2X65A

Crystal structure of t. maritima gdp-mannose pyrophosphorylase in complex with mannose-1-phosphate.
Total Genus 112
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
112
sequence length
334
structure length
334
Chain Sequence
VMKALILAGGSGERFWPLSTPETPKQFLKLFGNKSLMRWTFERVLEEMDPKDVIVVTHKDYVERTKKELPELPDENIIAEPMKKNTAPACFIGTKLADDDEPVLVLPADHRIPDTKKFWKTVKKALDALEKYDGLFTFGIVPTRPETGYGYIEIGEELEEGVHKVAQFREKPDLETAKKFVESGRFLWNSGMFLWKAREFIEEVKVCEPSIYENLKDVDPRNFEELKKAYEKVPSISVDYAVMEKSKKVRVVKADFEWSDLGNWSSVREIEGYTEESDEVILVDSDRVFVKTHNKPIAVVGLSDVIVIDTPNGILICKEEYAQKVREVVKKLFR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords MANNOSE-1-PHOSPHATE GUANYLYLTRANSFERASE
publication title Structural Insights Into the Catalytic Mechanism of Bacterial Guanosine-Diphospho-D-Mannose Pyrophosphorylase and its Regulation by Divalent Ions.
pubmed doi rcsb
source organism Thermotoga maritima
molecule tags Transferase
total genus 112
structure length 334
sequence length 334
chains with identical sequence B
ec nomenclature ec 2.7.7.13: Mannose-1-phosphate guanylyltransferase.
pdb deposition date 2010-02-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00483 NTP_transferase Nucleotidyl transferase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.550.10 Alpha Beta Alpha-Beta Complex Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A 2x65A00
2GGOA 3SX7A 3U2TA 2BO6A 3PKPA 1QG8A 4ECMA 2XWLA 2XMHA 2MZBA 1VM8A 2D0JA 4BMAA 2FYAA 5CQNX 1G97A 5C1GA 3I0EA 1VZXA 1H4EA 2X5ZA 4HG6A 3V0LA 5AJPA 4EE5A 1PZYB 1G95A 3BCVA 3BRKX 1MC3A 1VICA 2YQJA 5AJOA 1YP4A 1FO8A 4YS8A 2RJ4A 3I0KA 1LZIA 3EE5A 4JISA 1H7QA 3SXGA 3V8ZA 2FFVA 1HJLA 2WAWA 1R7VA 3I0DA 1PZTA 5CQPA 1JVDA 2WGZA 1HV9A 3K8EA 1HM8A 5C38A 1R7XA 1VZUA 1TVYA 1S4PA 3OKRA 1H7EA 3JUKA 4HO6A 4D0ZA 2YQCA 3Q80A 4HCQA 5IDSA 2V0LA 4HO4A 1VH3A 4KQLA 2FFUA 4EEGA 5C8RA 4EEAA 1JVGA 4Y9XA 2RIYA 1ZDGA 4FRHA 5FU8A 2BO7A 1H4DA 4DECA 4FRDA 2I5KA 2APCA 2Y7AA 1H3MA 4EEOA 2VFZA 4Y7TA 3Q4SA 3JTJA 3POLA 5J49A 4FRLA 3V0MA 4FRPA 4B4GA 2VXLA 2FYBA 1HM9A 4FRQA 1V84A 4D48A 1R7UA 3SPTA 5C4BA 5IFYA 2Y4LA 1H5TB 4KXOA 2I5EA 5CMFX 4FRBA 4Y7GA 2AGDA 4MYBA 4Y7UA 2YESA 2AM5A 2RJ7A 5FYEA 3CKQA 4P02A 3CKOA 1R81A 5FU0A 4Y7FA 3DK5A 5C4CA 1ZCVA 2ICYA 1S4OA 1H5SA 2OI5A 1EZIA 3V0PA 1FWYA 3SXDA 2PGVA 3U0YA 1H5SD 1XZ6A 2A8UA 3E25A 4KT7A 1GQCA 2RJ0A 2P73A 3V90A 1TW5A 3T7NA 5JQQA 3OH1A 5EJZA 5FUHA 1NKHB 2PA4A 1LL0A 4E1KA 1OMXA 3OH2A 4EE3A 2VS3A 1FXJA 3USQA 2RJ1A 4AAWA 4Y63A 5CMHA 3IOHA 4D11C 2Y4MA 3CKNA 3U2VA 1FR9A 4KC1A 1H4CA 2Z87A 1NQIB 4XWIA 1WT1A 1NF5B 4FCEA 2OEGA 4DDZA 2YC3A 1G93A 1H7HA 1VGZA 4KPZA 5C3DA 1VGWA 2X65A 1ZI1A 2PGYA 1YROB 1ZJPA 3RMWA 1Z90A 2YQSA 1R80A 2QKXA 3U2UA 4B4MA 1W55A 2OEFA 5C48A 5AJNA 2RJ8A 1K4VA 3USRA 4FQWA 3U0XA 3I0FA 2X5SA 1HJJA 1ZI5A 5EJ1A 4B5BA 3DJ4A 1QGQA 1FRWA 1LZJA 5BXCA 2XWMA 3OAMA 1R7TA 3LW6A 1H5RB 1VGTA 1W77A 1R82A 2CU2A 4KNXA 4AYLA 1GQ9A 1H7FA 2JCOA 4HO2A 3F1CA 1IIMA 1ZJ2A 3SXCA 3ZLKA 1JYLA 1MP3A 3QVBA 3ZGFA 1WT3A 5DDTA 1V82A 3OC9A 4NAKA 5L6SA 1FGXA 2DPWA 1QWJA 3CU0A 4B3UA 5C3AA 2AECA 4NANA 1FR8A 1FZWA 5C4FA 4B2WA 4AC3A 4CVHA 1ZI4A 3U2XA 1IINA 4HOCA 4HO8A 4JD0A 4M2BA 1JYKA 4L41C 4EVWA 3SX3A 4M2AA 4B42A 1H5SC 2BO4A 1R7YA 2AH9A 1VPAA 2AE7A 3I0IX 1G9RA 3I0GA 3GUEA 4HO9A 4KNRA 2A8WA 2WEEA 1LZ7A 1GX0A 2PX7A 3CKVA 1FG5N 3IOJA 1ZCUA 1G23A 3SXBA 1FO9A 2WVLA 4CJ8A 1H5TA 2YCMA 1WT2A 2JCLA 1MP4A 1VZTA 1W57A 2WVKA 3IOIA 3SX8A 1OMZA 1TW1A 1LVWA 3JUJA 1FOAA 1O23B 2OI7A 3D98A 5CMGX 5DDVA 5C36A 5C47A 2ZU9A 1G2VA 3E26A 3KIAA 2FYCB 3OH3A 3RSBA 4NAIA 1HM0A 1ZJ3A 2P6WA 1LL2A 2E8BA 2VS5A 5C4EA 4LW3A 5C3BA 2ZU8A 3OH0A 1ZJ1A 3N9WA 1H5SB 4J18A 1SS9A 4CJCA 1WT0A 1G8OA 3F1YA 4LW6A 1VH1A 1INJA 3V0NA 2D7IA 1INIA 5FTSA 1JV3A 1H7GA 2YC5A 1QGSA 3ZGGA 4G3QA 4FRMA 3DUVA 2O1GA 4Y64A 1WVCA 3U2WA 2RJ5A 1I52A 2XMEA 4ZDQA 3I0JA 4D0TA 3FOQA 3ST8A 3T7MA 4BQHA 3TQDA 4AYJA 1ON6A 4GBPA 2RJ9A 1XHBA 4HO5A 4ARWA 4KRVA 3SX5A 4C2SA 4FRAA 1H7TA 3K8DA 1OQMB 1NWGB 4K6RA 3OGZA 1O7QA 1GX4A 1WSZA 2AM4A 2Y4KA 1YP2A 1S4NA 4NALA 4FCUA 2JCJA 1ZCYA 1ZCTA 3V0QA 3FWWA 2VSIA 3CGXA 5HS2A 1H5RA 5FV9A 2UX8A 1KWSA 2D7RA 2WVMA 2AM3A 2Y4JA 4FREA 3SXEA 4D11A 2P72A 5CQOA 4DE7A 2OI6A 1LL3A 1H7LA 1JV1A 4B2XA 4Y6NA 3HL3A 2Y6PA 3D5NA 3D8VA 4ASJA 3O3PA 1V83A 1LZ0A 3I0LA 3ZLLA 3T7OA 1ON8A 4ASYA 2O1HA 4Y6UA 1NMMB 5C4DA 1O7OA 2JCKA 2VXMA 1VGUA 5CMJA 2FY7A 2BO8A 4Y62A 5EIYA 2V0KA 2VD4A 2O1FA 1ZHJA 5IDTA 1MP5A 5CQMX 1NHEB 1TZFA 3RMVA 5CQLX 1FGGA 2QGIA 3V8YA 2VS4A 1GWVA 4G3SA 4HO0A 2FYDB 5FTVA 4IRQA 4KPXA 3V91A 1ZJ0A 2RIZA 1FXOA 2V0JA 1GA8A 1G3LA 4EE4A 3R3IA 5L6VA 2YQHA 2AESA 4B4BA 5C1HA 2GGQA 1ZDFA 3NGWA 5CMIA 4CJBA 4R7PA 4KC4A 2V0IA 3OH4A 2XWNA 2RJ6A 1G1LA 2NXVA 1G0RA 4IRPA 1GWWA 2QH5A 4G3PA 2X60A 3PKQA 3V0OA 3I0HA 2ZU7A 5C1LA 2V0HA 4FROA 1ZJOA 5C49A 4EEMA 4M4KA 3Q7UA 2ICXA 2WE9A 3CKJA 2E3DA 4M28A 4G87A 2RITA 4MNDA 5I1FA 2Q4JA 4KC2A 2W0VA 1ZI3A 4Y7VA 1YP3A 2RIXA 3TZTA 3ZF8A 4P00A 4UEGA 3SXAA 3R2WA 1ZIZA 4HO3A 2W0WA 2Z86A 2VSHA 1E5KA 1O0RA 2I7BA 3I0CA 3PNNA 1EYRA
chains in the Genus database with same CATH superfamily
2GGOA 3SX7A 3U2TA 2BO6A 3PKPA 1QG8A 4ECMA 2XWLA 2XMHA 2MZBA 1VM8A 2D0JA 4BMAA 2FYAA 5CQNX 1G97A 5C1GA 3I0EA 1VZXA 1H4EA 2X5ZA 4HG6A 3V0LA 5AJPA 4EE5A 1PZYB 1G95A 3BCVA 3BRKX 1MC3A 1VICA 2YQJA 5AJOA 1YP4A 1FO8A 4YS8A 2RJ4A 3I0KA 1LZIA 3EE5A 4JISA 1H7QA 3SXGA 3V8ZA 2FFVA 1HJLA 2WAWA 1R7VA 3I0DA 1PZTA 5CQPA 1JVDA 2WGZA 1HV9A 3K8EA 1HM8A 5C38A 1R7XA 1VZUA 1TVYA 1S4PA 3OKRA 1H7EA 3JUKA 4HO6A 4D0ZA 2YQCA 3Q80A 4HCQA 5IDSA 2V0LA 4MIXA 4HO4A 1VH3A 4KQLA 2FFUA 4EEGA 5C8RA 4EEAA 1JVGA 4Y9XA 2RIYA 1ZDGA 4FRHA 5FU8A 2BO7A 1H4DA 4DECA 4FRDA 2I5KA 2APCA 2Y7AA 1H3MA 4EEOA 2VK9A 2VFZA 4Y7TA 3Q4SA 3JTJA 3POLA 5J49A 4FRLA 3V0MA 4FRPA 4B4GA 2VXLA 2FYBA 1HM9A 4FRQA 1V84A 4D48A 1R7UA 3SPTA 5C4BA 5D91A 5IFYA 2Y4LA 1H5TB 4KXOA 2I5EA 5CMFX 4FRBA 4Y7GA 2AGDA 4MYBA 4Y7UA 2YESA 2AM5A 2RJ7A 5FYEA 3CKQA 4P02A 3CKOA 4O6MA 4O6NA 1R81A 5FU0A 4Y7FA 3DK5A 5C4CA 1ZCVA 2ICYA 1S4OA 1H5SA 2OI5A 1EZIA 3V0PA 1FWYA 3SXDA 2PGVA 3U0YA 1H5SD 1XZ6A 2A8UA 3E25A 4KT7A 1GQCA 2RJ0A 2P73A 3V90A 1TW5A 3T7NA 5JQQA 3OH1A 5EJZA 5FUHA 1NKHB 2PA4A 1LL0A 4E1KA 1OMXA 3OH2A 4EE3A 2VS3A 1FXJA 2C0NA 3USQA 2RJ1A 4AAWA 4Y63A 5CMHA 3IOHA 4D11C 2Y4MA 3CKNA 3U2VA 1FR9A 4KC1A 1H4CA 2Z87A 1NQIB 4XWIA 1WT1A 1NF5B 4FCEA 2OEGA 4DDZA 2YC3A 1G93A 1H7HA 1VGZA 4KPZA 5C3DA 1VGWA 2X65A 1ZI1A 2PGYA 1YROB 1ZJPA 3RMWA 1Z90A 2YQSA 1R80A 2QKXA 3U2UA 4B4MA 1W55A 2J0AA 2OEFA 5C48A 5AJNA 2RJ8A 1K4VA 3USRA 4FQWA 3U0XA 3I0FA 2X5SA 1HJJA 1ZI5A 5EJ1A 4B5BA 3DJ4A 1QGQA 1FRWA 1LZJA 5BXCA 2XWMA 3OAMA 1R7TA 3LW6A 4FIYA 1H5RB 1VGTA 1W77A 1R82A 2CU2A 4KNXA 4AYLA 1GQ9A 1H7FA 2JCOA 4HO2A 3F1CA 1IIMA 1ZJ2A 3SXCA 3ZLKA 1JYLA 1MP3A 3QVBA 3ZGFA 1WT3A 5DDTA 1V82A 3OC9A 4NAKA 5L6SA 1FGXA 2DPWA 1QWJA 3CU0A 4B3UA 5C3AA 2AECA 4NANA 1FR8A 1FZWA 5C4FA 4B2WA 4AC3A 4CVHA 1ZI4A 3U2XA 1IINA 4HOCA 4HO8A 4JD0A 4M2BA 1JYKA 4L41C 4EVWA 3SX3A 4M2AA 4B42A 1H5SC 2BO4A 1R7YA 2AH9A 1VPAA 2AE7A 3I0IX 1G9RA 3I0GA 3GUEA 4HO9A 4KNRA 2A8WA 2WEEA 1LZ7A 1GX0A 2PX7A 3CKVA 1FG5N 3IOJA 1ZCUA 1G23A 3SXBA 1FO9A 2WVLA 4CJ8A 1H5TA 2YCMA 1WT2A 2JCLA 1MP4A 1VZTA 1W57A 2WVKA 3IOIA 3SX8A 1OMZA 1TW1A 1LVWA 3JUJA 1FOAA 1O23B 2OI7A 3D98A 5CMGX 5DDVA 5C36A 5C47A 2ZU9A 1G2VA 3E26A 3KIAA 2FYCB 3OH3A 3RSBA 4NAIA 1HM0A 1ZJ3A 2P6WA 1LL2A 2E8BA 2VS5A 5C4EA 4LW3A 5C3BA 2ZU8A 3OH0A 4FIXA 1ZJ1A 3N9WA 1H5SB 4J18A 1SS9A 4CJCA 5D92A 1WT0A 1G8OA 3F1YA 4LW6A 1VH1A 1INJA 3V0NA 2D7IA 1INIA 5FTSA 1JV3A 1H7GA 2YC5A 1QGSA 3ZGGA 4G3QA 4FRMA 3DUVA 2O1GA 4Y64A 1WVCA 3U2WA 2RJ5A 1I52A 2XMEA 4ZDQA 3I0JA 4D0TA 3FOQA 3ST8A 3T7MA 4BQHA 3TQDA 4AYJA 1ON6A 4GBPA 2RJ9A 1XHBA 4HO5A 4ARWA 4KRVA 3SX5A 4C2SA 4FRAA 1H7TA 3K8DA 1OQMB 1NWGB 4K6RA 3OGZA 1O7QA 1GX4A 1WSZA 2AM4A 2Y4KA 1YP2A 1S4NA 4NALA 4FCUA 2JCJA 1ZCYA 1ZCTA 3V0QA 3FWWA 2VSIA 3CGXA 5HS2A 1H5RA 5FV9A 2UX8A 1KWSA 2D7RA 2WVMA 2AM3A 2Y4JA 4FREA 3SXEA 4D11A 2P72A 5CQOA 4DE7A 2OI6A 1LL3A 1H7LA 1JV1A 4B2XA 4Y6NA 3HL3A 2Y6PA 3D5NA 3D8VA 4ASJA 3O3PA 1V83A 1LZ0A 3I0LA 3ZLLA 3T7OA 1ON8A 4ASYA 2O1HA 4Y6UA 1NMMB 5C4DA 1O7OA 2JCKA 2VXMA 1VGUA 5CMJA 2FY7A 2BO8A 2J0BA 4Y62A 5EIYA 2V0KA 2VD4A 2O1FA 1ZHJA 5IDTA 1MP5A 5CQMX 1NHEB 1TZFA 3RMVA 5CQLX 1FGGA 2QGIA 3V8YA 2VS4A 1GWVA 4G3SA 4HO0A 2FYDB 5FTVA 4IRQA 4KPXA 3V91A 1ZJ0A 2RIZA 1FXOA 2V0JA 1GA8A 1G3LA 4EE4A 3R3IA 5L6VA 2YQHA 2AESA 4B4BA 5C1HA 2GGQA 1ZDFA 3NGWA 5CMIA 4CJBA 4R7PA 4KC4A 2V0IA 3OH4A 2XWNA 4Q7CA 2RJ6A 1G1LA 2NXVA 1G0RA 4IRPA 1GWWA 2QH5A 4G3PA 2X60A 3PKQA 3V0OA 3I0HA 2ZU7A 5C1LA 2V0HA 4FROA 1ZJOA 5C49A 4EEMA 4M4KA 3Q7UA 2ICXA 2WE9A 3CKJA 2E3DA 4M28A 4G87A 2RITA 4MNDA 5I1FA 2Q4JA 4KC2A 2W0VA 1ZI3A 4Y7VA 1YP3A 2RIXA 3TZTA 3ZF8A 4P00A 4UEGA 3SXAA 3R2WA 1ZIZA 4HO3A 2W0WA 2Z86A 2VSHA 1E5KA 1O0RA 2I7BA 3I0CA 3PNNA 1EYRA
chains in the Genus database with same CATH topology
2GGOA 3SX7A 3U2TA 2BO6A 3PKPA 1QG8A 4ECMA 2XWLA 2XMHA 2MZBA 1VM8A 2D0JA 4BMAA 2FYAA 5CQNX 1G97A 5C1GA 3I0EA 1VZXA 1H4EA 2X5ZA 4HG6A 3V0LA 5AJPA 4EE5A 1PZYB 1G95A 3BCVA 3BRKX 1MC3A 1VICA 2YQJA 5AJOA 1YP4A 1FO8A 4YS8A 2RJ4A 3I0KA 1LZIA 3EE5A 4JISA 1H7QA 3SXGA 3V8ZA 2FFVA 1HJLA 2WAWA 1R7VA 3I0DA 1PZTA 5CQPA 1JVDA 2WGZA 1HV9A 3K8EA 1HM8A 5C38A 1R7XA 1VZUA 1TVYA 1S4PA 3OKRA 1H7EA 3JUKA 4HO6A 4D0ZA 2YQCA 3Q80A 4HCQA 5IDSA 2V0LA 4MIXA 4HO4A 1VH3A 4KQLA 2FFUA 4EEGA 5C8RA 4EEAA 1JVGA 4Y9XA 2RIYA 1ZDGA 4FRHA 5FU8A 2BO7A 1H4DA 4DECA 4FRDA 2I5KA 2APCA 2Y7AA 1H3MA 4EEOA 2VK9A 2VFZA 4Y7TA 3Q4SA 3JTJA 3POLA 5J49A 4FRLA 3V0MA 4FRPA 4B4GA 2VXLA 2FYBA 1HM9A 4FRQA 1V84A 4D48A 1R7UA 3SPTA 5C4BA 5D91A 5IFYA 2Y4LA 1H5TB 4KXOA 2I5EA 5CMFX 4FRBA 4Y7GA 2AGDA 4MYBA 4Y7UA 2YESA 2AM5A 2RJ7A 5FYEA 3CKQA 4P02A 3CKOA 4O6MA 4O6NA 1R81A 5FU0A 4Y7FA 3DK5A 5C4CA 1ZCVA 2ICYA 1S4OA 1H5SA 2OI5A 1EZIA 3V0PA 1FWYA 3SXDA 2PGVA 3U0YA 1H5SD 1XZ6A 2A8UA 3E25A 4KT7A 1GQCA 2RJ0A 2P73A 3V90A 1TW5A 3T7NA 5JQQA 3OH1A 5EJZA 5FUHA 1NKHB 2PA4A 1LL0A 4E1KA 1OMXA 3OH2A 4EE3A 2VS3A 1FXJA 2C0NA 3USQA 2RJ1A 4AAWA 4Y63A 5CMHA 3IOHA 4D11C 2Y4MA 3CKNA 3U2VA 1FR9A 4KC1A 1H4CA 2Z87A 1NQIB 4XWIA 1WT1A 1NF5B 4FCEA 2OEGA 4DDZA 2YC3A 1G93A 1H7HA 1VGZA 4KPZA 5C3DA 1VGWA 2X65A 1ZI1A 2PGYA 1YROB 1ZJPA 3RMWA 1Z90A 2YQSA 1R80A 2QKXA 3U2UA 4B4MA 1W55A 2J0AA 2OEFA 5C48A 5AJNA 2RJ8A 1K4VA 3USRA 4FQWA 3U0XA 3I0FA 2X5SA 1HJJA 1ZI5A 5EJ1A 4B5BA 3DJ4A 1QGQA 1FRWA 1LZJA 5BXCA 2XWMA 3OAMA 1R7TA 3LW6A 4FIYA 1H5RB 1VGTA 1W77A 1R82A 2CU2A 4KNXA 4AYLA 1GQ9A 1H7FA 2JCOA 4HO2A 3F1CA 1IIMA 1ZJ2A 3SXCA 3ZLKA 1JYLA 1MP3A 3QVBA 3ZGFA 1WT3A 5DDTA 1V82A 3OC9A 4NAKA 5L6SA 1FGXA 2DPWA 1QWJA 3CU0A 4B3UA 5C3AA 2AECA 4NANA 1FR8A 1FZWA 5C4FA 4B2WA 4AC3A 4CVHA 1ZI4A 3U2XA 1IINA 4HOCA 4HO8A 4JD0A 4M2BA 1JYKA 4L41C 4EVWA 3SX3A 4M2AA 4B42A 1H5SC 2BO4A 1R7YA 2AH9A 1VPAA 2AE7A 3I0IX 1G9RA 3I0GA 3GUEA 4HO9A 4KNRA 2A8WA 2WEEA 1LZ7A 1GX0A 2PX7A 3CKVA 1FG5N 3IOJA 1ZCUA 1G23A 3SXBA 1FO9A 2WVLA 4CJ8A 1H5TA 2YCMA 1WT2A 2JCLA 1MP4A 1VZTA 1W57A 2WVKA 3IOIA 3SX8A 1OMZA 1TW1A 1LVWA 3JUJA 1FOAA 1O23B 2OI7A 3D98A 5CMGX 5DDVA 5C36A 5C47A 2ZU9A 1G2VA 3E26A 3KIAA 2FYCB 3OH3A 3RSBA 4NAIA 1HM0A 1ZJ3A 2P6WA 1LL2A 2E8BA 2VS5A 5C4EA 4LW3A 5C3BA 2ZU8A 3OH0A 4FIXA 1ZJ1A 3N9WA 1H5SB 4J18A 1SS9A 4CJCA 5D92A 1WT0A 1G8OA 3F1YA 4LW6A 1VH1A 1INJA 3V0NA 2D7IA 1INIA 5FTSA 1JV3A 1H7GA 2YC5A 1QGSA 3ZGGA 4G3QA 4FRMA 3DUVA 2O1GA 4Y64A 1WVCA 3U2WA 2RJ5A 1I52A 2XMEA 4ZDQA 3I0JA 4D0TA 3FOQA 3ST8A 3T7MA 4BQHA 3TQDA 4AYJA 1ON6A 4GBPA 2RJ9A 1XHBA 4HO5A 4ARWA 4KRVA 3SX5A 4C2SA 4FRAA 1H7TA 3K8DA 1OQMB 1NWGB 4K6RA 3OGZA 1O7QA 1GX4A 1WSZA 2AM4A 2Y4KA 1YP2A 1S4NA 4NALA 4FCUA 2JCJA 1ZCYA 1ZCTA 3V0QA 3FWWA 2VSIA 3CGXA 5HS2A 1H5RA 5FV9A 2UX8A 1KWSA 2D7RA 2WVMA 2AM3A 2Y4JA 4FREA 3SXEA 4D11A 2P72A 5CQOA 4DE7A 2OI6A 1LL3A 1H7LA 1JV1A 4B2XA 4Y6NA 3HL3A 2Y6PA 3D5NA 3D8VA 4ASJA 3O3PA 1V83A 1LZ0A 3I0LA 3ZLLA 3T7OA 1ON8A 4ASYA 2O1HA 4Y6UA 1NMMB 5C4DA 1O7OA 2JCKA 2VXMA 1VGUA 5CMJA 2FY7A 2BO8A 2J0BA 4Y62A 5EIYA 2V0KA 2VD4A 2O1FA 1ZHJA 5IDTA 1MP5A 5CQMX 1NHEB 1TZFA 3RMVA 5CQLX 1FGGA 2QGIA 3V8YA 2VS4A 1GWVA 4G3SA 4HO0A 2FYDB 5FTVA 4IRQA 4KPXA 3V91A 1ZJ0A 2RIZA 1FXOA 2V0JA 1GA8A 1G3LA 4EE4A 3R3IA 5L6VA 2YQHA 2AESA 4B4BA 5C1HA 2GGQA 1ZDFA 3NGWA 5CMIA 4CJBA 4R7PA 4KC4A 2V0IA 3OH4A 2XWNA 4Q7CA 2RJ6A 1G1LA 2NXVA 1G0RA 4IRPA 1GWWA 2QH5A 4G3PA 2X60A 3PKQA 3V0OA 3I0HA 2ZU7A 5C1LA 2V0HA 4FROA 1ZJOA 5C49A 4EEMA 4M4KA 3Q7UA 2ICXA 2WE9A 3CKJA 2E3DA 4M28A 4G87A 2RITA 4MNDA 5I1FA 2Q4JA 4KC2A 2W0VA 1ZI3A 4Y7VA 1YP3A 2RIXA 3TZTA 3ZF8A 4P00A 4UEGA 3SXAA 3R2WA 1ZIZA 4HO3A 2W0WA 2Z86A 2VSHA 1E5KA 1O0RA 2I7BA 3I0CA 3PNNA 1EYRA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2GGO A;  3SX7 A;  3U2T A;  2BO6 A;  3PKP A;  1QG8 A;  4ECM A;  2XWL A;  2XMH A;  2MZB A;  1VM8 A;  2D0J A;  4BMA A;  2FYA A;  5CQN X;  1G97 A;  5C1G A;  3I0E A;  1VZX A;  1H4E A;  2X5Z A;  4HG6 A;  3V0L A;  5AJP A;  4EE5 A;  1PZY B;  1G95 A;  3BCV A;  3BRK X;  1MC3 A;  1VIC A;  2YQJ A;  5AJO A;  1YP4 A;  1FO8 A;  4YS8 A;  2RJ4 A;  3I0K A;  1LZI A;  3EE5 A;  4JIS A;  1H7Q A;  3SXG A;  3V8Z A;  2FFV A;  1HJL A;  2WAW A;  1R7V A;  3I0D A;  1PZT A;  5CQP A;  1JVD A;  2WGZ A;  1HV9 A;  3K8E A;  1HM8 A;  5C38 A;  1R7X A;  1VZU A;  1TVY A;  1S4P A;  3OKR A;  1H7E A;  3JUK A;  4HO6 A;  4D0Z A;  2YQC A;  3Q80 A;  4HCQ A;  5IDS A;  2V0L A;  4HO4 A;  1VH3 A;  4KQL A;  2FFU A;  4EEG A;  5C8R A;  4EEA A;  1JVG A;  4Y9X A;  2RIY A;  1ZDG A;  4FRH A;  5FU8 A;  2BO7 A;  1H4D A;  4DEC A;  4FRD A;  2I5K A;  2APC A;  2Y7A A;  1H3M A;  4EEO A;  2VFZ A;  4Y7T A;  3Q4S A;  3JTJ A;  3POL A;  5J49 A;  4FRL A;  3V0M A;  4FRP A;  4B4G A;  2VXL A;  2FYB A;  1HM9 A;  4FRQ A;  1V84 A;  4D48 A;  1R7U A;  3SPT A;  5C4B A;  5IFY A;  2Y4L A;  1H5T B;  4KXO A;  2I5E A;  5CMF X;  4FRB A;  4Y7G A;  2AGD A;  4MYB A;  4Y7U A;  2YES A;  2AM5 A;  2RJ7 A;  5FYE A;  3CKQ A;  4P02 A;  3CKO A;  1R81 A;  5FU0 A;  4Y7F A;  3DK5 A;  5C4C A;  1ZCV A;  2ICY A;  1S4O A;  1H5S A;  2OI5 A;  1EZI A;  3V0P A;  1FWY A;  3SXD A;  2PGV A;  3U0Y A;  1H5S D;  1XZ6 A;  2A8U A;  3E25 A;  4KT7 A;  1GQC A;  2RJ0 A;  2P73 A;  3V90 A;  1TW5 A;  3T7N A;  5JQQ A;  3OH1 A;  5EJZ A;  5FUH A;  1NKH B;  2PA4 A;  1LL0 A;  4E1K A;  1OMX A;  3OH2 A;  4EE3 A;  2VS3 A;  1FXJ A;  3USQ A;  2RJ1 A;  4AAW A;  4Y63 A;  5CMH A;  3IOH A;  4D11 C;  2Y4M A;  3CKN A;  3U2V A;  1FR9 A;  4KC1 A;  1H4C A;  2Z87 A;  1NQI B;  4XWI A;  1WT1 A;  1NF5 B;  4FCE A;  2OEG A;  4DDZ A;  2YC3 A;  1G93 A;  1H7H A;  1VGZ A;  4KPZ A;  5C3D A;  1VGW A;  2X65 A;  1ZI1 A;  2PGY A;  1YRO B;  1ZJP A;  3RMW A;  1Z90 A;  2YQS A;  1R80 A;  2QKX A;  3U2U A;  4B4M A;  1W55 A;  2OEF A;  5C48 A;  5AJN A;  2RJ8 A;  1K4V A;  3USR A;  4FQW A;  3U0X A;  3I0F A;  2X5S A;  1HJJ A;  1ZI5 A;  5EJ1 A;  4B5B A;  3DJ4 A;  1QGQ A;  1FRW A;  1LZJ A;  5BXC A;  2XWM A;  3OAM A;  1R7T A;  3LW6 A;  1H5R B;  1VGT A;  1W77 A;  1R82 A;  2CU2 A;  4KNX A;  4AYL A;  1GQ9 A;  1H7F A;  2JCO A;  4HO2 A;  3F1C A;  1IIM A;  1ZJ2 A;  3SXC A;  3ZLK A;  1JYL A;  1MP3 A;  3QVB A;  3ZGF A;  1WT3 A;  5DDT A;  1V82 A;  3OC9 A;  4NAK A;  5L6S A;  1FGX A;  2DPW A;  1QWJ A;  3CU0 A;  4B3U A;  5C3A A;  2AEC A;  4NAN A;  1FR8 A;  1FZW A;  5C4F A;  4B2W A;  4AC3 A;  4CVH A;  1ZI4 A;  3U2X A;  1IIN A;  4HOC A;  4HO8 A;  4JD0 A;  4M2B A;  1JYK A;  4L41 C;  4EVW A;  3SX3 A;  4M2A A;  4B42 A;  1H5S C;  2BO4 A;  1R7Y A;  2AH9 A;  1VPA A;  2AE7 A;  3I0I X;  1G9R A;  3I0G A;  3GUE A;  4HO9 A;  4KNR A;  2A8W A;  2WEE A;  1LZ7 A;  1GX0 A;  2PX7 A;  3CKV A;  1FG5 N;  3IOJ A;  1ZCU A;  1G23 A;  3SXB A;  1FO9 A;  2WVL A;  4CJ8 A;  1H5T A;  2YCM A;  1WT2 A;  2JCL A;  1MP4 A;  1VZT A;  1W57 A;  2WVK A;  3IOI A;  3SX8 A;  1OMZ A;  1TW1 A;  1LVW A;  3JUJ A;  1FOA A;  1O23 B;  2OI7 A;  3D98 A;  5CMG X;  5DDV A;  5C36 A;  5C47 A;  2ZU9 A;  1G2V A;  3E26 A;  3KIA A;  2FYC B;  3OH3 A;  3RSB A;  4NAI A;  1HM0 A;  1ZJ3 A;  2P6W A;  1LL2 A;  2E8B A;  2VS5 A;  5C4E A;  4LW3 A;  5C3B A;  2ZU8 A;  3OH0 A;  1ZJ1 A;  3N9W A;  1H5S B;  4J18 A;  1SS9 A;  4CJC A;  1WT0 A;  1G8O A;  3F1Y A;  4LW6 A;  1VH1 A;  1INJ A;  3V0N A;  2D7I A;  1INI A;  5FTS A;  1JV3 A;  1H7G A;  2YC5 A;  1QGS A;  3ZGG A;  4G3Q A;  4FRM A;  3DUV A;  2O1G A;  4Y64 A;  1WVC A;  3U2W A;  2RJ5 A;  1I52 A;  2XME A;  4ZDQ A;  3I0J A;  4D0T A;  3FOQ A;  3ST8 A;  3T7M A;  4BQH A;  3TQD A;  4AYJ A;  1ON6 A;  4GBP A;  2RJ9 A;  1XHB A;  4HO5 A;  4ARW A;  4KRV A;  3SX5 A;  4C2S A;  4FRA A;  1H7T A;  3K8D A;  1OQM B;  1NWG B;  4K6R A;  3OGZ A;  1O7Q A;  1GX4 A;  1WSZ A;  2AM4 A;  2Y4K A;  1YP2 A;  1S4N A;  4NAL A;  4FCU A;  2JCJ A;  1ZCY A;  1ZCT A;  3V0Q A;  3FWW A;  2VSI A;  3CGX A;  5HS2 A;  1H5R A;  5FV9 A;  2UX8 A;  1KWS A;  2D7R A;  2WVM A;  2AM3 A;  2Y4J A;  4FRE A;  3SXE A;  4D11 A;  2P72 A;  5CQO A;  4DE7 A;  2OI6 A;  1LL3 A;  1H7L A;  1JV1 A;  4B2X A;  4Y6N A;  3HL3 A;  2Y6P A;  3D5N A;  3D8V A;  4ASJ A;  3O3P A;  1V83 A;  1LZ0 A;  3I0L A;  3ZLL A;  3T7O A;  1ON8 A;  4ASY A;  2O1H A;  4Y6U A;  1NMM B;  5C4D A;  1O7O A;  2JCK A;  2VXM A;  1VGU A;  5CMJ A;  2FY7 A;  2BO8 A;  4Y62 A;  5EIY A;  2V0K A;  2VD4 A;  2O1F A;  1ZHJ A;  5IDT A;  1MP5 A;  5CQM X;  1NHE B;  1TZF A;  3RMV A;  5CQL X;  1FGG A;  2QGI A;  3V8Y A;  2VS4 A;  1GWV A;  4G3S A;  4HO0 A;  2FYD B;  5FTV A;  4IRQ A;  4KPX A;  3V91 A;  1ZJ0 A;  2RIZ A;  1FXO A;  2V0J A;  1GA8 A;  1G3L A;  4EE4 A;  3R3I A;  5L6V A;  2YQH A;  2AES A;  4B4B A;  5C1H A;  2GGQ A;  1ZDF A;  3NGW A;  5CMI A;  4CJB A;  4R7P A;  4KC4 A;  2V0I A;  3OH4 A;  2XWN A;  2RJ6 A;  1G1L A;  2NXV A;  1G0R A;  4IRP A;  1GWW A;  2QH5 A;  4G3P A;  2X60 A;  3PKQ A;  3V0O A;  3I0H A;  2ZU7 A;  5C1L A;  2V0H A;  4FRO A;  1ZJO A;  5C49 A;  4EEM A;  4M4K A;  3Q7U A;  2ICX A;  2WE9 A;  3CKJ A;  2E3D A;  4M28 A;  4G87 A;  2RIT A;  4MND A;  5I1F A;  2Q4J A;  4KC2 A;  2W0V A;  1ZI3 A;  4Y7V A;  1YP3 A;  2RIX A;  3TZT A;  3ZF8 A;  4P00 A;  4UEG A;  3SXA A;  3R2W A;  1ZIZ A;  4HO3 A;  2W0W A;  2Z86 A;  2VSH A;  1E5K A;  1O0R A;  2I7B A;  3I0C A;  3PNN A;  1EYR A; 
#chains in the Genus database with same CATH topology
 2GGO A;  3SX7 A;  3U2T A;  2BO6 A;  3PKP A;  1QG8 A;  4ECM A;  2XWL A;  2XMH A;  2MZB A;  1VM8 A;  2D0J A;  4BMA A;  2FYA A;  5CQN X;  1G97 A;  5C1G A;  3I0E A;  1VZX A;  1H4E A;  2X5Z A;  4HG6 A;  3V0L A;  5AJP A;  4EE5 A;  1PZY B;  1G95 A;  3BCV A;  3BRK X;  1MC3 A;  1VIC A;  2YQJ A;  5AJO A;  1YP4 A;  1FO8 A;  4YS8 A;  2RJ4 A;  3I0K A;  1LZI A;  3EE5 A;  4JIS A;  1H7Q A;  3SXG A;  3V8Z A;  2FFV A;  1HJL A;  2WAW A;  1R7V A;  3I0D A;  1PZT A;  5CQP A;  1JVD A;  2WGZ A;  1HV9 A;  3K8E A;  1HM8 A;  5C38 A;  1R7X A;  1VZU A;  1TVY A;  1S4P A;  3OKR A;  1H7E A;  3JUK A;  4HO6 A;  4D0Z A;  2YQC A;  3Q80 A;  4HCQ A;  5IDS A;  2V0L A;  4MIX A;  4HO4 A;  1VH3 A;  4KQL A;  2FFU A;  4EEG A;  5C8R A;  4EEA A;  1JVG A;  4Y9X A;  2RIY A;  1ZDG A;  4FRH A;  5FU8 A;  2BO7 A;  1H4D A;  4DEC A;  4FRD A;  2I5K A;  2APC A;  2Y7A A;  1H3M A;  4EEO A;  2VK9 A;  2VFZ A;  4Y7T A;  3Q4S A;  3JTJ A;  3POL A;  5J49 A;  4FRL A;  3V0M A;  4FRP A;  4B4G A;  2VXL A;  2FYB A;  1HM9 A;  4FRQ A;  1V84 A;  4D48 A;  1R7U A;  3SPT A;  5C4B A;  5D91 A;  5IFY A;  2Y4L A;  1H5T B;  4KXO A;  2I5E A;  5CMF X;  4FRB A;  4Y7G A;  2AGD A;  4MYB A;  4Y7U A;  2YES A;  2AM5 A;  2RJ7 A;  5FYE A;  3CKQ A;  4P02 A;  3CKO A;  4O6M A;  4O6N A;  1R81 A;  5FU0 A;  4Y7F A;  3DK5 A;  5C4C A;  1ZCV A;  2ICY A;  1S4O A;  1H5S A;  2OI5 A;  1EZI A;  3V0P A;  1FWY A;  3SXD A;  2PGV A;  3U0Y A;  1H5S D;  1XZ6 A;  2A8U A;  3E25 A;  4KT7 A;  1GQC A;  2RJ0 A;  2P73 A;  3V90 A;  1TW5 A;  3T7N A;  5JQQ A;  3OH1 A;  5EJZ A;  5FUH A;  1NKH B;  2PA4 A;  1LL0 A;  4E1K A;  1OMX A;  3OH2 A;  4EE3 A;  2VS3 A;  1FXJ A;  2C0N A;  3USQ A;  2RJ1 A;  4AAW A;  4Y63 A;  5CMH A;  3IOH A;  4D11 C;  2Y4M A;  3CKN A;  3U2V A;  1FR9 A;  4KC1 A;  1H4C A;  2Z87 A;  1NQI B;  4XWI A;  1WT1 A;  1NF5 B;  4FCE A;  2OEG A;  4DDZ A;  2YC3 A;  1G93 A;  1H7H A;  1VGZ A;  4KPZ A;  5C3D A;  1VGW A;  2X65 A;  1ZI1 A;  2PGY A;  1YRO B;  1ZJP A;  3RMW A;  1Z90 A;  2YQS A;  1R80 A;  2QKX A;  3U2U A;  4B4M A;  1W55 A;  2J0A A;  2OEF A;  5C48 A;  5AJN A;  2RJ8 A;  1K4V A;  3USR A;  4FQW A;  3U0X A;  3I0F A;  2X5S A;  1HJJ A;  1ZI5 A;  5EJ1 A;  4B5B A;  3DJ4 A;  1QGQ A;  1FRW A;  1LZJ A;  5BXC A;  2XWM A;  3OAM A;  1R7T A;  3LW6 A;  4FIY A;  1H5R B;  1VGT A;  1W77 A;  1R82 A;  2CU2 A;  4KNX A;  4AYL A;  1GQ9 A;  1H7F A;  2JCO A;  4HO2 A;  3F1C A;  1IIM A;  1ZJ2 A;  3SXC A;  3ZLK A;  1JYL A;  1MP3 A;  3QVB A;  3ZGF A;  1WT3 A;  5DDT A;  1V82 A;  3OC9 A;  4NAK A;  5L6S A;  1FGX A;  2DPW A;  1QWJ A;  3CU0 A;  4B3U A;  5C3A A;  2AEC A;  4NAN A;  1FR8 A;  1FZW A;  5C4F A;  4B2W A;  4AC3 A;  4CVH A;  1ZI4 A;  3U2X A;  1IIN A;  4HOC A;  4HO8 A;  4JD0 A;  4M2B A;  1JYK A;  4L41 C;  4EVW A;  3SX3 A;  4M2A A;  4B42 A;  1H5S C;  2BO4 A;  1R7Y A;  2AH9 A;  1VPA A;  2AE7 A;  3I0I X;  1G9R A;  3I0G A;  3GUE A;  4HO9 A;  4KNR A;  2A8W A;  2WEE A;  1LZ7 A;  1GX0 A;  2PX7 A;  3CKV A;  1FG5 N;  3IOJ A;  1ZCU A;  1G23 A;  3SXB A;  1FO9 A;  2WVL A;  4CJ8 A;  1H5T A;  2YCM A;  1WT2 A;  2JCL A;  1MP4 A;  1VZT A;  1W57 A;  2WVK A;  3IOI A;  3SX8 A;  1OMZ A;  1TW1 A;  1LVW A;  3JUJ A;  1FOA A;  1O23 B;  2OI7 A;  3D98 A;  5CMG X;  5DDV A;  5C36 A;  5C47 A;  2ZU9 A;  1G2V A;  3E26 A;  3KIA A;  2FYC B;  3OH3 A;  3RSB A;  4NAI A;  1HM0 A;  1ZJ3 A;  2P6W A;  1LL2 A;  2E8B A;  2VS5 A;  5C4E A;  4LW3 A;  5C3B A;  2ZU8 A;  3OH0 A;  4FIX A;  1ZJ1 A;  3N9W A;  1H5S B;  4J18 A;  1SS9 A;  4CJC A;  5D92 A;  1WT0 A;  1G8O A;  3F1Y A;  4LW6 A;  1VH1 A;  1INJ A;  3V0N A;  2D7I A;  1INI A;  5FTS A;  1JV3 A;  1H7G A;  2YC5 A;  1QGS A;  3ZGG A;  4G3Q A;  4FRM A;  3DUV A;  2O1G A;  4Y64 A;  1WVC A;  3U2W A;  2RJ5 A;  1I52 A;  2XME A;  4ZDQ A;  3I0J A;  4D0T A;  3FOQ A;  3ST8 A;  3T7M A;  4BQH A;  3TQD A;  4AYJ A;  1ON6 A;  4GBP A;  2RJ9 A;  1XHB A;  4HO5 A;  4ARW A;  4KRV A;  3SX5 A;  4C2S A;  4FRA A;  1H7T A;  3K8D A;  1OQM B;  1NWG B;  4K6R A;  3OGZ A;  1O7Q A;  1GX4 A;  1WSZ A;  2AM4 A;  2Y4K A;  1YP2 A;  1S4N A;  4NAL A;  4FCU A;  2JCJ A;  1ZCY A;  1ZCT A;  3V0Q A;  3FWW A;  2VSI A;  3CGX A;  5HS2 A;  1H5R A;  5FV9 A;  2UX8 A;  1KWS A;  2D7R A;  2WVM A;  2AM3 A;  2Y4J A;  4FRE A;  3SXE A;  4D11 A;  2P72 A;  5CQO A;  4DE7 A;  2OI6 A;  1LL3 A;  1H7L A;  1JV1 A;  4B2X A;  4Y6N A;  3HL3 A;  2Y6P A;  3D5N A;  3D8V A;  4ASJ A;  3O3P A;  1V83 A;  1LZ0 A;  3I0L A;  3ZLL A;  3T7O A;  1ON8 A;  4ASY A;  2O1H A;  4Y6U A;  1NMM B;  5C4D A;  1O7O A;  2JCK A;  2VXM A;  1VGU A;  5CMJ A;  2FY7 A;  2BO8 A;  2J0B A;  4Y62 A;  5EIY A;  2V0K A;  2VD4 A;  2O1F A;  1ZHJ A;  5IDT A;  1MP5 A;  5CQM X;  1NHE B;  1TZF A;  3RMV A;  5CQL X;  1FGG A;  2QGI A;  3V8Y A;  2VS4 A;  1GWV A;  4G3S A;  4HO0 A;  2FYD B;  5FTV A;  4IRQ A;  4KPX A;  3V91 A;  1ZJ0 A;  2RIZ A;  1FXO A;  2V0J A;  1GA8 A;  1G3L A;  4EE4 A;  3R3I A;  5L6V A;  2YQH A;  2AES A;  4B4B A;  5C1H A;  2GGQ A;  1ZDF A;  3NGW A;  5CMI A;  4CJB A;  4R7P A;  4KC4 A;  2V0I A;  3OH4 A;  2XWN A;  4Q7C A;  2RJ6 A;  1G1L A;  2NXV A;  1G0R A;  4IRP A;  1GWW A;  2QH5 A;  4G3P A;  2X60 A;  3PKQ A;  3V0O A;  3I0H A;  2ZU7 A;  5C1L A;  2V0H A;  4FRO A;  1ZJO A;  5C49 A;  4EEM A;  4M4K A;  3Q7U A;  2ICX A;  2WE9 A;  3CKJ A;  2E3D A;  4M28 A;  4G87 A;  2RIT A;  4MND A;  5I1F A;  2Q4J A;  4KC2 A;  2W0V A;  1ZI3 A;  4Y7V A;  1YP3 A;  2RIX A;  3TZT A;  3ZF8 A;  4P00 A;  4UEG A;  3SXA A;  3R2W A;  1ZIZ A;  4HO3 A;  2W0W A;  2Z86 A;  2VSH A;  1E5K A;  1O0R A;  2I7B A;  3I0C A;  3PNN A;  1EYR A; 
#chains in the Genus database with same CATH homology
 2GGO A;  3SX7 A;  3U2T A;  2BO6 A;  3PKP A;  1QG8 A;  4ECM A;  2XWL A;  2XMH A;  2MZB A;  1VM8 A;  2D0J A;  4BMA A;  2FYA A;  5CQN X;  1G97 A;  5C1G A;  3I0E A;  1VZX A;  1H4E A;  2X5Z A;  4HG6 A;  3V0L A;  5AJP A;  4EE5 A;  1PZY B;  1G95 A;  3BCV A;  3BRK X;  1MC3 A;  1VIC A;  2YQJ A;  5AJO A;  1YP4 A;  1FO8 A;  4YS8 A;  2RJ4 A;  3I0K A;  1LZI A;  3EE5 A;  4JIS A;  1H7Q A;  3SXG A;  3V8Z A;  2FFV A;  1HJL A;  2WAW A;  1R7V A;  3I0D A;  1PZT A;  5CQP A;  1JVD A;  2WGZ A;  1HV9 A;  3K8E A;  1HM8 A;  5C38 A;  1R7X A;  1VZU A;  1TVY A;  1S4P A;  3OKR A;  1H7E A;  3JUK A;  4HO6 A;  4D0Z A;  2YQC A;  3Q80 A;  4HCQ A;  5IDS A;  2V0L A;  4MIX A;  4HO4 A;  1VH3 A;  4KQL A;  2FFU A;  4EEG A;  5C8R A;  4EEA A;  1JVG A;  4Y9X A;  2RIY A;  1ZDG A;  4FRH A;  5FU8 A;  2BO7 A;  1H4D A;  4DEC A;  4FRD A;  2I5K A;  2APC A;  2Y7A A;  1H3M A;  4EEO A;  2VK9 A;  2VFZ A;  4Y7T A;  3Q4S A;  3JTJ A;  3POL A;  5J49 A;  4FRL A;  3V0M A;  4FRP A;  4B4G A;  2VXL A;  2FYB A;  1HM9 A;  4FRQ A;  1V84 A;  4D48 A;  1R7U A;  3SPT A;  5C4B A;  5D91 A;  5IFY A;  2Y4L A;  1H5T B;  4KXO A;  2I5E A;  5CMF X;  4FRB A;  4Y7G A;  2AGD A;  4MYB A;  4Y7U A;  2YES A;  2AM5 A;  2RJ7 A;  5FYE A;  3CKQ A;  4P02 A;  3CKO A;  4O6M A;  4O6N A;  1R81 A;  5FU0 A;  4Y7F A;  3DK5 A;  5C4C A;  1ZCV A;  2ICY A;  1S4O A;  1H5S A;  2OI5 A;  1EZI A;  3V0P A;  1FWY A;  3SXD A;  2PGV A;  3U0Y A;  1H5S D;  1XZ6 A;  2A8U A;  3E25 A;  4KT7 A;  1GQC A;  2RJ0 A;  2P73 A;  3V90 A;  1TW5 A;  3T7N A;  5JQQ A;  3OH1 A;  5EJZ A;  5FUH A;  1NKH B;  2PA4 A;  1LL0 A;  4E1K A;  1OMX A;  3OH2 A;  4EE3 A;  2VS3 A;  1FXJ A;  2C0N A;  3USQ A;  2RJ1 A;  4AAW A;  4Y63 A;  5CMH A;  3IOH A;  4D11 C;  2Y4M A;  3CKN A;  3U2V A;  1FR9 A;  4KC1 A;  1H4C A;  2Z87 A;  1NQI B;  4XWI A;  1WT1 A;  1NF5 B;  4FCE A;  2OEG A;  4DDZ A;  2YC3 A;  1G93 A;  1H7H A;  1VGZ A;  4KPZ A;  5C3D A;  1VGW A;  2X65 A;  1ZI1 A;  2PGY A;  1YRO B;  1ZJP A;  3RMW A;  1Z90 A;  2YQS A;  1R80 A;  2QKX A;  3U2U A;  4B4M A;  1W55 A;  2J0A A;  2OEF A;  5C48 A;  5AJN A;  2RJ8 A;  1K4V A;  3USR A;  4FQW A;  3U0X A;  3I0F A;  2X5S A;  1HJJ A;  1ZI5 A;  5EJ1 A;  4B5B A;  3DJ4 A;  1QGQ A;  1FRW A;  1LZJ A;  5BXC A;  2XWM A;  3OAM A;  1R7T A;  3LW6 A;  4FIY A;  1H5R B;  1VGT A;  1W77 A;  1R82 A;  2CU2 A;  4KNX A;  4AYL A;  1GQ9 A;  1H7F A;  2JCO A;  4HO2 A;  3F1C A;  1IIM A;  1ZJ2 A;  3SXC A;  3ZLK A;  1JYL A;  1MP3 A;  3QVB A;  3ZGF A;  1WT3 A;  5DDT A;  1V82 A;  3OC9 A;  4NAK A;  5L6S A;  1FGX A;  2DPW A;  1QWJ A;  3CU0 A;  4B3U A;  5C3A A;  2AEC A;  4NAN A;  1FR8 A;  1FZW A;  5C4F A;  4B2W A;  4AC3 A;  4CVH A;  1ZI4 A;  3U2X A;  1IIN A;  4HOC A;  4HO8 A;  4JD0 A;  4M2B A;  1JYK A;  4L41 C;  4EVW A;  3SX3 A;  4M2A A;  4B42 A;  1H5S C;  2BO4 A;  1R7Y A;  2AH9 A;  1VPA A;  2AE7 A;  3I0I X;  1G9R A;  3I0G A;  3GUE A;  4HO9 A;  4KNR A;  2A8W A;  2WEE A;  1LZ7 A;  1GX0 A;  2PX7 A;  3CKV A;  1FG5 N;  3IOJ A;  1ZCU A;  1G23 A;  3SXB A;  1FO9 A;  2WVL A;  4CJ8 A;  1H5T A;  2YCM A;  1WT2 A;  2JCL A;  1MP4 A;  1VZT A;  1W57 A;  2WVK A;  3IOI A;  3SX8 A;  1OMZ A;  1TW1 A;  1LVW A;  3JUJ A;  1FOA A;  1O23 B;  2OI7 A;  3D98 A;  5CMG X;  5DDV A;  5C36 A;  5C47 A;  2ZU9 A;  1G2V A;  3E26 A;  3KIA A;  2FYC B;  3OH3 A;  3RSB A;  4NAI A;  1HM0 A;  1ZJ3 A;  2P6W A;  1LL2 A;  2E8B A;  2VS5 A;  5C4E A;  4LW3 A;  5C3B A;  2ZU8 A;  3OH0 A;  4FIX A;  1ZJ1 A;  3N9W A;  1H5S B;  4J18 A;  1SS9 A;  4CJC A;  5D92 A;  1WT0 A;  1G8O A;  3F1Y A;  4LW6 A;  1VH1 A;  1INJ A;  3V0N A;  2D7I A;  1INI A;  5FTS A;  1JV3 A;  1H7G A;  2YC5 A;  1QGS A;  3ZGG A;  4G3Q A;  4FRM A;  3DUV A;  2O1G A;  4Y64 A;  1WVC A;  3U2W A;  2RJ5 A;  1I52 A;  2XME A;  4ZDQ A;  3I0J A;  4D0T A;  3FOQ A;  3ST8 A;  3T7M A;  4BQH A;  3TQD A;  4AYJ A;  1ON6 A;  4GBP A;  2RJ9 A;  1XHB A;  4HO5 A;  4ARW A;  4KRV A;  3SX5 A;  4C2S A;  4FRA A;  1H7T A;  3K8D A;  1OQM B;  1NWG B;  4K6R A;  3OGZ A;  1O7Q A;  1GX4 A;  1WSZ A;  2AM4 A;  2Y4K A;  1YP2 A;  1S4N A;  4NAL A;  4FCU A;  2JCJ A;  1ZCY A;  1ZCT A;  3V0Q A;  3FWW A;  2VSI A;  3CGX A;  5HS2 A;  1H5R A;  5FV9 A;  2UX8 A;  1KWS A;  2D7R A;  2WVM A;  2AM3 A;  2Y4J A;  4FRE A;  3SXE A;  4D11 A;  2P72 A;  5CQO A;  4DE7 A;  2OI6 A;  1LL3 A;  1H7L A;  1JV1 A;  4B2X A;  4Y6N A;  3HL3 A;  2Y6P A;  3D5N A;  3D8V A;  4ASJ A;  3O3P A;  1V83 A;  1LZ0 A;  3I0L A;  3ZLL A;  3T7O A;  1ON8 A;  4ASY A;  2O1H A;  4Y6U A;  1NMM B;  5C4D A;  1O7O A;  2JCK A;  2VXM A;  1VGU A;  5CMJ A;  2FY7 A;  2BO8 A;  2J0B A;  4Y62 A;  5EIY A;  2V0K A;  2VD4 A;  2O1F A;  1ZHJ A;  5IDT A;  1MP5 A;  5CQM X;  1NHE B;  1TZF A;  3RMV A;  5CQL X;  1FGG A;  2QGI A;  3V8Y A;  2VS4 A;  1GWV A;  4G3S A;  4HO0 A;  2FYD B;  5FTV A;  4IRQ A;  4KPX A;  3V91 A;  1ZJ0 A;  2RIZ A;  1FXO A;  2V0J A;  1GA8 A;  1G3L A;  4EE4 A;  3R3I A;  5L6V A;  2YQH A;  2AES A;  4B4B A;  5C1H A;  2GGQ A;  1ZDF A;  3NGW A;  5CMI A;  4CJB A;  4R7P A;  4KC4 A;  2V0I A;  3OH4 A;  2XWN A;  4Q7C A;  2RJ6 A;  1G1L A;  2NXV A;  1G0R A;  4IRP A;  1GWW A;  2QH5 A;  4G3P A;  2X60 A;  3PKQ A;  3V0O A;  3I0H A;  2ZU7 A;  5C1L A;  2V0H A;  4FRO A;  1ZJO A;  5C49 A;  4EEM A;  4M4K A;  3Q7U A;  2ICX A;  2WE9 A;  3CKJ A;  2E3D A;  4M28 A;  4G87 A;  2RIT A;  4MND A;  5I1F A;  2Q4J A;  4KC2 A;  2W0V A;  1ZI3 A;  4Y7V A;  1YP3 A;  2RIX A;  3TZT A;  3ZF8 A;  4P00 A;  4UEG A;  3SXA A;  3R2W A;  1ZIZ A;  4HO3 A;  2W0W A;  2Z86 A;  2VSH A;  1E5K A;  1O0R A;  2I7B A;  3I0C A;  3PNN A;  1EYR A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...