4FROA

Crystal structure of bbbb+udp+gal at ph 9.0 with mpd as the cryoprotectant
Total Genus 79
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
79
sequence length
278
structure length
276
Chain Sequence
MVYPQPKVLTPCRKDVLVVTPWLAPIVWEGTFNIDILNEQFRLQNTTIGLTVFAIKKYVAFLKLFLETAEKHFMVGHRVHYYVFTDQPAAVPRVTLGTGRQLSVLEVGAYKRWQDVSMRRMEMISCERRFLSEVDYLVCVDVDMEFRDHVGVEILTPLFGTLHPSFYGSSREAFTYERRPQSQAYIPKDEGDFYYMGAFFGGSVQEVQRLTRACHQAMMVDQANGIEAVWHDESHLNKYLLRHKPTKVLSPEYLWDQQLLGWPAVLRKLRFTAVPK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Histo-blood group ABO system transferase
publication title pH-induced conformational changes in human ABO(H) blood group glycosyltransferases confirm the importance of electrostatic interactions in the formation of the semi-closed state.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 79
structure length 276
sequence length 278
ec nomenclature ec 2.4.1.37: Fucosylgalactoside 3-alpha-galactosyltransferase.
pdb deposition date 2012-06-26
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.550.10 Alpha Beta Alpha-Beta Complex Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A 4froA00
3F1YA 4D0TA 3JUKA 4Y6UA 1JV3A 3U0YA 2RIZA 3KIAA 4B4GA 3CKOA 3T7MA 3HL3A 1FOAA 4HO3A 3OH0A 2FYCB 2V0LA 2AM3A 4Y6NA 1ZJOA 1TZFA 1O7QA 4DE7A 4AYJA 1VGZA 1GX0A 2AH9A 1HM8A 4Y64A 1JV1A 3V0OA 2RIYA 4B2WA 4BMAA 3SX5A 3U2TA 2XWLA 3T7NA 2RIXA 4EE5A 3PKQA 4NAKA 3V0LA 3V90A 4UEGA 1JVGA 1NF5B 3V0NA 5CQPA 1H7QA 5EIYA 2JCLA 1FWYA 3SXDA 4M2BA 1ZIZA 1MP4A 4DDZA 2X60A 3FOQA 5IDSA 1G9RA 2FFVA 1ZI3A 3SPTA 4KNRA 1QWJA 3OH1A 2I5KA 4G3SA 2JCOA 3CU0A 2Q4JA 3IOHA 1R7UA 1OQMB 1R81A 4ARWA 3U2XA 4AC3A 2E3DA 2VFZA 4EEOA 5AJPA 1HJJA 2JCJA 2Y7AA 1ZDFA 2Y4MA 2XWMA 1FGXA 4FRHA 1XHBA 1ZDGA 2I7BA 1GWVA 4MNDA 3V0MA 2YC3A 3PNNA 4AYLA 1ZJ1A 4EEGA 3E25A 3I0GA 2RJ4A 3ST8A 2VS4A 5C1GA 4Y7UA 1WVCA 3V91A 5CQMX 3SXEA 4YS8A 4HG6A 1LZIA 1H5RB 2BO6A 4HO4A 1H7LA 3T7OA 2Y4LA 1G95A 2V0IA 1FXJA 2YESA 4HO6A 3GUEA 5CQNX 2OEFA 2MZBA 1OMZA 2YQJA 5AJOA 5FV9A 1V82A 2VS3A 3V8YA 3ZLLA 1H5TB 1ZCTA 2VS5A 1GWWA 4B2XA 3ZLKA 3I0EA 3BRKX 1GQCA 1NHEB 3OAMA 2A8WA 1H4DA 1H5SC 2E8BA 4EE3A 1ZI5A 3SXGA 5C48A 5JQQA 1GX4A 4Y62A 1TW1A 4D11C 1G97A 5FU0A 1WT2A 1WT3A 3CKVA 5CMHA 1JYKA 4M28A 1NKHB 1VZXA 4NALA 4ECMA 3QVBA 4D11A 5C3AA 1XZ6A 4HO2A 1OMXA 1MC3A 3SXCA 3FWWA 1WT1A 4M4KA 1NQIB 5C3DA 1PZTA 1ZCVA 1ZHJA 3USRA 2WE9A 2ICXA 2XMEA 1HM0A 4K6RA 2ZU7A 3SXBA 1WSZA 4Y7VA 2GGOA 2P72A 1W55A 2Z86A 1S4PA 1INJA 3OH4A 5I1FA 5CMGX 4FRDA 3V8ZA 3OH2A 1H7EA 2V0HA 2RJ1A 2X5SA 4HO5A 5C38A 3I0DA 4LW3A 2FFUA 1INIA 2W0VA 4KQLA 1TW5A 2VXMA 4G87A 2O1FA 4C2SA 1H3MA 1TVYA 1H7GA 4JISA 2JCKA 1O0RA 3I0CA 3CKQA 1HV9A 4HCQA 4XWIA 4EE4A 4J18A 5FYEA 3U2VA 3U2WA 1QGSA 2QGIA 5C4BA 1VH1A 2WVMA 1VZTA 3POLA 4KXOA 4KT7A 4FRAA 1FO8A 2YQSA 1ZJ0A 4FREA 2OI7A 2AECA 4LW6A 1IINA 2AM4A 4EVWA 2V0JA 3U2UA 4ASJA 5EJ1A 4FQWA 2XMHA 2I5EA 5C1LA 2P73A 3R3IA 1GA8A 4KC1A 3RMWA 1O23B 1LL0A 1G8OA 3BCVA 2YQCA 5C47A 5L6VA 4DECA 1FR9A 4KC4A 1R7VA 2P6WA 3PKPA 1ON8A 4FCUA 3DUVA 3ZGGA 2YCMA 4B4BA 3ZGFA 1VPAA 3F1CA 4EEMA 2WEEA 5FTSA 2RJ0A 3OKRA 3O3PA 1S4OA 4M2AA 5L6SA 1O7OA 3I0HA 3Q80A 4P00A 1JVDA 1VGWA 2VSIA 1ZJ2A 2X65A 1YROB 4BQHA 3LW6A 3JUJA 2D0JA 2AE7A 4E1KA 1R80A 3NGWA 4FRMA 1QG8A 3R2WA 2XWNA 2ZU8A 1MP5A 1VZUA 2BO4A 4B3UA 4KPXA 1H5SA 5DDVA 4IRPA 3ZF8A 4KNXA 2A8UA 5IFYA 3K8DA 1G2VA 1KWSA 1YP4A 2YC5A 3Q4SA 4NANA 4CJ8A 2Y4JA 1VM8A 4P02A 3DJ4A 3CGXA 4FROA 4FRPA 1VICA 1R7YA 1I52A 4Y7GA 2W0WA 4Y63A 2WAWA 1K4VA 1GQ9A 4B5BA 1ZCUA 4D0ZA 2D7IA 2GGQA 1IIMA 5FU8A 5DDTA 5HS2A 3N9WA 2FYDB 1H7TA 1LVWA 4KPZA 3TQDA 4KRVA 4FCEA 4FRLA 2PX7A 2BO8A 3I0IX 1PZYB 4G3QA 1EYRA 1G1LA 2CU2A 1H7HA 2UX8A 3D98A 2YQHA 2RJ8A 3CKJA 3CKNA 1R82A 4CJCA 4B4MA 1LL3A 3E26A 2PGVA 5CMFX 2APCA 2VXLA 1FO9A 1WT0A 3RMVA 4FRBA 3DK5A 5CQOA 1V84A 2AESA 4NAIA 4L41C 3V0QA 5C4CA 3SX3A 1LZ7A 4JD0A 3OGZA 5C8RA 3SX7A 4B42A 3JTJA 5CMJA 1ON6A 1FZWA 2FYBA 2PA4A 3RSBA 1H4EA 2WVKA 1FR8A 1ZJ3A 4HOCA 1H5SD 1VGTA 4ZDQA 5C49A 1ZI1A 2RJ9A 5FUHA 2AGDA 5C3BA 1G93A 1YP3A 2ZU9A 1LZ0A 5C1HA 3TZTA 4IRQA 1W77A 2VD4A 2OI5A 2QH5A 1FRWA 2WGZA 1VGUA 5C4FA 1YP2A 1LZJA 1ZJPA 4R7PA 3OH3A 3I0LA 4FRQA 1LL2A 1H5RA 2OEGA 2DPWA 2V0KA 1G3LA 3D8VA 4KC2A 2PGYA 2QKXA 3I0FA 1NWGB 4MYBA 2ICYA 1EZIA 2OI6A 4CVHA 1H5TA 1V83A 5C4EA 3V0PA 4ASYA 1NMMB 5CQLX 1QGQA 2Y6PA 2WVLA 4Y9XA 2RITA 1FGGA 2O1GA 3USQA 1ZCYA 1G0RA 1E5KA 4HO9A 3OC9A 2RJ6A 1Z90A 1R7XA 1H7FA 4D48A 1SS9A 3SX8A 3IOIA 3D5NA 2X5ZA 1FXOA 1HM9A 5EJZA 4EEAA 5FTVA 4AAWA 1H4CA 1W57A 2FYAA 1VH3A 1FG5N 2Y4KA 5C4DA 1HJLA 4HO8A 2O1HA 1S4NA 3EE5A 5IDTA 1G23A 1JYLA 4GBPA 5J49A 4Y7TA 4Y7FA 2RJ5A 1ZI4A 2BO7A 5CMIA 1MP3A 3IOJA 5AJNA 3I0JA 5BXCA 2D7RA 3I0KA 3U0XA 2NXVA 3SXAA 1H5SB 3Q7UA 2Z87A 1R7TA 4HO0A 2FY7A 2AM5A 4CJBA 4G3PA 5C36A 2RJ7A 2VSHA 3K8EA
chains in the Genus database with same CATH superfamily
3F1YA 4D0TA 3JUKA 4Y6UA 1JV3A 3U0YA 2RIZA 3KIAA 4B4GA 3CKOA 3T7MA 3HL3A 1FOAA 4HO3A 3OH0A 2FYCB 2V0LA 2AM3A 4Y6NA 1ZJOA 1TZFA 1O7QA 4DE7A 4AYJA 1VGZA 1GX0A 2AH9A 1HM8A 4Y64A 1JV1A 3V0OA 2RIYA 4B2WA 4BMAA 3SX5A 3U2TA 2XWLA 3T7NA 2RIXA 4EE5A 3PKQA 2J0BA 4NAKA 3V0LA 3V90A 4UEGA 1JVGA 1NF5B 3V0NA 5CQPA 1H7QA 5EIYA 2JCLA 1FWYA 3SXDA 4M2BA 1ZIZA 1MP4A 4DDZA 2X60A 3FOQA 5IDSA 1G9RA 2FFVA 1ZI3A 3SPTA 4KNRA 1QWJA 3OH1A 5D91A 2I5KA 4G3SA 2JCOA 3CU0A 2Q4JA 3IOHA 1R7UA 1OQMB 1R81A 4ARWA 3U2XA 4AC3A 2E3DA 2VFZA 4EEOA 5AJPA 1HJJA 2JCJA 2Y7AA 1ZDFA 2Y4MA 2XWMA 1FGXA 4FRHA 1XHBA 1ZDGA 2I7BA 1GWVA 4MNDA 3V0MA 2YC3A 3PNNA 4FIYA 4AYLA 1ZJ1A 4EEGA 3E25A 3I0GA 2RJ4A 3ST8A 2VS4A 5C1GA 4Y7UA 1WVCA 3V91A 5CQMX 3SXEA 4YS8A 4HG6A 1LZIA 1H5RB 2BO6A 4HO4A 1H7LA 3T7OA 2Y4LA 1G95A 2V0IA 1FXJA 2YESA 4HO6A 3GUEA 5CQNX 2OEFA 2MZBA 1OMZA 2YQJA 5AJOA 5FV9A 1V82A 2VS3A 3V8YA 3ZLLA 1H5TB 1ZCTA 2VS5A 1GWWA 4B2XA 3ZLKA 3I0EA 3BRKX 1GQCA 1NHEB 3OAMA 2A8WA 1H4DA 1H5SC 2E8BA 4EE3A 1ZI5A 3SXGA 2J0AA 5C48A 5JQQA 1GX4A 4Y62A 1TW1A 4D11C 1G97A 5FU0A 1WT2A 1WT3A 3CKVA 5CMHA 1JYKA 4M28A 1NKHB 1VZXA 4NALA 4ECMA 3QVBA 4D11A 5C3AA 1XZ6A 4HO2A 1OMXA 1MC3A 3SXCA 3FWWA 1WT1A 4M4KA 1NQIB 5C3DA 1PZTA 1ZCVA 1ZHJA 3USRA 2WE9A 2ICXA 2XMEA 1HM0A 4K6RA 2ZU7A 3SXBA 1WSZA 4Y7VA 2GGOA 2P72A 1W55A 2Z86A 1S4PA 1INJA 3OH4A 5I1FA 5CMGX 4FRDA 3V8ZA 3OH2A 1H7EA 2V0HA 2RJ1A 2X5SA 4HO5A 5C38A 3I0DA 4LW3A 2FFUA 1INIA 2W0VA 4KQLA 1TW5A 2VXMA 4G87A 2O1FA 4C2SA 1H3MA 1TVYA 1H7GA 4JISA 2JCKA 5D92A 1O0RA 3I0CA 4MIXA 3CKQA 1HV9A 4HCQA 4XWIA 4EE4A 4J18A 5FYEA 3U2VA 3U2WA 1QGSA 2QGIA 5C4BA 1VH1A 2WVMA 1VZTA 3POLA 4KXOA 4KT7A 4FRAA 1FO8A 2YQSA 1ZJ0A 4FREA 2C0NA 2OI7A 2AECA 4LW6A 1IINA 2AM4A 4EVWA 2V0JA 3U2UA 4ASJA 5EJ1A 4FQWA 2XMHA 2I5EA 5C1LA 2P73A 3R3IA 1GA8A 4KC1A 3RMWA 1O23B 1LL0A 1G8OA 3BCVA 2YQCA 5C47A 5L6VA 4DECA 1FR9A 4KC4A 1R7VA 2P6WA 3PKPA 1ON8A 4FCUA 3DUVA 3ZGGA 2YCMA 4B4BA 3ZGFA 1VPAA 3F1CA 4EEMA 2WEEA 5FTSA 2RJ0A 3OKRA 3O3PA 1S4OA 4M2AA 5L6SA 1O7OA 3I0HA 3Q80A 4P00A 1JVDA 1VGWA 2VSIA 1ZJ2A 2X65A 1YROB 4BQHA 3LW6A 3JUJA 4FIXA 2D0JA 2AE7A 4E1KA 1R80A 3NGWA 4FRMA 1QG8A 3R2WA 2XWNA 2ZU8A 1MP5A 1VZUA 2BO4A 4B3UA 4KPXA 1H5SA 5DDVA 4IRPA 3ZF8A 4KNXA 2A8UA 5IFYA 3K8DA 1G2VA 1KWSA 1YP4A 2YC5A 3Q4SA 4NANA 4CJ8A 2Y4JA 1VM8A 4P02A 3DJ4A 3CGXA 4FROA 4FRPA 4O6MA 1VICA 1R7YA 1I52A 4Y7GA 2W0WA 4Y63A 2WAWA 1K4VA 1GQ9A 4B5BA 1ZCUA 4D0ZA 2D7IA 2GGQA 1IIMA 5FU8A 5DDTA 5HS2A 3N9WA 2FYDB 1H7TA 1LVWA 4KPZA 3TQDA 4KRVA 4FCEA 4FRLA 2PX7A 2BO8A 3I0IX 1PZYB 4G3QA 1EYRA 1G1LA 2CU2A 1H7HA 2UX8A 3D98A 2YQHA 2RJ8A 3CKJA 3CKNA 1R82A 4CJCA 4B4MA 1LL3A 3E26A 2PGVA 5CMFX 2APCA 2VXLA 2VK9A 1FO9A 1WT0A 3RMVA 4FRBA 3DK5A 5CQOA 1V84A 2AESA 4NAIA 4L41C 3V0QA 5C4CA 3SX3A 4Q7CA 1LZ7A 4JD0A 3OGZA 5C8RA 3SX7A 4B42A 3JTJA 5CMJA 1ON6A 1FZWA 2FYBA 2PA4A 3RSBA 1H4EA 2WVKA 1FR8A 1ZJ3A 4HOCA 1H5SD 1VGTA 4ZDQA 5C49A 1ZI1A 2RJ9A 5FUHA 2AGDA 5C3BA 1G93A 1YP3A 2ZU9A 1LZ0A 5C1HA 3TZTA 4IRQA 1W77A 2VD4A 2OI5A 2QH5A 1FRWA 2WGZA 1VGUA 5C4FA 1YP2A 1LZJA 1ZJPA 4R7PA 3OH3A 3I0LA 4FRQA 1LL2A 1H5RA 2OEGA 2DPWA 2V0KA 1G3LA 3D8VA 4KC2A 2PGYA 2QKXA 3I0FA 1NWGB 4MYBA 2ICYA 1EZIA 2OI6A 4CVHA 1H5TA 1V83A 5C4EA 3V0PA 4ASYA 1NMMB 5CQLX 1QGQA 2Y6PA 2WVLA 4Y9XA 2RITA 1FGGA 2O1GA 3USQA 4O6NA 1ZCYA 1G0RA 1E5KA 4HO9A 3OC9A 2RJ6A 1Z90A 1R7XA 1H7FA 4D48A 1SS9A 3SX8A 3IOIA 3D5NA 2X5ZA 1FXOA 1HM9A 5EJZA 4EEAA 5FTVA 4AAWA 1H4CA 1W57A 2FYAA 1VH3A 1FG5N 2Y4KA 5C4DA 1HJLA 4HO8A 2O1HA 1S4NA 3EE5A 5IDTA 1G23A 1JYLA 4GBPA 5J49A 4Y7TA 4Y7FA 2RJ5A 1ZI4A 2BO7A 5CMIA 1MP3A 3IOJA 5AJNA 3I0JA 5BXCA 2D7RA 3I0KA 3U0XA 2NXVA 3SXAA 1H5SB 3Q7UA 2Z87A 1R7TA 4HO0A 2FY7A 2AM5A 4CJBA 4G3PA 5C36A 2RJ7A 2VSHA 3K8EA
chains in the Genus database with same CATH topology
3F1YA 4D0TA 3JUKA 4Y6UA 1JV3A 3U0YA 2RIZA 3KIAA 4B4GA 3CKOA 3T7MA 3HL3A 1FOAA 4HO3A 3OH0A 2FYCB 2V0LA 2AM3A 4Y6NA 1ZJOA 1TZFA 1O7QA 4DE7A 4AYJA 1VGZA 1GX0A 2AH9A 1HM8A 4Y64A 1JV1A 3V0OA 2RIYA 4B2WA 4BMAA 3SX5A 3U2TA 2XWLA 3T7NA 2RIXA 4EE5A 3PKQA 2J0BA 4NAKA 3V0LA 3V90A 4UEGA 1JVGA 1NF5B 3V0NA 5CQPA 1H7QA 5EIYA 2JCLA 1FWYA 3SXDA 4M2BA 1ZIZA 1MP4A 4DDZA 2X60A 3FOQA 5IDSA 1G9RA 2FFVA 1ZI3A 3SPTA 4KNRA 1QWJA 3OH1A 5D91A 2I5KA 4G3SA 2JCOA 3CU0A 2Q4JA 3IOHA 1R7UA 1OQMB 1R81A 4ARWA 3U2XA 4AC3A 2E3DA 2VFZA 4EEOA 5AJPA 1HJJA 2JCJA 2Y7AA 1ZDFA 2Y4MA 2XWMA 1FGXA 4FRHA 1XHBA 1ZDGA 2I7BA 1GWVA 4MNDA 3V0MA 2YC3A 3PNNA 4FIYA 4AYLA 1ZJ1A 4EEGA 3E25A 3I0GA 2RJ4A 3ST8A 2VS4A 5C1GA 4Y7UA 1WVCA 3V91A 5CQMX 3SXEA 4YS8A 4HG6A 1LZIA 1H5RB 2BO6A 4HO4A 1H7LA 3T7OA 2Y4LA 1G95A 2V0IA 1FXJA 2YESA 4HO6A 3GUEA 5CQNX 2OEFA 2MZBA 1OMZA 2YQJA 5AJOA 5FV9A 1V82A 2VS3A 3V8YA 3ZLLA 1H5TB 1ZCTA 2VS5A 1GWWA 4B2XA 3ZLKA 3I0EA 3BRKX 1GQCA 1NHEB 3OAMA 2A8WA 1H4DA 1H5SC 2E8BA 4EE3A 1ZI5A 3SXGA 2J0AA 5C48A 5JQQA 1GX4A 4Y62A 1TW1A 4D11C 1G97A 5FU0A 1WT2A 1WT3A 3CKVA 5CMHA 1JYKA 4M28A 1NKHB 1VZXA 4NALA 4ECMA 3QVBA 4D11A 5C3AA 1XZ6A 4HO2A 1OMXA 1MC3A 3SXCA 3FWWA 1WT1A 4M4KA 1NQIB 5C3DA 1PZTA 1ZCVA 1ZHJA 3USRA 2WE9A 2ICXA 2XMEA 1HM0A 4K6RA 2ZU7A 3SXBA 1WSZA 4Y7VA 2GGOA 2P72A 1W55A 2Z86A 1S4PA 1INJA 3OH4A 5I1FA 5CMGX 4FRDA 3V8ZA 3OH2A 1H7EA 2V0HA 2RJ1A 2X5SA 4HO5A 5C38A 3I0DA 4LW3A 2FFUA 1INIA 2W0VA 4KQLA 1TW5A 2VXMA 4G87A 2O1FA 4C2SA 1H3MA 1TVYA 1H7GA 4JISA 2JCKA 5D92A 1O0RA 3I0CA 4MIXA 3CKQA 1HV9A 4HCQA 4XWIA 4EE4A 4J18A 5FYEA 3U2VA 3U2WA 1QGSA 2QGIA 5C4BA 1VH1A 2WVMA 1VZTA 3POLA 4KXOA 4KT7A 4FRAA 1FO8A 2YQSA 1ZJ0A 4FREA 2C0NA 2OI7A 2AECA 4LW6A 1IINA 2AM4A 4EVWA 2V0JA 3U2UA 4ASJA 5EJ1A 4FQWA 2XMHA 2I5EA 5C1LA 2P73A 3R3IA 1GA8A 4KC1A 3RMWA 1O23B 1LL0A 1G8OA 3BCVA 2YQCA 5C47A 5L6VA 4DECA 1FR9A 4KC4A 1R7VA 2P6WA 3PKPA 1ON8A 4FCUA 3DUVA 3ZGGA 2YCMA 4B4BA 3ZGFA 1VPAA 3F1CA 4EEMA 2WEEA 5FTSA 2RJ0A 3OKRA 3O3PA 1S4OA 4M2AA 5L6SA 1O7OA 3I0HA 3Q80A 4P00A 1JVDA 1VGWA 2VSIA 1ZJ2A 2X65A 1YROB 4BQHA 3LW6A 3JUJA 4FIXA 2D0JA 2AE7A 4E1KA 1R80A 3NGWA 4FRMA 1QG8A 3R2WA 2XWNA 2ZU8A 1MP5A 1VZUA 2BO4A 4B3UA 4KPXA 1H5SA 5DDVA 4IRPA 3ZF8A 4KNXA 2A8UA 5IFYA 3K8DA 1G2VA 1KWSA 1YP4A 2YC5A 3Q4SA 4NANA 4CJ8A 2Y4JA 1VM8A 4P02A 3DJ4A 3CGXA 4FROA 4FRPA 4O6MA 1VICA 1R7YA 1I52A 4Y7GA 2W0WA 4Y63A 2WAWA 1K4VA 1GQ9A 4B5BA 1ZCUA 4D0ZA 2D7IA 2GGQA 1IIMA 5FU8A 5DDTA 5HS2A 3N9WA 2FYDB 1H7TA 1LVWA 4KPZA 3TQDA 4KRVA 4FCEA 4FRLA 2PX7A 2BO8A 3I0IX 1PZYB 4G3QA 1EYRA 1G1LA 2CU2A 1H7HA 2UX8A 3D98A 2YQHA 2RJ8A 3CKJA 3CKNA 1R82A 4CJCA 4B4MA 1LL3A 3E26A 2PGVA 5CMFX 2APCA 2VXLA 2VK9A 1FO9A 1WT0A 3RMVA 4FRBA 3DK5A 5CQOA 1V84A 2AESA 4NAIA 4L41C 3V0QA 5C4CA 3SX3A 4Q7CA 1LZ7A 4JD0A 3OGZA 5C8RA 3SX7A 4B42A 3JTJA 5CMJA 1ON6A 1FZWA 2FYBA 2PA4A 3RSBA 1H4EA 2WVKA 1FR8A 1ZJ3A 4HOCA 1H5SD 1VGTA 4ZDQA 5C49A 1ZI1A 2RJ9A 5FUHA 2AGDA 5C3BA 1G93A 1YP3A 2ZU9A 1LZ0A 5C1HA 3TZTA 4IRQA 1W77A 2VD4A 2OI5A 2QH5A 1FRWA 2WGZA 1VGUA 5C4FA 1YP2A 1LZJA 1ZJPA 4R7PA 3OH3A 3I0LA 4FRQA 1LL2A 1H5RA 2OEGA 2DPWA 2V0KA 1G3LA 3D8VA 4KC2A 2PGYA 2QKXA 3I0FA 1NWGB 4MYBA 2ICYA 1EZIA 2OI6A 4CVHA 1H5TA 1V83A 5C4EA 3V0PA 4ASYA 1NMMB 5CQLX 1QGQA 2Y6PA 2WVLA 4Y9XA 2RITA 1FGGA 2O1GA 3USQA 4O6NA 1ZCYA 1G0RA 1E5KA 4HO9A 3OC9A 2RJ6A 1Z90A 1R7XA 1H7FA 4D48A 1SS9A 3SX8A 3IOIA 3D5NA 2X5ZA 1FXOA 1HM9A 5EJZA 4EEAA 5FTVA 4AAWA 1H4CA 1W57A 2FYAA 1VH3A 1FG5N 2Y4KA 5C4DA 1HJLA 4HO8A 2O1HA 1S4NA 3EE5A 5IDTA 1G23A 1JYLA 4GBPA 5J49A 4Y7TA 4Y7FA 2RJ5A 1ZI4A 2BO7A 5CMIA 1MP3A 3IOJA 5AJNA 3I0JA 5BXCA 2D7RA 3I0KA 3U0XA 2NXVA 3SXAA 1H5SB 3Q7UA 2Z87A 1R7TA 4HO0A 2FY7A 2AM5A 4CJBA 4G3PA 5C36A 2RJ7A 2VSHA 3K8EA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3F1Y A;  4D0T A;  3JUK A;  4Y6U A;  1JV3 A;  3U0Y A;  2RIZ A;  3KIA A;  4B4G A;  3CKO A;  3T7M A;  3HL3 A;  1FOA A;  4HO3 A;  3OH0 A;  2FYC B;  2V0L A;  2AM3 A;  4Y6N A;  1ZJO A;  1TZF A;  1O7Q A;  4DE7 A;  4AYJ A;  1VGZ A;  1GX0 A;  2AH9 A;  1HM8 A;  4Y64 A;  1JV1 A;  3V0O A;  2RIY A;  4B2W A;  4BMA A;  3SX5 A;  3U2T A;  2XWL A;  3T7N A;  2RIX A;  4EE5 A;  3PKQ A;  4NAK A;  3V0L A;  3V90 A;  4UEG A;  1JVG A;  1NF5 B;  3V0N A;  5CQP A;  1H7Q A;  5EIY A;  2JCL A;  1FWY A;  3SXD A;  4M2B A;  1ZIZ A;  1MP4 A;  4DDZ A;  2X60 A;  3FOQ A;  5IDS A;  1G9R A;  2FFV A;  1ZI3 A;  3SPT A;  4KNR A;  1QWJ A;  3OH1 A;  2I5K A;  4G3S A;  2JCO A;  3CU0 A;  2Q4J A;  3IOH A;  1R7U A;  1OQM B;  1R81 A;  4ARW A;  3U2X A;  4AC3 A;  2E3D A;  2VFZ A;  4EEO A;  5AJP A;  1HJJ A;  2JCJ A;  2Y7A A;  1ZDF A;  2Y4M A;  2XWM A;  1FGX A;  4FRH A;  1XHB A;  1ZDG A;  2I7B A;  1GWV A;  4MND A;  3V0M A;  2YC3 A;  3PNN A;  4AYL A;  1ZJ1 A;  4EEG A;  3E25 A;  3I0G A;  2RJ4 A;  3ST8 A;  2VS4 A;  5C1G A;  4Y7U A;  1WVC A;  3V91 A;  5CQM X;  3SXE A;  4YS8 A;  4HG6 A;  1LZI A;  1H5R B;  2BO6 A;  4HO4 A;  1H7L A;  3T7O A;  2Y4L A;  1G95 A;  2V0I A;  1FXJ A;  2YES A;  4HO6 A;  3GUE A;  5CQN X;  2OEF A;  2MZB A;  1OMZ A;  2YQJ A;  5AJO A;  5FV9 A;  1V82 A;  2VS3 A;  3V8Y A;  3ZLL A;  1H5T B;  1ZCT A;  2VS5 A;  1GWW A;  4B2X A;  3ZLK A;  3I0E A;  3BRK X;  1GQC A;  1NHE B;  3OAM A;  2A8W A;  1H4D A;  1H5S C;  2E8B A;  4EE3 A;  1ZI5 A;  3SXG A;  5C48 A;  5JQQ A;  1GX4 A;  4Y62 A;  1TW1 A;  4D11 C;  1G97 A;  5FU0 A;  1WT2 A;  1WT3 A;  3CKV A;  5CMH A;  1JYK A;  4M28 A;  1NKH B;  1VZX A;  4NAL A;  4ECM A;  3QVB A;  4D11 A;  5C3A A;  1XZ6 A;  4HO2 A;  1OMX A;  1MC3 A;  3SXC A;  3FWW A;  1WT1 A;  4M4K A;  1NQI B;  5C3D A;  1PZT A;  1ZCV A;  1ZHJ A;  3USR A;  2WE9 A;  2ICX A;  2XME A;  1HM0 A;  4K6R A;  2ZU7 A;  3SXB A;  1WSZ A;  4Y7V A;  2GGO A;  2P72 A;  1W55 A;  2Z86 A;  1S4P A;  1INJ A;  3OH4 A;  5I1F A;  5CMG X;  4FRD A;  3V8Z A;  3OH2 A;  1H7E A;  2V0H A;  2RJ1 A;  2X5S A;  4HO5 A;  5C38 A;  3I0D A;  4LW3 A;  2FFU A;  1INI A;  2W0V A;  4KQL A;  1TW5 A;  2VXM A;  4G87 A;  2O1F A;  4C2S A;  1H3M A;  1TVY A;  1H7G A;  4JIS A;  2JCK A;  1O0R A;  3I0C A;  3CKQ A;  1HV9 A;  4HCQ A;  4XWI A;  4EE4 A;  4J18 A;  5FYE A;  3U2V A;  3U2W A;  1QGS A;  2QGI A;  5C4B A;  1VH1 A;  2WVM A;  1VZT A;  3POL A;  4KXO A;  4KT7 A;  4FRA A;  1FO8 A;  2YQS A;  1ZJ0 A;  4FRE A;  2OI7 A;  2AEC A;  4LW6 A;  1IIN A;  2AM4 A;  4EVW A;  2V0J A;  3U2U A;  4ASJ A;  5EJ1 A;  4FQW A;  2XMH A;  2I5E A;  5C1L A;  2P73 A;  3R3I A;  1GA8 A;  4KC1 A;  3RMW A;  1O23 B;  1LL0 A;  1G8O A;  3BCV A;  2YQC A;  5C47 A;  5L6V A;  4DEC A;  1FR9 A;  4KC4 A;  1R7V A;  2P6W A;  3PKP A;  1ON8 A;  4FCU A;  3DUV A;  3ZGG A;  2YCM A;  4B4B A;  3ZGF A;  1VPA A;  3F1C A;  4EEM A;  2WEE A;  5FTS A;  2RJ0 A;  3OKR A;  3O3P A;  1S4O A;  4M2A A;  5L6S A;  1O7O A;  3I0H A;  3Q80 A;  4P00 A;  1JVD A;  1VGW A;  2VSI A;  1ZJ2 A;  2X65 A;  1YRO B;  4BQH A;  3LW6 A;  3JUJ A;  2D0J A;  2AE7 A;  4E1K A;  1R80 A;  3NGW A;  4FRM A;  1QG8 A;  3R2W A;  2XWN A;  2ZU8 A;  1MP5 A;  1VZU A;  2BO4 A;  4B3U A;  4KPX A;  1H5S A;  5DDV A;  4IRP A;  3ZF8 A;  4KNX A;  2A8U A;  5IFY A;  3K8D A;  1G2V A;  1KWS A;  1YP4 A;  2YC5 A;  3Q4S A;  4NAN A;  4CJ8 A;  2Y4J A;  1VM8 A;  4P02 A;  3DJ4 A;  3CGX A;  4FRO A;  4FRP A;  1VIC A;  1R7Y A;  1I52 A;  4Y7G A;  2W0W A;  4Y63 A;  2WAW A;  1K4V A;  1GQ9 A;  4B5B A;  1ZCU A;  4D0Z A;  2D7I A;  2GGQ A;  1IIM A;  5FU8 A;  5DDT A;  5HS2 A;  3N9W A;  2FYD B;  1H7T A;  1LVW A;  4KPZ A;  3TQD A;  4KRV A;  4FCE A;  4FRL A;  2PX7 A;  2BO8 A;  3I0I X;  1PZY B;  4G3Q A;  1EYR A;  1G1L A;  2CU2 A;  1H7H A;  2UX8 A;  3D98 A;  2YQH A;  2RJ8 A;  3CKJ A;  3CKN A;  1R82 A;  4CJC A;  4B4M A;  1LL3 A;  3E26 A;  2PGV A;  5CMF X;  2APC A;  2VXL A;  1FO9 A;  1WT0 A;  3RMV A;  4FRB A;  3DK5 A;  5CQO A;  1V84 A;  2AES A;  4NAI A;  4L41 C;  3V0Q A;  5C4C A;  3SX3 A;  1LZ7 A;  4JD0 A;  3OGZ A;  5C8R A;  3SX7 A;  4B42 A;  3JTJ A;  5CMJ A;  1ON6 A;  1FZW A;  2FYB A;  2PA4 A;  3RSB A;  1H4E A;  2WVK A;  1FR8 A;  1ZJ3 A;  4HOC A;  1H5S D;  1VGT A;  4ZDQ A;  5C49 A;  1ZI1 A;  2RJ9 A;  5FUH A;  2AGD A;  5C3B A;  1G93 A;  1YP3 A;  2ZU9 A;  1LZ0 A;  5C1H A;  3TZT A;  4IRQ A;  1W77 A;  2VD4 A;  2OI5 A;  2QH5 A;  1FRW A;  2WGZ A;  1VGU A;  5C4F A;  1YP2 A;  1LZJ A;  1ZJP A;  4R7P A;  3OH3 A;  3I0L A;  4FRQ A;  1LL2 A;  1H5R A;  2OEG A;  2DPW A;  2V0K A;  1G3L A;  3D8V A;  4KC2 A;  2PGY A;  2QKX A;  3I0F A;  1NWG B;  4MYB A;  2ICY A;  1EZI A;  2OI6 A;  4CVH A;  1H5T A;  1V83 A;  5C4E A;  3V0P A;  4ASY A;  1NMM B;  5CQL X;  1QGQ A;  2Y6P A;  2WVL A;  4Y9X A;  2RIT A;  1FGG A;  2O1G A;  3USQ A;  1ZCY A;  1G0R A;  1E5K A;  4HO9 A;  3OC9 A;  2RJ6 A;  1Z90 A;  1R7X A;  1H7F A;  4D48 A;  1SS9 A;  3SX8 A;  3IOI A;  3D5N A;  2X5Z A;  1FXO A;  1HM9 A;  5EJZ A;  4EEA A;  5FTV A;  4AAW A;  1H4C A;  1W57 A;  2FYA A;  1VH3 A;  1FG5 N;  2Y4K A;  5C4D A;  1HJL A;  4HO8 A;  2O1H A;  1S4N A;  3EE5 A;  5IDT A;  1G23 A;  1JYL A;  4GBP A;  5J49 A;  4Y7T A;  4Y7F A;  2RJ5 A;  1ZI4 A;  2BO7 A;  5CMI A;  1MP3 A;  3IOJ A;  5AJN A;  3I0J A;  5BXC A;  2D7R A;  3I0K A;  3U0X A;  2NXV A;  3SXA A;  1H5S B;  3Q7U A;  2Z87 A;  1R7T A;  4HO0 A;  2FY7 A;  2AM5 A;  4CJB A;  4G3P A;  5C36 A;  2RJ7 A;  2VSH A;  3K8E A; 
#chains in the Genus database with same CATH topology
 3F1Y A;  4D0T A;  3JUK A;  4Y6U A;  1JV3 A;  3U0Y A;  2RIZ A;  3KIA A;  4B4G A;  3CKO A;  3T7M A;  3HL3 A;  1FOA A;  4HO3 A;  3OH0 A;  2FYC B;  2V0L A;  2AM3 A;  4Y6N A;  1ZJO A;  1TZF A;  1O7Q A;  4DE7 A;  4AYJ A;  1VGZ A;  1GX0 A;  2AH9 A;  1HM8 A;  4Y64 A;  1JV1 A;  3V0O A;  2RIY A;  4B2W A;  4BMA A;  3SX5 A;  3U2T A;  2XWL A;  3T7N A;  2RIX A;  4EE5 A;  3PKQ A;  2J0B A;  4NAK A;  3V0L A;  3V90 A;  4UEG A;  1JVG A;  1NF5 B;  3V0N A;  5CQP A;  1H7Q A;  5EIY A;  2JCL A;  1FWY A;  3SXD A;  4M2B A;  1ZIZ A;  1MP4 A;  4DDZ A;  2X60 A;  3FOQ A;  5IDS A;  1G9R A;  2FFV A;  1ZI3 A;  3SPT A;  4KNR A;  1QWJ A;  3OH1 A;  5D91 A;  2I5K A;  4G3S A;  2JCO A;  3CU0 A;  2Q4J A;  3IOH A;  1R7U A;  1OQM B;  1R81 A;  4ARW A;  3U2X A;  4AC3 A;  2E3D A;  2VFZ A;  4EEO A;  5AJP A;  1HJJ A;  2JCJ A;  2Y7A A;  1ZDF A;  2Y4M A;  2XWM A;  1FGX A;  4FRH A;  1XHB A;  1ZDG A;  2I7B A;  1GWV A;  4MND A;  3V0M A;  2YC3 A;  3PNN A;  4FIY A;  4AYL A;  1ZJ1 A;  4EEG A;  3E25 A;  3I0G A;  2RJ4 A;  3ST8 A;  2VS4 A;  5C1G A;  4Y7U A;  1WVC A;  3V91 A;  5CQM X;  3SXE A;  4YS8 A;  4HG6 A;  1LZI A;  1H5R B;  2BO6 A;  4HO4 A;  1H7L A;  3T7O A;  2Y4L A;  1G95 A;  2V0I A;  1FXJ A;  2YES A;  4HO6 A;  3GUE A;  5CQN X;  2OEF A;  2MZB A;  1OMZ A;  2YQJ A;  5AJO A;  5FV9 A;  1V82 A;  2VS3 A;  3V8Y A;  3ZLL A;  1H5T B;  1ZCT A;  2VS5 A;  1GWW A;  4B2X A;  3ZLK A;  3I0E A;  3BRK X;  1GQC A;  1NHE B;  3OAM A;  2A8W A;  1H4D A;  1H5S C;  2E8B A;  4EE3 A;  1ZI5 A;  3SXG A;  2J0A A;  5C48 A;  5JQQ A;  1GX4 A;  4Y62 A;  1TW1 A;  4D11 C;  1G97 A;  5FU0 A;  1WT2 A;  1WT3 A;  3CKV A;  5CMH A;  1JYK A;  4M28 A;  1NKH B;  1VZX A;  4NAL A;  4ECM A;  3QVB A;  4D11 A;  5C3A A;  1XZ6 A;  4HO2 A;  1OMX A;  1MC3 A;  3SXC A;  3FWW A;  1WT1 A;  4M4K A;  1NQI B;  5C3D A;  1PZT A;  1ZCV A;  1ZHJ A;  3USR A;  2WE9 A;  2ICX A;  2XME A;  1HM0 A;  4K6R A;  2ZU7 A;  3SXB A;  1WSZ A;  4Y7V A;  2GGO A;  2P72 A;  1W55 A;  2Z86 A;  1S4P A;  1INJ A;  3OH4 A;  5I1F A;  5CMG X;  4FRD A;  3V8Z A;  3OH2 A;  1H7E A;  2V0H A;  2RJ1 A;  2X5S A;  4HO5 A;  5C38 A;  3I0D A;  4LW3 A;  2FFU A;  1INI A;  2W0V A;  4KQL A;  1TW5 A;  2VXM A;  4G87 A;  2O1F A;  4C2S A;  1H3M A;  1TVY A;  1H7G A;  4JIS A;  2JCK A;  5D92 A;  1O0R A;  3I0C A;  4MIX A;  3CKQ A;  1HV9 A;  4HCQ A;  4XWI A;  4EE4 A;  4J18 A;  5FYE A;  3U2V A;  3U2W A;  1QGS A;  2QGI A;  5C4B A;  1VH1 A;  2WVM A;  1VZT A;  3POL A;  4KXO A;  4KT7 A;  4FRA A;  1FO8 A;  2YQS A;  1ZJ0 A;  4FRE A;  2C0N A;  2OI7 A;  2AEC A;  4LW6 A;  1IIN A;  2AM4 A;  4EVW A;  2V0J A;  3U2U A;  4ASJ A;  5EJ1 A;  4FQW A;  2XMH A;  2I5E A;  5C1L A;  2P73 A;  3R3I A;  1GA8 A;  4KC1 A;  3RMW A;  1O23 B;  1LL0 A;  1G8O A;  3BCV A;  2YQC A;  5C47 A;  5L6V A;  4DEC A;  1FR9 A;  4KC4 A;  1R7V A;  2P6W A;  3PKP A;  1ON8 A;  4FCU A;  3DUV A;  3ZGG A;  2YCM A;  4B4B A;  3ZGF A;  1VPA A;  3F1C A;  4EEM A;  2WEE A;  5FTS A;  2RJ0 A;  3OKR A;  3O3P A;  1S4O A;  4M2A A;  5L6S A;  1O7O A;  3I0H A;  3Q80 A;  4P00 A;  1JVD A;  1VGW A;  2VSI A;  1ZJ2 A;  2X65 A;  1YRO B;  4BQH A;  3LW6 A;  3JUJ A;  4FIX A;  2D0J A;  2AE7 A;  4E1K A;  1R80 A;  3NGW A;  4FRM A;  1QG8 A;  3R2W A;  2XWN A;  2ZU8 A;  1MP5 A;  1VZU A;  2BO4 A;  4B3U A;  4KPX A;  1H5S A;  5DDV A;  4IRP A;  3ZF8 A;  4KNX A;  2A8U A;  5IFY A;  3K8D A;  1G2V A;  1KWS A;  1YP4 A;  2YC5 A;  3Q4S A;  4NAN A;  4CJ8 A;  2Y4J A;  1VM8 A;  4P02 A;  3DJ4 A;  3CGX A;  4FRO A;  4FRP A;  4O6M A;  1VIC A;  1R7Y A;  1I52 A;  4Y7G A;  2W0W A;  4Y63 A;  2WAW A;  1K4V A;  1GQ9 A;  4B5B A;  1ZCU A;  4D0Z A;  2D7I A;  2GGQ A;  1IIM A;  5FU8 A;  5DDT A;  5HS2 A;  3N9W A;  2FYD B;  1H7T A;  1LVW A;  4KPZ A;  3TQD A;  4KRV A;  4FCE A;  4FRL A;  2PX7 A;  2BO8 A;  3I0I X;  1PZY B;  4G3Q A;  1EYR A;  1G1L A;  2CU2 A;  1H7H A;  2UX8 A;  3D98 A;  2YQH A;  2RJ8 A;  3CKJ A;  3CKN A;  1R82 A;  4CJC A;  4B4M A;  1LL3 A;  3E26 A;  2PGV A;  5CMF X;  2APC A;  2VXL A;  2VK9 A;  1FO9 A;  1WT0 A;  3RMV A;  4FRB A;  3DK5 A;  5CQO A;  1V84 A;  2AES A;  4NAI A;  4L41 C;  3V0Q A;  5C4C A;  3SX3 A;  4Q7C A;  1LZ7 A;  4JD0 A;  3OGZ A;  5C8R A;  3SX7 A;  4B42 A;  3JTJ A;  5CMJ A;  1ON6 A;  1FZW A;  2FYB A;  2PA4 A;  3RSB A;  1H4E A;  2WVK A;  1FR8 A;  1ZJ3 A;  4HOC A;  1H5S D;  1VGT A;  4ZDQ A;  5C49 A;  1ZI1 A;  2RJ9 A;  5FUH A;  2AGD A;  5C3B A;  1G93 A;  1YP3 A;  2ZU9 A;  1LZ0 A;  5C1H A;  3TZT A;  4IRQ A;  1W77 A;  2VD4 A;  2OI5 A;  2QH5 A;  1FRW A;  2WGZ A;  1VGU A;  5C4F A;  1YP2 A;  1LZJ A;  1ZJP A;  4R7P A;  3OH3 A;  3I0L A;  4FRQ A;  1LL2 A;  1H5R A;  2OEG A;  2DPW A;  2V0K A;  1G3L A;  3D8V A;  4KC2 A;  2PGY A;  2QKX A;  3I0F A;  1NWG B;  4MYB A;  2ICY A;  1EZI A;  2OI6 A;  4CVH A;  1H5T A;  1V83 A;  5C4E A;  3V0P A;  4ASY A;  1NMM B;  5CQL X;  1QGQ A;  2Y6P A;  2WVL A;  4Y9X A;  2RIT A;  1FGG A;  2O1G A;  3USQ A;  4O6N A;  1ZCY A;  1G0R A;  1E5K A;  4HO9 A;  3OC9 A;  2RJ6 A;  1Z90 A;  1R7X A;  1H7F A;  4D48 A;  1SS9 A;  3SX8 A;  3IOI A;  3D5N A;  2X5Z A;  1FXO A;  1HM9 A;  5EJZ A;  4EEA A;  5FTV A;  4AAW A;  1H4C A;  1W57 A;  2FYA A;  1VH3 A;  1FG5 N;  2Y4K A;  5C4D A;  1HJL A;  4HO8 A;  2O1H A;  1S4N A;  3EE5 A;  5IDT A;  1G23 A;  1JYL A;  4GBP A;  5J49 A;  4Y7T A;  4Y7F A;  2RJ5 A;  1ZI4 A;  2BO7 A;  5CMI A;  1MP3 A;  3IOJ A;  5AJN A;  3I0J A;  5BXC A;  2D7R A;  3I0K A;  3U0X A;  2NXV A;  3SXA A;  1H5S B;  3Q7U A;  2Z87 A;  1R7T A;  4HO0 A;  2FY7 A;  2AM5 A;  4CJB A;  4G3P A;  5C36 A;  2RJ7 A;  2VSH A;  3K8E A; 
#chains in the Genus database with same CATH homology
 3F1Y A;  4D0T A;  3JUK A;  4Y6U A;  1JV3 A;  3U0Y A;  2RIZ A;  3KIA A;  4B4G A;  3CKO A;  3T7M A;  3HL3 A;  1FOA A;  4HO3 A;  3OH0 A;  2FYC B;  2V0L A;  2AM3 A;  4Y6N A;  1ZJO A;  1TZF A;  1O7Q A;  4DE7 A;  4AYJ A;  1VGZ A;  1GX0 A;  2AH9 A;  1HM8 A;  4Y64 A;  1JV1 A;  3V0O A;  2RIY A;  4B2W A;  4BMA A;  3SX5 A;  3U2T A;  2XWL A;  3T7N A;  2RIX A;  4EE5 A;  3PKQ A;  2J0B A;  4NAK A;  3V0L A;  3V90 A;  4UEG A;  1JVG A;  1NF5 B;  3V0N A;  5CQP A;  1H7Q A;  5EIY A;  2JCL A;  1FWY A;  3SXD A;  4M2B A;  1ZIZ A;  1MP4 A;  4DDZ A;  2X60 A;  3FOQ A;  5IDS A;  1G9R A;  2FFV A;  1ZI3 A;  3SPT A;  4KNR A;  1QWJ A;  3OH1 A;  5D91 A;  2I5K A;  4G3S A;  2JCO A;  3CU0 A;  2Q4J A;  3IOH A;  1R7U A;  1OQM B;  1R81 A;  4ARW A;  3U2X A;  4AC3 A;  2E3D A;  2VFZ A;  4EEO A;  5AJP A;  1HJJ A;  2JCJ A;  2Y7A A;  1ZDF A;  2Y4M A;  2XWM A;  1FGX A;  4FRH A;  1XHB A;  1ZDG A;  2I7B A;  1GWV A;  4MND A;  3V0M A;  2YC3 A;  3PNN A;  4FIY A;  4AYL A;  1ZJ1 A;  4EEG A;  3E25 A;  3I0G A;  2RJ4 A;  3ST8 A;  2VS4 A;  5C1G A;  4Y7U A;  1WVC A;  3V91 A;  5CQM X;  3SXE A;  4YS8 A;  4HG6 A;  1LZI A;  1H5R B;  2BO6 A;  4HO4 A;  1H7L A;  3T7O A;  2Y4L A;  1G95 A;  2V0I A;  1FXJ A;  2YES A;  4HO6 A;  3GUE A;  5CQN X;  2OEF A;  2MZB A;  1OMZ A;  2YQJ A;  5AJO A;  5FV9 A;  1V82 A;  2VS3 A;  3V8Y A;  3ZLL A;  1H5T B;  1ZCT A;  2VS5 A;  1GWW A;  4B2X A;  3ZLK A;  3I0E A;  3BRK X;  1GQC A;  1NHE B;  3OAM A;  2A8W A;  1H4D A;  1H5S C;  2E8B A;  4EE3 A;  1ZI5 A;  3SXG A;  2J0A A;  5C48 A;  5JQQ A;  1GX4 A;  4Y62 A;  1TW1 A;  4D11 C;  1G97 A;  5FU0 A;  1WT2 A;  1WT3 A;  3CKV A;  5CMH A;  1JYK A;  4M28 A;  1NKH B;  1VZX A;  4NAL A;  4ECM A;  3QVB A;  4D11 A;  5C3A A;  1XZ6 A;  4HO2 A;  1OMX A;  1MC3 A;  3SXC A;  3FWW A;  1WT1 A;  4M4K A;  1NQI B;  5C3D A;  1PZT A;  1ZCV A;  1ZHJ A;  3USR A;  2WE9 A;  2ICX A;  2XME A;  1HM0 A;  4K6R A;  2ZU7 A;  3SXB A;  1WSZ A;  4Y7V A;  2GGO A;  2P72 A;  1W55 A;  2Z86 A;  1S4P A;  1INJ A;  3OH4 A;  5I1F A;  5CMG X;  4FRD A;  3V8Z A;  3OH2 A;  1H7E A;  2V0H A;  2RJ1 A;  2X5S A;  4HO5 A;  5C38 A;  3I0D A;  4LW3 A;  2FFU A;  1INI A;  2W0V A;  4KQL A;  1TW5 A;  2VXM A;  4G87 A;  2O1F A;  4C2S A;  1H3M A;  1TVY A;  1H7G A;  4JIS A;  2JCK A;  5D92 A;  1O0R A;  3I0C A;  4MIX A;  3CKQ A;  1HV9 A;  4HCQ A;  4XWI A;  4EE4 A;  4J18 A;  5FYE A;  3U2V A;  3U2W A;  1QGS A;  2QGI A;  5C4B A;  1VH1 A;  2WVM A;  1VZT A;  3POL A;  4KXO A;  4KT7 A;  4FRA A;  1FO8 A;  2YQS A;  1ZJ0 A;  4FRE A;  2C0N A;  2OI7 A;  2AEC A;  4LW6 A;  1IIN A;  2AM4 A;  4EVW A;  2V0J A;  3U2U A;  4ASJ A;  5EJ1 A;  4FQW A;  2XMH A;  2I5E A;  5C1L A;  2P73 A;  3R3I A;  1GA8 A;  4KC1 A;  3RMW A;  1O23 B;  1LL0 A;  1G8O A;  3BCV A;  2YQC A;  5C47 A;  5L6V A;  4DEC A;  1FR9 A;  4KC4 A;  1R7V A;  2P6W A;  3PKP A;  1ON8 A;  4FCU A;  3DUV A;  3ZGG A;  2YCM A;  4B4B A;  3ZGF A;  1VPA A;  3F1C A;  4EEM A;  2WEE A;  5FTS A;  2RJ0 A;  3OKR A;  3O3P A;  1S4O A;  4M2A A;  5L6S A;  1O7O A;  3I0H A;  3Q80 A;  4P00 A;  1JVD A;  1VGW A;  2VSI A;  1ZJ2 A;  2X65 A;  1YRO B;  4BQH A;  3LW6 A;  3JUJ A;  4FIX A;  2D0J A;  2AE7 A;  4E1K A;  1R80 A;  3NGW A;  4FRM A;  1QG8 A;  3R2W A;  2XWN A;  2ZU8 A;  1MP5 A;  1VZU A;  2BO4 A;  4B3U A;  4KPX A;  1H5S A;  5DDV A;  4IRP A;  3ZF8 A;  4KNX A;  2A8U A;  5IFY A;  3K8D A;  1G2V A;  1KWS A;  1YP4 A;  2YC5 A;  3Q4S A;  4NAN A;  4CJ8 A;  2Y4J A;  1VM8 A;  4P02 A;  3DJ4 A;  3CGX A;  4FRO A;  4FRP A;  4O6M A;  1VIC A;  1R7Y A;  1I52 A;  4Y7G A;  2W0W A;  4Y63 A;  2WAW A;  1K4V A;  1GQ9 A;  4B5B A;  1ZCU A;  4D0Z A;  2D7I A;  2GGQ A;  1IIM A;  5FU8 A;  5DDT A;  5HS2 A;  3N9W A;  2FYD B;  1H7T A;  1LVW A;  4KPZ A;  3TQD A;  4KRV A;  4FCE A;  4FRL A;  2PX7 A;  2BO8 A;  3I0I X;  1PZY B;  4G3Q A;  1EYR A;  1G1L A;  2CU2 A;  1H7H A;  2UX8 A;  3D98 A;  2YQH A;  2RJ8 A;  3CKJ A;  3CKN A;  1R82 A;  4CJC A;  4B4M A;  1LL3 A;  3E26 A;  2PGV A;  5CMF X;  2APC A;  2VXL A;  2VK9 A;  1FO9 A;  1WT0 A;  3RMV A;  4FRB A;  3DK5 A;  5CQO A;  1V84 A;  2AES A;  4NAI A;  4L41 C;  3V0Q A;  5C4C A;  3SX3 A;  4Q7C A;  1LZ7 A;  4JD0 A;  3OGZ A;  5C8R A;  3SX7 A;  4B42 A;  3JTJ A;  5CMJ A;  1ON6 A;  1FZW A;  2FYB A;  2PA4 A;  3RSB A;  1H4E A;  2WVK A;  1FR8 A;  1ZJ3 A;  4HOC A;  1H5S D;  1VGT A;  4ZDQ A;  5C49 A;  1ZI1 A;  2RJ9 A;  5FUH A;  2AGD A;  5C3B A;  1G93 A;  1YP3 A;  2ZU9 A;  1LZ0 A;  5C1H A;  3TZT A;  4IRQ A;  1W77 A;  2VD4 A;  2OI5 A;  2QH5 A;  1FRW A;  2WGZ A;  1VGU A;  5C4F A;  1YP2 A;  1LZJ A;  1ZJP A;  4R7P A;  3OH3 A;  3I0L A;  4FRQ A;  1LL2 A;  1H5R A;  2OEG A;  2DPW A;  2V0K A;  1G3L A;  3D8V A;  4KC2 A;  2PGY A;  2QKX A;  3I0F A;  1NWG B;  4MYB A;  2ICY A;  1EZI A;  2OI6 A;  4CVH A;  1H5T A;  1V83 A;  5C4E A;  3V0P A;  4ASY A;  1NMM B;  5CQL X;  1QGQ A;  2Y6P A;  2WVL A;  4Y9X A;  2RIT A;  1FGG A;  2O1G A;  3USQ A;  4O6N A;  1ZCY A;  1G0R A;  1E5K A;  4HO9 A;  3OC9 A;  2RJ6 A;  1Z90 A;  1R7X A;  1H7F A;  4D48 A;  1SS9 A;  3SX8 A;  3IOI A;  3D5N A;  2X5Z A;  1FXO A;  1HM9 A;  5EJZ A;  4EEA A;  5FTV A;  4AAW A;  1H4C A;  1W57 A;  2FYA A;  1VH3 A;  1FG5 N;  2Y4K A;  5C4D A;  1HJL A;  4HO8 A;  2O1H A;  1S4N A;  3EE5 A;  5IDT A;  1G23 A;  1JYL A;  4GBP A;  5J49 A;  4Y7T A;  4Y7F A;  2RJ5 A;  1ZI4 A;  2BO7 A;  5CMI A;  1MP3 A;  3IOJ A;  5AJN A;  3I0J A;  5BXC A;  2D7R A;  3I0K A;  3U0X A;  2NXV A;  3SXA A;  1H5S B;  3Q7U A;  2Z87 A;  1R7T A;  4HO0 A;  2FY7 A;  2AM5 A;  4CJB A;  4G3P A;  5C36 A;  2RJ7 A;  2VSH A;  3K8E A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...