA 2JCJA 1NHEB 4BMAA 2FYDB 3V90A 4CJCA 1FR8A 2P6WA 5C47A 5C3BA 1VZTA 4DDZA 1VZUA 1LZJA 2VXLA 1FR9A 4P00A 4KNRA 5FU8A 1WVCA 1QGQA 1YP4A 1ZJ2A 5CQMX 1ZIZA 3OH1A 1LVWA 1HV9A 4NANA 3SX7A 4NAIA 1VGWA 2OEFA 5EJ1A 2BO6A 1HM9A 2VSHA 4M2AA 1VPAA 4MNDA 5C4EA 3CKVA 1JYLA 2VD4A 4FRAA 3PNNA 1MP4A 3CU0A 1OQMB 5L6SA 1OMXA 3USQA 1ZDGA 2XMHA 3I0HA 4G87A 4Y6NA 4Y7FA 4Y7UA 5BXCA 4FRHA 1GX0A 1HM8A 2C0NA 3SPTA 2GGQA 3BCVA 1H5TB 1G9RA 2WVMA 4B5BA 4D48A 1PZTA 5CMJA 4HCQA 2JCKA 3U2VA 2OI6A 1WT3A 1H5RB 3I0GA 2AE7A 4KQLA 1TVYA 5HS2A 1ZDFA 5CMGX 4JISA 1GWWA 5DDVA 1EYRA 3V0PA 4DE7A 1R7XA 1H7EA 5C4BA 4Y63A 2AM5A 1R7YA 2ZU9A 4KPZA 2J0AA 5C4CA 4KT7A 4ASJA 4EVWA 4Y6UA 1TZFA 4Y62A 4Y64A 2RIXA 5C4FA 1FG5N 2ICYA 2RJ5A 1V83A 4Y7GA 1Z90A 1PZYB 1QGSA 3U2TA 1LZIA 4E1KA 4AYLA 3IOHA 2YQHA 2YQSA 4ARWA 2UX8A 1YP2A 3E26A 1H7QA 2Z87A 2JCOA 2RIZA 4M2BA 3CKNA 3TQDA 3TZTA 3ZF8A 3RSBA 3Q4SA 3FWWA 3V0MA 1ZHJA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1FGX A;  3F1Y A;  3IOI A;  1H4D A;  1GQ9 A;  2P72 A;  1LZ0 A;  2RJ1 A;  1S4N A;  3SXB A;  4AYJ A;  1ZCY A;  1ZJ1 A;  1NKH B;  2AM3 A;  5IFY A;  1R82 A;  2W0V A;  3OH0 A;  1W77 A;  3I0L A;  1NWG B;  3U2U A;  2WGZ A;  5C38 A;  4EEA A;  1G23 A;  2O1G A;  1SS9 A;  4HO6 A;  2QKX A;  1H7L A;  5CQP A;  5DDT A;  5IDS A;  1O7O A;  2Y7A A;  3N9W A;  4LW3 A;  1FO8 A;  1NQI B;  2A8U A;  1TW1 A;  1H3M A;  3NGW A;  4M4K A;  4FRE A;  2O1H A;  5FU0 A;  1LL3 A;  2RIT A;  4GBP A;  5J49 A;  1G8O A;  3LW6 A;  2OEG A;  4J18 A;  1O0R A;  1H4E A;  4FCU A;  1INI A;  4AC3 A;  4EEO A;  1IIN A;  4B2W A;  1XHB A;  3D5N A;  4NAK A;  2XWM A;  4CJB A;  3V8Z A;  4HO2 A;  2FYA A;  4G3S A;  5I1F A;  1GWV A;  2W0W A;  3Q7U A;  4KRV A;  5CQN X;  1INJ A;  2VS5 A;  1R80 A;  1R7U A;  4IRQ A;  1ZJO A;  4FRO A;  3D98 A;  4D11 C;  3DK5 A;  4CVH A;  2X60 A;  2VXM A;  3JUJ A;  4HO0 A;  2PX7 A;  1ZI5 A;  1H7F A;  1G2V A;  2YC5 A;  5C36 A;  5CQO A;  4B4G A;  4XWI A;  3V0L A;  1EZI A;  2ZU7 A;  3CKO A;  2AGD A;  4G3Q A;  2MZB A;  3CKQ A;  5CQL X;  2D0J A;  1XZ6 A;  3HL3 A;  1G93 A;  4M28 A;  1R81 A;  4G3P A;  3SX5 A;  3U0X A;  1ZJ0 A;  4KXO A;  2ICX A;  4ASY A;  2X5Z A;  2WEE A;  4EEG A;  5C1H A;  3IOJ A;  1MP5 A;  1S4P A;  3K8D A;  2AH9 A;  4C2S A;  5AJP A;  2APC A;  5CMI A;  1FZW A;  1ON6 A;  3SXG A;  1WSZ A;  3ZLK A;  4CJ8 A;  1H7G A;  3OC9 A;  5C1L A;  2Q4J A;  3OKR A;  1JV1 A;  1VIC A;  3DUV A;  3CKJ A;  1YP3 A;  2ZU8 A;  5C48 A;  3OGZ A;  3SX3 A;  2A8W A;  2V0K A;  2NXV A;  3POL A;  1FOA A;  1H4C A;  3V91 A;  3U2W A;  4HO5 A;  4HO9 A;  1H5S B;  2FYC B;  4IRP A;  2YC3 A;  1H5S C;  2RJ7 A;  2DPW A;  3R2W A;  4MYB A;  1IIM A;  3V0O A;  5C3D A;  3O3P A;  1R7T A;  3PKQ A;  4HOC A;  1ZCV A;  4FQW A;  1TW5 A;  2V0I A;  3RMV A;  4BQH A;  1FXO A;  4ECM A;  4B2X A;  3PKP A;  4FCE A;  4FRB A;  2Y4L A;  4EE4 A;  1JV3 A;  1G97 A;  2YQC A;  1W55 A;  2WVK A;  1G3L A;  1ZCU A;  2RIY A;  1JVD A;  1GA8 A;  2X5S A;  5AJN A;  1V84 A;  2P73 A;  3CGX A;  3U0Y A;  3I0F A;  1LL2 A;  3SXE A;  1VZX A;  2PGY A;  4K6R A;  2E3D A;  1ZI1 A;  2FY7 A;  3BRK X;  3OH2 A;  1JVG A;  3OH3 A;  2YQJ A;  1KWS A;  1ON8 A;  5C8R A;  4EE5 A;  3I0D A;  2WVL A;  2X65 A;  1G95 A;  3DJ4 A;  3JUK A;  5FTS A;  4P02 A;  2I7B A;  4Y7V A;  1FRW A;  1VGT A;  3EE5 A;  5C4D A;  3ST8 A;  1ZI3 A;  1GQC A;  4FRP A;  1MP3 A;  2Z86 A;  2RJ6 A;  4UEG A;  2RJ0 A;  1O23 B;  5JQQ A;  2QH5 A;  2BO4 A;  5CMH A;  3V0N A;  2VFZ A;  4B3U A;  5IDT A;  4FRQ A;  2XME A;  3FOQ A;  3ZGF A;  1H5T A;  2QGI A;  4D11 A;  5AJO A;  3SXC A;  1VH1 A;  3ZGG A;  1O7Q A;  4ZDQ A;  1GX4 A;  2RJ8 A;  3D8V A;  4EEM A;  4KC2 A;  3K8E A;  1H5R A;  1ZI4 A;  2VSI A;  1E5K A;  3ZLL A;  3JTJ A;  5FUH A;  4NAL A;  1ZCT A;  5EJZ A;  4FRL A;  2FFV A;  3I0C A;  3E25 A;  2O1F A;  3U2X A;  1QG8 A;  1FO9 A;  2Y6P A;  1NMM B;  2V0H A;  2Y4K A;  2BO8 A;  1G0R A;  3T7M A;  3I0E A;  1V82 A;  3V8Y A;  3I0K A;  5FYE A;  1MC3 A;  2I5K A;  4FRD A;  5L6V A;  4KC4 A;  2I5E A;  1VH3 A;  4KC1 A;  3RMW A;  1ZJP A;  1HJL A;  1K4V A;  2YCM A;  2YES A;  1ZJ3 A;  4L41 C;  1VM8 A;  4R7P A;  4Y7T A;  5FTV A;  4EE3 A;  1VGZ A;  2V0J A;  2OI7 A;  2XWN A;  2RJ4 A;  3R3I A;  2VS4 A;  4B4M A;  4B42 A;  1HM0 A;  4AAW A;  2V0L A;  1G1L A;  1H5S A;  1FGG A;  1WT2 A;  1JYK A;  1QWJ A;  3OH4 A;  1S4O A;  5C3A A;  5CMF X;  1VGU A;  2VS3 A;  1H5S D;  2RJ9 A;  2Y4J A;  4KPX A;  2AM4 A;  4KNX A;  1FXJ A;  1NF5 B;  3Q80 A;  3V0Q A;  2CU2 A;  4YS8 A;  3SXD A;  3QVB A;  3USR A;  2WE9 A;  5FV9 A;  2OI5 A;  1H7T A;  4HG6 A;  3I0I X;  2WAW A;  4Y9X A;  1LZ7 A;  4HO8 A;  1FWY A;  4FRM A;  1R7V A;  3F1C A;  4HO3 A;  3T7O A;  2AES A;  3T7N A;  4JD0 A;  4D0Z A;  2JCL A;  2D7I A;  3KIA A;  2D7R A;  1H7H A;  2PGV A;  1WT1 A;  1OMZ A;  5C1G A;  2FFU A;  4DEC A;  2AEC A;  2FYB A;  2PA4 A;  5EIY A;  1WT0 A;  3SXA A;  3SX8 A;  4LW6 A;  1I52 A;  3GUE A;  1LL0 A;  2Y4M A;  1W57 A;  3I0J A;  1YRO B;  2GGO A;  2XWL A;  4HO4 A;  4D0T A;  5C49 A;  4B4B A;  2BO7 A;  1HJJ A;  3OAM A;  2E8B A;  2JCJ A;  1NHE B;  4BMA A;  2FYD B;  3V90 A;  4CJC A;  1FR8 A;  2P6W A;  5C47 A;  5C3B A;  1VZT A;  4DDZ A;  1VZU A;  1LZJ A;  2VXL A;  1FR9 A;  4P00 A;  4KNR A;  5FU8 A;  1WVC A;  1QGQ A;  1YP4 A;  1ZJ2 A;  5CQM X;  1ZIZ A;  3OH1 A;  1LVW A;  1HV9 A;  4NAN A;  3SX7 A;  4NAI A;  1VGW A;  2OEF A;  5EJ1 A;  2BO6 A;  1HM9 A;  2VSH A;  4M2A A;  1VPA A;  4MND A;  5C4E A;  3CKV A;  1JYL A;  2VD4 A;  4FRA A;  3PNN A;  1MP4 A;  3CU0 A;  1OQM B;  5L6S A;  1OMX A;  3USQ A;  1ZDG A;  2XMH A;  3I0H A;  4G87 A;  4Y6N A;  4Y7F A;  4Y7U A;  5BXC A;  4FRH A;  1GX0 A;  1HM8 A;  3SPT A;  2GGQ A;  3BCV A;  1H5T B;  1G9R A;  2WVM A;  4B5B A;  4D48 A;  1PZT A;  5CMJ A;  4HCQ A;  2JCK A;  3U2V A;  2OI6 A;  1WT3 A;  1H5R B;  3I0G A;  2AE7 A;  4KQL A;  1TVY A;  5HS2 A;  1ZDF A;  5CMG X;  4JIS A;  1GWW A;  5DDV A;  1EYR A;  3V0P A;  4DE7 A;  1R7X A;  1H7E A;  5C4B A;  4Y63 A;  2AM5 A;  1R7Y A;  2ZU9 A;  4KPZ A;  5C4C A;  4KT7 A;  4ASJ A;  4EVW A;  4Y6U A;  1TZF A;  4Y62 A;  4Y64 A;  2RIX A;  5C4F A;  1FG5 N;  2ICY A;  2RJ5 A;  1V83 A;  4Y7G A;  1Z90 A;  1PZY B;  1QGS A;  3U2T A;  1LZI A;  4E1K A;  4AYL A;  3IOH A;  2YQH A;  2YQS A;  4ARW A;  2UX8 A;  1YP2 A;  3E26 A;  1H7Q A;  2Z87 A;  2JCO A;  2RIZ A;  4M2B A;  3CKN A;  3TQD A;  3TZT A;  3ZF8 A;  3RSB A;  3Q4S A;  3FWW A;  3V0M A;  1ZHJ A; 
#chains in the Genus database with same CATH topology
 1FGX A;  3F1Y A;  3IOI A;  1H4D A;  1GQ9 A;  2P72 A;  1LZ0 A;  2RJ1 A;  1S4N A;  3SXB A;  4AYJ A;  1ZCY A;  1ZJ1 A;  1NKH B;  2AM3 A;  5IFY A;  1R82 A;  2W0V A;  3OH0 A;  1W77 A;  3I0L A;  1NWG B;  3U2U A;  2WGZ A;  5C38 A;  4EEA A;  4O6M A;  1G23 A;  2O1G A;  1SS9 A;  4HO6 A;  2QKX A;  1H7L A;  5CQP A;  5DDT A;  5IDS A;  1O7O A;  2Y7A A;  3N9W A;  4LW3 A;  1FO8 A;  1NQI B;  2A8U A;  1TW1 A;  4FIX A;  1H3M A;  3NGW A;  4M4K A;  4FRE A;  2O1H A;  5FU0 A;  1LL3 A;  2RIT A;  4GBP A;  5J49 A;  1G8O A;  3LW6 A;  2OEG A;  4J18 A;  1O0R A;  1H4E A;  4FCU A;  1INI A;  4AC3 A;  5D91 A;  4EEO A;  1IIN A;  4B2W A;  1XHB A;  3D5N A;  4NAK A;  2XWM A;  4CJB A;  3V8Z A;  4HO2 A;  2FYA A;  4G3S A;  5I1F A;  1GWV A;  2W0W A;  3Q7U A;  4KRV A;  5CQN X;  1INJ A;  2VS5 A;  1R80 A;  1R7U A;  4O6N A;  4IRQ A;  1ZJO A;  4FRO A;  3D98 A;  4D11 C;  3DK5 A;  4CVH A;  2X60 A;  2VXM A;  3JUJ A;  4HO0 A;  2PX7 A;  1ZI5 A;  1H7F A;  1G2V A;  2YC5 A;  5C36 A;  5CQO A;  4B4G A;  4XWI A;  3V0L A;  1EZI A;  2ZU7 A;  3CKO A;  2AGD A;  4G3Q A;  2MZB A;  3CKQ A;  5CQL X;  2D0J A;  1XZ6 A;  3HL3 A;  1G93 A;  4M28 A;  1R81 A;  4G3P A;  3SX5 A;  3U0X A;  1ZJ0 A;  4KXO A;  2ICX A;  4ASY A;  2X5Z A;  2WEE A;  4EEG A;  5C1H A;  3IOJ A;  1MP5 A;  1S4P A;  3K8D A;  2AH9 A;  4C2S A;  5AJP A;  2APC A;  5CMI A;  1FZW A;  1ON6 A;  3SXG A;  1WSZ A;  3ZLK A;  4CJ8 A;  1H7G A;  3OC9 A;  5C1L A;  2Q4J A;  3OKR A;  1JV1 A;  4MIX A;  1VIC A;  3DUV A;  3CKJ A;  1YP3 A;  2ZU8 A;  5C48 A;  2VK9 A;  3OGZ A;  3SX3 A;  2A8W A;  2V0K A;  2NXV A;  3POL A;  1FOA A;  1H4C A;  3V91 A;  3U2W A;  4HO5 A;  4HO9 A;  1H5S B;  2FYC B;  4IRP A;  2YC3 A;  1H5S C;  2RJ7 A;  2DPW A;  3R2W A;  4MYB A;  1IIM A;  3V0O A;  5C3D A;  3O3P A;  1R7T A;  3PKQ A;  4HOC A;  1ZCV A;  2J0B A;  1TW5 A;  2V0I A;  4FQW A;  3RMV A;  4BQH A;  1FXO A;  4ECM A;  4B2X A;  3PKP A;  4FCE A;  4FRB A;  2Y4L A;  4EE4 A;  1JV3 A;  1G97 A;  2YQC A;  1W55 A;  2WVK A;  1G3L A;  1ZCU A;  2RIY A;  1JVD A;  1GA8 A;  2X5S A;  5AJN A;  1V84 A;  2P73 A;  3CGX A;  3U0Y A;  3I0F A;  1LL2 A;  3SXE A;  1VZX A;  2PGY A;  4K6R A;  2E3D A;  1ZI1 A;  2FY7 A;  3BRK X;  3OH2 A;  1JVG A;  3OH3 A;  2YQJ A;  1KWS A;  1ON8 A;  5C8R A;  4EE5 A;  3I0D A;  2WVL A;  2X65 A;  1G95 A;  3DJ4 A;  3JUK A;  5FTS A;  4P02 A;  2I7B A;  4Y7V A;  1FRW A;  1VGT A;  3EE5 A;  5C4D A;  3ST8 A;  1ZI3 A;  1GQC A;  4FRP A;  1MP3 A;  2Z86 A;  2RJ6 A;  4UEG A;  2RJ0 A;  1O23 B;  5JQQ A;  2QH5 A;  2BO4 A;  5CMH A;  3V0N A;  2VFZ A;  4B3U A;  5IDT A;  4FRQ A;  2XME A;  3FOQ A;  3ZGF A;  1H5T A;  2QGI A;  4D11 A;  5AJO A;  3SXC A;  1VH1 A;  3ZGG A;  1O7Q A;  4ZDQ A;  1GX4 A;  2RJ8 A;  3D8V A;  4EEM A;  4KC2 A;  3K8E A;  1H5R A;  1ZI4 A;  2VSI A;  1E5K A;  3ZLL A;  3JTJ A;  5FUH A;  4NAL A;  1ZCT A;  5EJZ A;  4FRL A;  2FFV A;  3I0C A;  3E25 A;  2O1F A;  3U2X A;  1QG8 A;  1FO9 A;  2Y6P A;  1NMM B;  2V0H A;  2Y4K A;  2BO8 A;  1G0R A;  3T7M A;  3I0E A;  1V82 A;  3V8Y A;  3I0K A;  5FYE A;  1MC3 A;  2I5K A;  4FRD A;  5L6V A;  4KC4 A;  2I5E A;  1VH3 A;  4KC1 A;  3RMW A;  1ZJP A;  1HJL A;  1K4V A;  2YCM A;  2YES A;  1ZJ3 A;  4L41 C;  1VM8 A;  4R7P A;  4Y7T A;  5FTV A;  4EE3 A;  4FIY A;  1VGZ A;  2V0J A;  2OI7 A;  2XWN A;  2RJ4 A;  3R3I A;  2VS4 A;  4B4M A;  4B42 A;  1HM0 A;  4AAW A;  2V0L A;  1G1L A;  1H5S A;  1FGG A;  1WT2 A;  1JYK A;  1QWJ A;  3OH4 A;  1S4O A;  5C3A A;  5CMF X;  1VGU A;  2VS3 A;  1H5S D;  2RJ9 A;  2Y4J A;  4KPX A;  2AM4 A;  4KNX A;  1FXJ A;  1NF5 B;  3Q80 A;  3V0Q A;  2CU2 A;  4YS8 A;  3SXD A;  3QVB A;  3USR A;  2WE9 A;  5FV9 A;  2OI5 A;  1H7T A;  4HG6 A;  3I0I X;  2WAW A;  4Y9X A;  1LZ7 A;  4HO8 A;  1FWY A;  4FRM A;  1R7V A;  3F1C A;  5D92 A;  4HO3 A;  3T7O A;  2AES A;  3T7N A;  4JD0 A;  4D0Z A;  2JCL A;  2D7I A;  3KIA A;  2D7R A;  1H7H A;  2PGV A;  1WT1 A;  1OMZ A;  5C1G A;  2FFU A;  4DEC A;  2AEC A;  2FYB A;  2PA4 A;  5EIY A;  1WT0 A;  3SXA A;  4Q7C A;  3SX8 A;  4LW6 A;  1I52 A;  3GUE A;  1LL0 A;  2Y4M A;  1W57 A;  3I0J A;  1YRO B;  2GGO A;  2XWL A;  4HO4 A;  4D0T A;  5C49 A;  4B4B A;  2BO7 A;  1HJJ A;  3OAM A;  2E8B A;  2JCJ A;  1NHE B;  4BMA A;  2FYD B;  3V90 A;  4CJC A;  1FR8 A;  2P6W A;  5C47 A;  5C3B A;  1VZT A;  4DDZ A;  1VZU A;  1LZJ A;  2VXL A;  1FR9 A;  4P00 A;  4KNR A;  5FU8 A;  1WVC A;  1QGQ A;  1YP4 A;  1ZJ2 A;  5CQM X;  1ZIZ A;  3OH1 A;  1LVW A;  1HV9 A;  4NAN A;  3SX7 A;  4NAI A;  1VGW A;  2OEF A;  5EJ1 A;  2BO6 A;  1HM9 A;  2VSH A;  4M2A A;  1VPA A;  4MND A;  5C4E A;  3CKV A;  1JYL A;  2VD4 A;  4FRA A;  3PNN A;  1MP4 A;  3CU0 A;  1OQM B;  5L6S A;  1OMX A;  3USQ A;  1ZDG A;  2XMH A;  3I0H A;  4G87 A;  4Y6N A;  4Y7F A;  4Y7U A;  5BXC A;  4FRH A;  1GX0 A;  1HM8 A;  2C0N A;  3SPT A;  2GGQ A;  3BCV A;  1H5T B;  1G9R A;  2WVM A;  4B5B A;  4D48 A;  1PZT A;  5CMJ A;  4HCQ A;  2JCK A;  3U2V A;  2OI6 A;  1WT3 A;  1H5R B;  3I0G A;  2AE7 A;  4KQL A;  1TVY A;  5HS2 A;  1ZDF A;  5CMG X;  4JIS A;  1GWW A;  5DDV A;  1EYR A;  3V0P A;  4DE7 A;  1R7X A;  1H7E A;  5C4B A;  4Y63 A;  2AM5 A;  1R7Y A;  2ZU9 A;  4KPZ A;  2J0A A;  5C4C A;  4KT7 A;  4ASJ A;  4EVW A;  4Y6U A;  1TZF A;  4Y62 A;  4Y64 A;  2RIX A;  5C4F A;  1FG5 N;  2ICY A;  2RJ5 A;  1V83 A;  4Y7G A;  1Z90 A;  1PZY B;  1QGS A;  3U2T A;  1LZI A;  4E1K A;  4AYL A;  3IOH A;  2YQH A;  2YQS A;  4ARW A;  2UX8 A;  1YP2 A;  3E26 A;  1H7Q A;  2Z87 A;  2JCO A;  2RIZ A;  4M2B A;  3CKN A;  3TQD A;  3TZT A;  3ZF8 A;  3RSB A;  3Q4S A;  3FWW A;  3V0M A;  1ZHJ A; 
#chains in the Genus database with same CATH homology
 1FGX A;  3F1Y A;  3IOI A;  1H4D A;  1GQ9 A;  2P72 A;  1LZ0 A;  2RJ1 A;  1S4N A;  3SXB A;  4AYJ A;  1ZCY A;  1ZJ1 A;  1NKH B;  2AM3 A;  5IFY A;  1R82 A;  2W0V A;  3OH0 A;  1W77 A;  3I0L A;  1NWG B;  3U2U A;  2WGZ A;  5C38 A;  4EEA A;  4O6M A;  1G23 A;  2O1G A;  1SS9 A;  4HO6 A;  2QKX A;  1H7L A;  5CQP A;  5DDT A;  5IDS A;  1O7O A;  2Y7A A;  3N9W A;  4LW3 A;  1FO8 A;  1NQI B;  2A8U A;  1TW1 A;  4FIX A;  1H3M A;  3NGW A;  4M4K A;  4FRE A;  2O1H A;  5FU0 A;  1LL3 A;  2RIT A;  4GBP A;  5J49 A;  1G8O A;  3LW6 A;  2OEG A;  4J18 A;  1O0R A;  1H4E A;  4FCU A;  1INI A;  4AC3 A;  5D91 A;  4EEO A;  1IIN A;  4B2W A;  1XHB A;  3D5N A;  4NAK A;  2XWM A;  4CJB A;  3V8Z A;  4HO2 A;  2FYA A;  4G3S A;  5I1F A;  1GWV A;  2W0W A;  3Q7U A;  4KRV A;  5CQN X;  1INJ A;  2VS5 A;  1R80 A;  1R7U A;  4O6N A;  4IRQ A;  1ZJO A;  4FRO A;  3D98 A;  4D11 C;  3DK5 A;  4CVH A;  2X60 A;  2VXM A;  3JUJ A;  4HO0 A;  2PX7 A;  1ZI5 A;  1H7F A;  1G2V A;  2YC5 A;  5C36 A;  5CQO A;  4B4G A;  4XWI A;  3V0L A;  1EZI A;  2ZU7 A;  3CKO A;  2AGD A;  4G3Q A;  2MZB A;  3CKQ A;  5CQL X;  2D0J A;  1XZ6 A;  3HL3 A;  1G93 A;  4M28 A;  1R81 A;  4G3P A;  3SX5 A;  3U0X A;  1ZJ0 A;  4KXO A;  2ICX A;  4ASY A;  2X5Z A;  2WEE A;  4EEG A;  5C1H A;  3IOJ A;  1MP5 A;  1S4P A;  3K8D A;  2AH9 A;  4C2S A;  5AJP A;  2APC A;  5CMI A;  1FZW A;  1ON6 A;  3SXG A;  1WSZ A;  3ZLK A;  4CJ8 A;  1H7G A;  3OC9 A;  5C1L A;  2Q4J A;  3OKR A;  1JV1 A;  4MIX A;  1VIC A;  3DUV A;  3CKJ A;  1YP3 A;  2ZU8 A;  5C48 A;  2VK9 A;  3OGZ A;  3SX3 A;  2A8W A;  2V0K A;  2NXV A;  3POL A;  1FOA A;  1H4C A;  3V91 A;  3U2W A;  4HO5 A;  4HO9 A;  1H5S B;  2FYC B;  4IRP A;  2YC3 A;  1H5S C;  2RJ7 A;  2DPW A;  3R2W A;  4MYB A;  1IIM A;  3V0O A;  5C3D A;  3O3P A;  1R7T A;  3PKQ A;  4HOC A;  1ZCV A;  2J0B A;  1TW5 A;  2V0I A;  4FQW A;  3RMV A;  4BQH A;  1FXO A;  4ECM A;  4B2X A;  3PKP A;  4FCE A;  4FRB A;  2Y4L A;  4EE4 A;  1JV3 A;  1G97 A;  2YQC A;  1W55 A;  2WVK A;  1G3L A;  1ZCU A;  2RIY A;  1JVD A;  1GA8 A;  2X5S A;  5AJN A;  1V84 A;  2P73 A;  3CGX A;  3U0Y A;  3I0F A;  1LL2 A;  3SXE A;  1VZX A;  2PGY A;  4K6R A;  2E3D A;  1ZI1 A;  2FY7 A;  3BRK X;  3OH2 A;  1JVG A;  3OH3 A;  2YQJ A;  1KWS A;  1ON8 A;  5C8R A;  4EE5 A;  3I0D A;  2WVL A;  2X65 A;  1G95 A;  3DJ4 A;  3JUK A;  5FTS A;  4P02 A;  2I7B A;  4Y7V A;  1FRW A;  1VGT A;  3EE5 A;  5C4D A;  3ST8 A;  1ZI3 A;  1GQC A;  4FRP A;  1MP3 A;  2Z86 A;  2RJ6 A;  4UEG A;  2RJ0 A;  1O23 B;  5JQQ A;  2QH5 A;  2BO4 A;  5CMH A;  3V0N A;  2VFZ A;  4B3U A;  5IDT A;  4FRQ A;  2XME A;  3FOQ A;  3ZGF A;  1H5T A;  2QGI A;  4D11 A;  5AJO A;  3SXC A;  1VH1 A;  3ZGG A;  1O7Q A;  4ZDQ A;  1GX4 A;  2RJ8 A;  3D8V A;  4EEM A;  4KC2 A;  3K8E A;  1H5R A;  1ZI4 A;  2VSI A;  1E5K A;  3ZLL A;  3JTJ A;  5FUH A;  4NAL A;  1ZCT A;  5EJZ A;  4FRL A;  2FFV A;  3I0C A;  3E25 A;  2O1F A;  3U2X A;  1QG8 A;  1FO9 A;  2Y6P A;  1NMM B;  2V0H A;  2Y4K A;  2BO8 A;  1G0R A;  3T7M A;  3I0E A;  1V82 A;  3V8Y A;  3I0K A;  5FYE A;  1MC3 A;  2I5K A;  4FRD A;  5L6V A;  4KC4 A;  2I5E A;  1VH3 A;  4KC1 A;  3RMW A;  1ZJP A;  1HJL A;  1K4V A;  2YCM A;  2YES A;  1ZJ3 A;  4L41 C;  1VM8 A;  4R7P A;  4Y7T A;  5FTV A;  4EE3 A;  4FIY A;  1VGZ A;  2V0J A;  2OI7 A;  2XWN A;  2RJ4 A;  3R3I A;  2VS4 A;  4B4M A;  4B42 A;  1HM0 A;  4AAW A;  2V0L A;  1G1L A;  1H5S A;  1FGG A;  1WT2 A;  1JYK A;  1QWJ A;  3OH4 A;  1S4O A;  5C3A A;  5CMF X;  1VGU A;  2VS3 A;  1H5S D;  2RJ9 A;  2Y4J A;  4KPX A;  2AM4 A;  4KNX A;  1FXJ A;  1NF5 B;  3Q80 A;  3V0Q A;  2CU2 A;  4YS8 A;  3SXD A;  3QVB A;  3USR A;  2WE9 A;  5FV9 A;  2OI5 A;  1H7T A;  4HG6 A;  3I0I X;  2WAW A;  4Y9X A;  1LZ7 A;  4HO8 A;  1FWY A;  4FRM A;  1R7V A;  3F1C A;  5D92 A;  4HO3 A;  3T7O A;  2AES A;  3T7N A;  4JD0 A;  4D0Z A;  2JCL A;  2D7I A;  3KIA A;  2D7R A;  1H7H A;  2PGV A;  1WT1 A;  1OMZ A;  5C1G A;  2FFU A;  4DEC A;  2AEC A;  2FYB A;  2PA4 A;  5EIY A;  1WT0 A;  3SXA A;  4Q7C A;  3SX8 A;  4LW6 A;  1I52 A;  3GUE A;  1LL0 A;  2Y4M A;  1W57 A;  3I0J A;  1YRO B;  2GGO A;  2XWL A;  4HO4 A;  4D0T A;  5C49 A;  4B4B A;  2BO7 A;  1HJJ A;  3OAM A;  2E8B A;  2JCJ A;  1NHE B;  4BMA A;  2FYD B;  3V90 A;  4CJC A;  1FR8 A;  2P6W A;  5C47 A;  5C3B A;  1VZT A;  4DDZ A;  1VZU A;  1LZJ A;  2VXL A;  1FR9 A;  4P00 A;  4KNR A;  5FU8 A;  1WVC A;  1QGQ A;  1YP4 A;  1ZJ2 A;  5CQM X;  1ZIZ A;  3OH1 A;  1LVW A;  1HV9 A;  4NAN A;  3SX7 A;  4NAI A;  1VGW A;  2OEF A;  5EJ1 A;  2BO6 A;  1HM9 A;  2VSH A;  4M2A A;  1VPA A;  4MND A;  5C4E A;  3CKV A;  1JYL A;  2VD4 A;  4FRA A;  3PNN A;  1MP4 A;  3CU0 A;  1OQM B;  5L6S A;  1OMX A;  3USQ A;  1ZDG A;  2XMH A;  3I0H A;  4G87 A;  4Y6N A;  4Y7F A;  4Y7U A;  5BXC A;  4FRH A;  1GX0 A;  1HM8 A;  2C0N A;  3SPT A;  2GGQ A;  3BCV A;  1H5T B;  1G9R A;  2WVM A;  4B5B A;  4D48 A;  1PZT A;  5CMJ A;  4HCQ A;  2JCK A;  3U2V A;  2OI6 A;  1WT3 A;  1H5R B;  3I0G A;  2AE7 A;  4KQL A;  1TVY A;  5HS2 A;  1ZDF A;  5CMG X;  4JIS A;  1GWW A;  5DDV A;  1EYR A;  3V0P A;  4DE7 A;  1R7X A;  1H7E A;  5C4B A;  4Y63 A;  2AM5 A;  1R7Y A;  2ZU9 A;  4KPZ A;  2J0A A;  5C4C A;  4KT7 A;  4ASJ A;  4EVW A;  4Y6U A;  1TZF A;  4Y62 A;  4Y64 A;  2RIX A;  5C4F A;  1FG5 N;  2ICY A;  2RJ5 A;  1V83 A;  4Y7G A;  1Z90 A;  1PZY B;  1QGS A;  3U2T A;  1LZI A;  4E1K A;  4AYL A;  3IOH A;  2YQH A;  2YQS A;  4ARW A;  2UX8 A;  1YP2 A;  3E26 A;  1H7Q A;  2Z87 A;  2JCO A;  2RIZ A;  4M2B A;  3CKN A;  3TQD A;  3TZT A;  3ZF8 A;  3RSB A;  3Q4S A;  3FWW A;  3V0M A;  1ZHJ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...