2X65A

Crystal structure of t. maritima gdp-mannose pyrophosphorylase in complex with mannose-1-phosphate.
Total Genus 112
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
112
sequence length
334
structure length
334
Chain Sequence
VMKALILAGGSGERFWPLSTPETPKQFLKLFGNKSLMRWTFERVLEEMDPKDVIVVTHKDYVERTKKELPELPDENIIAEPMKKNTAPACFIGTKLADDDEPVLVLPADHRIPDTKKFWKTVKKALDALEKYDGLFTFGIVPTRPETGYGYIEIGEELEEGVHKVAQFREKPDLETAKKFVESGRFLWNSGMFLWKAREFIEEVKVCEPSIYENLKDVDPRNFEELKKAYEKVPSISVDYAVMEKSKKVRVVKADFEWSDLGNWSSVREIEGYTEESDEVILVDSDRVFVKTHNKPIAVVGLSDVIVIDTPNGILICKEEYAQKVREVVKKLFR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords MANNOSE-1-PHOSPHATE GUANYLYLTRANSFERASE
publication title Structural Insights Into the Catalytic Mechanism of Bacterial Guanosine-Diphospho-D-Mannose Pyrophosphorylase and its Regulation by Divalent Ions.
pubmed doi rcsb
source organism Thermotoga maritima
total genus 112
structure length 334
sequence length 334
chains with identical sequence B
ec nomenclature ec 2.7.7.13: Mannose-1-phosphate guanylyltransferase.
pdb deposition date 2010-02-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00483 NTP_transferase Nucleotidyl transferase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.550.10 Alpha Beta Alpha-Beta Complex Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A 2x65A00
3U2VA 3CU0A 2ICYA 4EE5A 2V0IA 3CKNA 3F1YA 4FROA 2OI7A 2WVMA 1H5SC 3T7OA 2E3DA 2NXVA 3SXDA 3U0YA 2BO7A 4KC2A 4JISA 3DUVA 2CU2A 2Y4LA 2D7IA 2MZBA 3CKJA 2YQHA 2FYCB 1JYLA 2YQSA 1JV3A 1VZTA 2ZU7A 5FTSA 5C49A 3E25A 1YP2A 4FRBA 1H4EA 2QH5A 4LW3A 5J49A 2YC3A 1G23A 4B4GA 2YC5A 1Z90A 3K8DA 4B2WA 1LZ7A 3U2XA 2I7BA 1SS9A 2BO4A 4HO5A 5IDTA 4FQWA 3GUEA 1LZIA 2E8BA 4P02A 1G97A 5C1LA 1XZ6A 2WGZA 4KT7A 4MYBA 1V83A 4R7PA 1VGTA 1HM0A 1HM9A 2A8WA 3TZTA 4EEGA 4Y9XA 2W0WA 2ZU9A 3I0KA 3EE5A 3I0IX 3SXAA 1ZJ0A 1KWSA 2JCLA 4NAIA 2O1GA 3D8VA 2V0LA 4C2SA 3N9WA 5EJ1A 1H7GA 2AM5A 1O23B 5C4FA 1G0RA 1LL3A 1O0RA 4AAWA 4D11C 1OMXA 5C3BA 1VGZA 3D98A 2Z86A 2AH9A 4FRDA 1R80A 5CMFX 4YS8A 1WT2A 3RMWA 4IRQA 1PZYB 4FREA 3I0FA 1QGSA 1R7YA 3FOQA 3Q7UA 4B42A 1VM8A 2O1HA 1ZJPA 3JUJA 4Y63A 1H5RB 5C47A 2XWNA 1TW1A 3V0NA 2D0JA 3R2WA 2BO6A 4FRHA 4Y7FA 1H5SD 2X65A 2P73A 2Y4MA 2P72A 3T7NA 4ZDQA 4KC4A 3IOJA 3ST8A 2PGYA 3OH1A 1V82A 3T7MA 4HO3A 1JVDA 4Y7VA 2QGIA 2ZU8A 3OH2A 4HO9A 5FU8A 3NGWA 5AJNA 1FG5N 4CJ8A 4FRQA 2AESA 4NANA 4KNRA 2WVKA 2YCMA 3I0CA 3SXEA 2WAWA 2VS3A 2VSIA 1W77A 2Y7AA 3OAMA 1FR9A 4M2BA 3V8YA 2FFVA 1S4NA 3U2WA 5C4BA 4CJCA 3E26A 4FRMA 3K8EA 3V91A 3USQA 2V0HA 1FXJA 4CJBA 5FU0A 1VPAA 1JV1A 3V0OA 2FYBA 1VH1A 2PA4A 5CMIA 3I0EA 1GWWA 3PKPA 1FRWA 1HV9A 2XMEA 1R7UA 1ZJ1A 1G1LA 3QVBA 5EJZA 1O7QA 3U2TA 1S4PA 4NAKA 1I52A 1H7TA 1NMMB 5C48A 2RJ7A 2I5KA 3ZF8A 1H5RA 1TW5A 4HCQA 5AJOA 4HO6A 4KC1A 3JTJA 4UEGA 1HJJA 1FGGA 1ZI1A 2RJ0A 5C1GA 5CMHA 1WVCA 3SX5A 1WT1A 4B2XA 2GGQA 1GQ9A 4ARWA 1VGUA 3SXBA 1LVWA 2JCKA 2XWLA 1ZI5A 1VH3A 3SXGA 4DE7A 1ZCVA 3V0MA 1MP5A 2YQCA 2WE9A 3KIAA 4FCEA 4HO4A 1NF5B 1PZTA 2V0KA 4B5BA 3JUKA 1G9RA 3OC9A 3OKRA 1ZCUA 1ZJ2A 1ZIZA 2BO8A 4EEOA 1O7OA 1GX0A 3USRA 4Y7UA 2RJ8A 4HG6A 2RJ1A 2RITA 4M2AA 1H5SB 1G8OA 1WT0A 5DDTA 3O3PA 1GQCA 1V84A 3SX3A 4Y6UA 3I0GA 2AM3A 4K6RA 4D0TA 1QWJA 2W0VA 1G95A 4GBPA 4E1KA 4NALA 3RMVA 3CGXA 5HS2A 5CQNX 3IOHA 4B3UA 2FY7A 2GGOA 4KPXA 3ZGGA 1YROB 2VXLA 2VS5A 2X60A 3F1CA 1ON8A 1FWYA 1ZCYA 2FYDB 3V90A 5IFYA 1FO9A 4FCUA 1XHBA 4AC3A 1FGXA 4M4KA 1FXOA 2V0JA 4IRPA 4EEMA 2WVLA 1R7VA 2ICXA 5C38A 3RSBA 1FO8A 4G3PA 4FRAA 1ZJ3A 2JCJA 4Y64A 5L6VA 1QG8A 4L41C 1JYKA 1H7EA 2VSHA 1ZDGA 5AJPA 2VS4A 2XMHA 4P00A 1VGWA 1YP3A 4B4MA 3CKQA 1S4OA 1EZIA 5CQOA 1H4CA 2P6WA 1QGQA 3I0JA 1ZI4A 2X5SA 5C36A 3V0QA 2FYAA 2OEFA 1H5SA 1H7FA 1MP4A 1LZJA 2RIZA 2RIYA 3I0LA 3IOIA 2YESA 3FWWA 4KRVA 3ZLLA 3U0XA 5CMGX 1FOAA 1H5TB 4MNDA 4KQLA 3CKOA 5C1HA 1H7QA 5C3AA 1VZXA 1H3MA 2XWMA 5I1FA 2RIXA 5DDVA 5C4DA 2AECA 3LW6A 4KPZA 4HO8A 1INIA 1OMZA 5FTVA 4B4BA 1GA8A 3DJ4A 1INJA 1VICA 3SX8A 2APCA 1LZ0A 2RJ6A 4J18A 4EVWA 1YP4A 3SXCA 2Y4KA 1H7LA 3OH3A 1ZHJA 5CMJA 3PKQA 4LW6A 4AYLA 4EEAA 4KNXA 2Z87A 3SPTA 1TZFA 5BXCA 5FV9A 2I5EA 2OI5A 1FZWA 1G2VA 5IDSA 1TVYA 4D48A 1NWGB 1E5KA 3BRKX 4Y7TA 1WT3A 4BMAA 1IINA 1NQIB 4Y6NA 1ZJOA 3OH4A 3PNNA 2O1FA 2OEGA 5C3DA 4G3QA 2Q4JA 1NHEB 4HOCA 3SX7A 4D11A 5L6SA 3OGZA 4FRPA 3I0DA 4DECA 2Y6PA 1H7HA 2AM4A 1FR8A 2UX8A 1H5TA 1R82A 3TQDA 4D0ZA 2JCOA 1ZI3A 4Y62A 2PGVA 5C4CA 4HO2A 1W55A 2RJ5A 2YQJA 4HO0A 1G3LA 4CVHA 2QKXA 2VFZA 3CKVA 1W57A 4ASYA 1K4VA 3DK5A 5EIYA 3D5NA 1G93A 1R7XA 5C8RA 2A8UA 4EE4A 3I0HA 3V8ZA 5FUHA 4M28A 1HJLA 2WEEA 4ECMA 4XWIA 2VD4A 2AGDA 1GX4A 1R7TA 2PX7A 5CQPA 1GWVA 4Y7GA 1R81A 5CQMX 2RJ9A 3POLA 3HL3A 3V0PA 2Y4JA 3U2UA 2D7RA 2DPWA 1VZUA 3Q4SA 2X5ZA 5C4EA 3ZGFA 3BCVA 4EE3A 4FRLA 3R3IA 1ZCTA 2VXMA 4ASJA 1OQMB 2RJ4A 1MP3A 1IIMA 3Q80A 4KXOA 4AYJA 5FYEA 3ZLKA 1LL0A 3V0LA 5JQQA 1LL2A 1EYRA 1HM8A 2AE7A 2OI6A 4G87A 1NKHB 3OH0A 1ON6A 1ZDFA 4BQHA 5CQLX 1JVGA 4DDZA 1H4DA 2FFUA 4JD0A 1MC3A 4G3SA 1WSZA
chains in the Genus database with same CATH superfamily
3U2VA 3CU0A 2ICYA 4EE5A 2V0IA 3CKNA 3F1YA 4FROA 2OI7A 2WVMA 1H5SC 3T7OA 2E3DA 2NXVA 3SXDA 3U0YA 2BO7A 4KC2A 4JISA 3DUVA 2CU2A 2Y4LA 2D7IA 2MZBA 3CKJA 2YQHA 2FYCB 1JYLA 2YQSA 1JV3A 1VZTA 2ZU7A 5FTSA 5C49A 3E25A 1YP2A 4FRBA 1H4EA 2QH5A 4LW3A 5J49A 2YC3A 1G23A 4B4GA 2YC5A 1Z90A 3K8DA 4B2WA 1LZ7A 3U2XA 2I7BA 1SS9A 2BO4A 4HO5A 5IDTA 4FQWA 3GUEA 1LZIA 2E8BA 4P02A 1G97A 4O6MA 5C1LA 1XZ6A 2WGZA 4KT7A 4MYBA 1V83A 4R7PA 1VGTA 1HM0A 1HM9A 2A8WA 3TZTA 4EEGA 4Y9XA 2W0WA 2ZU9A 3I0KA 3EE5A 3I0IX 3SXAA 1ZJ0A 1KWSA 2JCLA 4NAIA 2O1GA 3D8VA 2V0LA 4C2SA 3N9WA 5EJ1A 1H7GA 2AM5A 1O23B 5C4FA 1G0RA 1LL3A 1O0RA 4AAWA 4D11C 1OMXA 5C3BA 1VGZA 2Z86A 3D98A 2AH9A 4FRDA 1R80A 5CMFX 4YS8A 1WT2A 3RMWA 4IRQA 1PZYB 4FREA 3I0FA 1QGSA 1R7YA 3FOQA 3Q7UA 5D92A 4B42A 1VM8A 2O1HA 1ZJPA 3JUJA 4Y63A 1H5RB 5C47A 2XWNA 1TW1A 3V0NA 2D0JA 3R2WA 2BO6A 4FRHA 4Y7FA 1H5SD 2X65A 2P73A 2Y4MA 2P72A 3T7NA 4ZDQA 4KC4A 3IOJA 3ST8A 2PGYA 3OH1A 1V82A 3T7MA 4HO3A 1JVDA 4Y7VA 2QGIA 2ZU8A 3OH2A 4HO9A 5FU8A 3NGWA 5AJNA 1FG5N 4CJ8A 4FRQA 2AESA 4NANA 4KNRA 2WVKA 2YCMA 3I0CA 3SXEA 2WAWA 2VS3A 2VSIA 1W77A 2Y7AA 3OAMA 1FR9A 4M2BA 3V8YA 2FFVA 1S4NA 3U2WA 5C4BA 4CJCA 3E26A 4FRMA 3K8EA 2J0BA 3V91A 3USQA 2V0HA 1FXJA 4CJBA 5FU0A 1VPAA 1JV1A 3V0OA 2FYBA 1VH1A 2PA4A 5CMIA 3I0EA 1GWWA 3PKPA 1FRWA 1HV9A 2XMEA 1R7UA 1ZJ1A 1G1LA 3QVBA 5EJZA 1O7QA 3U2TA 1S4PA 4NAKA 1I52A 1H7TA 1NMMB 5C48A 2RJ7A 2I5KA 3ZF8A 1H5RA 1TW5A 4HCQA 5AJOA 4HO6A 4KC1A 3JTJA 4UEGA 1HJJA 1FGGA 4FIXA 1ZI1A 2RJ0A 5C1GA 4MIXA 5CMHA 1WVCA 3SX5A 1WT1A 4B2XA 2GGQA 1GQ9A 4ARWA 1VGUA 3SXBA 1LVWA 2JCKA 2XWLA 1ZI5A 1VH3A 3SXGA 4DE7A 1ZCVA 3V0MA 1MP5A 2YQCA 2WE9A 3KIAA 4FCEA 4HO4A 1NF5B 1PZTA 2V0KA 4B5BA 3JUKA 1G9RA 3OC9A 3OKRA 1ZCUA 1ZJ2A 1ZIZA 2BO8A 4EEOA 1O7OA 1GX0A 3USRA 4Q7CA 4Y7UA 2RJ8A 4HG6A 2RJ1A 2RITA 4M2AA 1H5SB 1G8OA 1WT0A 5DDTA 3O3PA 1GQCA 1V84A 3SX3A 4Y6UA 3I0GA 2AM3A 4K6RA 4D0TA 1QWJA 2W0VA 1G95A 4GBPA 4E1KA 4NALA 3RMVA 3CGXA 5HS2A 5CQNX 3IOHA 4B3UA 2FY7A 2GGOA 4KPXA 3ZGGA 1YROB 2VXLA 2VS5A 2X60A 3F1CA 1ON8A 1FWYA 1ZCYA 2FYDB 3V90A 5IFYA 1FO9A 4FCUA 1XHBA 4AC3A 1FGXA 4M4KA 1FXOA 2V0JA 4IRPA 4EEMA 2WVLA 1R7VA 2ICXA 5C38A 3RSBA 4O6NA 1FO8A 4G3PA 4FRAA 1ZJ3A 2JCJA 4Y64A 5L6VA 1QG8A 4L41C 1JYKA 1H7EA 2VSHA 1ZDGA 5AJPA 2VS4A 2XMHA 4P00A 1VGWA 1YP3A 4B4MA 3CKQA 1S4OA 1EZIA 5CQOA 1H4CA 2P6WA 1QGQA 3I0JA 1ZI4A 2X5SA 5C36A 3V0QA 2FYAA 2OEFA 1H5SA 1H7FA 1MP4A 1LZJA 2RIZA 2RIYA 3I0LA 3IOIA 2YESA 3FWWA 4KRVA 3ZLLA 3U0XA 5CMGX 1FOAA 1H5TB 4MNDA 4KQLA 3CKOA 5C1HA 1H7QA 5C3AA 1VZXA 1H3MA 2XWMA 5D91A 5I1FA 2RIXA 5DDVA 2C0NA 5C4DA 2AECA 3LW6A 4KPZA 4HO8A 1INIA 1OMZA 5FTVA 4B4BA 1GA8A 3DJ4A 1INJA 1VICA 3SX8A 2VK9A 2APCA 1LZ0A 2RJ6A 4J18A 4EVWA 1YP4A 3SXCA 2Y4KA 1H7LA 3OH3A 1ZHJA 5CMJA 3PKQA 4LW6A 4AYLA 4EEAA 4KNXA 4FIYA 2Z87A 3SPTA 1TZFA 5BXCA 5FV9A 2I5EA 2OI5A 1FZWA 1G2VA 5IDSA 1TVYA 4D48A 1NWGB 1E5KA 3BRKX 4Y7TA 1WT3A 4BMAA 1IINA 1NQIB 4Y6NA 1ZJOA 3OH4A 3PNNA 2O1FA 2OEGA 5C3DA 4G3QA 2Q4JA 1NHEB 4HOCA 3SX7A 4D11A 5L6SA 3OGZA 4FRPA 3I0DA 4DECA 2Y6PA 1H7HA 2AM4A 2J0AA 1FR8A 2UX8A 1H5TA 1R82A 3TQDA 4D0ZA 2JCOA 1ZI3A 4Y62A 2PGVA 5C4CA 4HO2A 1W55A 2RJ5A 2YQJA 4HO0A 1G3LA 4CVHA 2QKXA 2VFZA 3CKVA 1W57A 4ASYA 1K4VA 3DK5A 5EIYA 3D5NA 1G93A 1R7XA 5C8RA 2A8UA 4EE4A 3I0HA 3V8ZA 5FUHA 4M28A 1HJLA 2WEEA 4ECMA 4XWIA 2VD4A 2AGDA 1GX4A 1R7TA 2PX7A 5CQPA 1GWVA 4Y7GA 1R81A 5CQMX 2RJ9A 3POLA 3HL3A 3V0PA 2Y4JA 3U2UA 2D7RA 2DPWA 1VZUA 3Q4SA 2X5ZA 5C4EA 3ZGFA 3BCVA 4EE3A 4FRLA 3R3IA 1ZCTA 2VXMA 4ASJA 1OQMB 2RJ4A 1MP3A 1IIMA 3Q80A 4KXOA 4AYJA 5FYEA 3ZLKA 1LL0A 3V0LA 5JQQA 1LL2A 1EYRA 1HM8A 2AE7A 2OI6A 4G87A 1NKHB 3OH0A 1ON6A 1ZDFA 4BQHA 5CQLX 1JVGA 4DDZA 1H4DA 2FFUA 4JD0A 1MC3A 4G3SA 1WSZA
chains in the Genus database with same CATH topology
3U2VA 3CU0A 2ICYA 4EE5A 2V0IA 3CKNA 3F1YA 4FROA 2OI7A 2WVMA 1H5SC 3T7OA 2E3DA 2NXVA 3SXDA 3U0YA 2BO7A 4KC2A 4JISA 3DUVA 2CU2A 2Y4LA 2D7IA 2MZBA 3CKJA 2YQHA 2FYCB 1JYLA 2YQSA 1JV3A 1VZTA 2ZU7A 5FTSA 5C49A 3E25A 1YP2A 4FRBA 1H4EA 2QH5A 4LW3A 5J49A 2YC3A 1G23A 4B4GA 2YC5A 1Z90A 3K8DA 4B2WA 1LZ7A 3U2XA 2I7BA 1SS9A 2BO4A 4HO5A 5IDTA 4FQWA 3GUEA 1LZIA 2E8BA 4P02A 1G97A 4O6MA 5C1LA 1XZ6A 2WGZA 4KT7A 4MYBA 1V83A 4R7PA 1VGTA 1HM0A 1HM9A 2A8WA 3TZTA 4EEGA 4Y9XA 2W0WA 2ZU9A 3I0KA 3EE5A 3I0IX 3SXAA 1ZJ0A 1KWSA 2JCLA 4NAIA 2O1GA 3D8VA 2V0LA 4C2SA 3N9WA 5EJ1A 1H7GA 2AM5A 1O23B 5C4FA 1G0RA 1LL3A 1O0RA 4AAWA 4D11C 1OMXA 5C3BA 1VGZA 2Z86A 3D98A 2AH9A 4FRDA 1R80A 5CMFX 4YS8A 1WT2A 3RMWA 4IRQA 1PZYB 4FREA 3I0FA 1QGSA 1R7YA 3FOQA 3Q7UA 5D92A 4B42A 1VM8A 2O1HA 1ZJPA 3JUJA 4Y63A 1H5RB 5C47A 2XWNA 1TW1A 3V0NA 2D0JA 3R2WA 2BO6A 4FRHA 4Y7FA 1H5SD 2X65A 2P73A 2Y4MA 2P72A 3T7NA 4ZDQA 4KC4A 3IOJA 3ST8A 2PGYA 3OH1A 1V82A 3T7MA 4HO3A 1JVDA 4Y7VA 2QGIA 2ZU8A 3OH2A 4HO9A 5FU8A 3NGWA 5AJNA 1FG5N 4CJ8A 4FRQA 2AESA 4NANA 4KNRA 2WVKA 2YCMA 3I0CA 3SXEA 2WAWA 2VS3A 2VSIA 1W77A 2Y7AA 3OAMA 1FR9A 4M2BA 3V8YA 2FFVA 1S4NA 3U2WA 5C4BA 4CJCA 3E26A 4FRMA 3K8EA 2J0BA 3V91A 3USQA 2V0HA 1FXJA 4CJBA 5FU0A 1VPAA 1JV1A 3V0OA 2FYBA 1VH1A 2PA4A 5CMIA 3I0EA 1GWWA 3PKPA 1FRWA 1HV9A 2XMEA 1R7UA 1ZJ1A 1G1LA 3QVBA 5EJZA 1O7QA 3U2TA 1S4PA 4NAKA 1I52A 1H7TA 1NMMB 5C48A 2RJ7A 2I5KA 3ZF8A 1H5RA 1TW5A 4HCQA 5AJOA 4HO6A 4KC1A 3JTJA 4UEGA 1HJJA 1FGGA 4FIXA 1ZI1A 2RJ0A 5C1GA 4MIXA 5CMHA 1WVCA 3SX5A 1WT1A 4B2XA 2GGQA 1GQ9A 4ARWA 1VGUA 3SXBA 1LVWA 2JCKA 2XWLA 1ZI5A 1VH3A 3SXGA 4DE7A 1ZCVA 3V0MA 1MP5A 2YQCA 2WE9A 3KIAA 4FCEA 4HO4A 1NF5B 1PZTA 2V0KA 4B5BA 3JUKA 1G9RA 3OC9A 3OKRA 1ZCUA 1ZJ2A 1ZIZA 2BO8A 4EEOA 1O7OA 1GX0A 3USRA 4Q7CA 4Y7UA 2RJ8A 4HG6A 2RJ1A 2RITA 4M2AA 1H5SB 1G8OA 1WT0A 5DDTA 3O3PA 1GQCA 1V84A 3SX3A 4Y6UA 3I0GA 2AM3A 4K6RA 4D0TA 1QWJA 2W0VA 1G95A 4GBPA 4E1KA 4NALA 3RMVA 3CGXA 5HS2A 5CQNX 3IOHA 4B3UA 2FY7A 2GGOA 4KPXA 3ZGGA 1YROB 2VXLA 2VS5A 2X60A 3F1CA 1ON8A 1FWYA 1ZCYA 2FYDB 3V90A 5IFYA 1FO9A 4FCUA 1XHBA 4AC3A 1FGXA 4M4KA 1FXOA 2V0JA 4IRPA 4EEMA 2WVLA 1R7VA 2ICXA 5C38A 3RSBA 4O6NA 1FO8A 4G3PA 4FRAA 1ZJ3A 2JCJA 4Y64A 5L6VA 1QG8A 4L41C 1JYKA 1H7EA 2VSHA 1ZDGA 5AJPA 2VS4A 2XMHA 4P00A 1VGWA 1YP3A 4B4MA 3CKQA 1S4OA 1EZIA 5CQOA 1H4CA 2P6WA 1QGQA 3I0JA 1ZI4A 2X5SA 5C36A 3V0QA 2FYAA 2OEFA 1H5SA 1H7FA 1MP4A 1LZJA 2RIZA 2RIYA 3I0LA 3IOIA 2YESA 3FWWA 4KRVA 3ZLLA 3U0XA 5CMGX 1FOAA 1H5TB 4MNDA 4KQLA 3CKOA 5C1HA 1H7QA 5C3AA 1VZXA 1H3MA 2XWMA 5D91A 5I1FA 2RIXA 5DDVA 2C0NA 5C4DA 2AECA 3LW6A 4KPZA 4HO8A 1INIA 1OMZA 5FTVA 4B4BA 1GA8A 3DJ4A 1INJA 1VICA 3SX8A 2VK9A 2APCA 1LZ0A 2RJ6A 4J18A 4EVWA 1YP4A 3SXCA 2Y4KA 1H7LA 3OH3A 1ZHJA 5CMJA 3PKQA 4LW6A 4AYLA 4EEAA 4KNXA 4FIYA 2Z87A 3SPTA 1TZFA 5BXCA 5FV9A 2I5EA 2OI5A 1FZWA 1G2VA 5IDSA 1TVYA 4D48A 1NWGB 1E5KA 3BRKX 4Y7TA 1WT3A 4BMAA 1IINA 1NQIB 4Y6NA 1ZJOA 3OH4A 3PNNA 2O1FA 2OEGA 5C3DA 4G3QA 2Q4JA 1NHEB 4HOCA 3SX7A 4D11A 5L6SA 3OGZA 4FRPA 3I0DA 4DECA 2Y6PA 1H7HA 2AM4A 2J0AA 1FR8A 2UX8A 1H5TA 1R82A 3TQDA 4D0ZA 2JCOA 1ZI3A 4Y62A 2PGVA 5C4CA 4HO2A 1W55A 2RJ5A 2YQJA 4HO0A 1G3LA 4CVHA 2QKXA 2VFZA 3CKVA 1W57A 4ASYA 1K4VA 3DK5A 5EIYA 3D5NA 1G93A 1R7XA 5C8RA 2A8UA 4EE4A 3I0HA 3V8ZA 5FUHA 4M28A 1HJLA 2WEEA 4ECMA 4XWIA 2VD4A 2AGDA 1GX4A 1R7TA 2PX7A 5CQPA 1GWVA 4Y7GA 1R81A 5CQMX 2RJ9A 3POLA 3HL3A 3V0PA 2Y4JA 3U2UA 2D7RA 2DPWA 1VZUA 3Q4SA 2X5ZA 5C4EA 3ZGFA 3BCVA 4EE3A 4FRLA 3R3IA 1ZCTA 2VXMA 4ASJA 1OQMB 2RJ4A 1MP3A 1IIMA 3Q80A 4KXOA 4AYJA 5FYEA 3ZLKA 1LL0A 3V0LA 5JQQA 1LL2A 1EYRA 1HM8A 2AE7A 2OI6A 4G87A 1NKHB 3OH0A 1ON6A 1ZDFA 4BQHA 5CQLX 1JVGA 4DDZA 1H4DA 2FFUA 4JD0A 1MC3A 4G3SA 1WSZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3U2V A;  3CU0 A;  2ICY A;  4EE5 A;  2V0I A;  3CKN A;  3F1Y A;  4FRO A;  2OI7 A;  2WVM A;  1H5S C;  3T7O A;  2E3D A;  2NXV A;  3SXD A;  3U0Y A;  2BO7 A;  4KC2 A;  4JIS A;  3DUV A;  2CU2 A;  2Y4L A;  2D7I A;  2MZB A;  3CKJ A;  2YQH A;  2FYC B;  1JYL A;  2YQS A;  1JV3 A;  1VZT A;  2ZU7 A;  5FTS A;  5C49 A;  3E25 A;  1YP2 A;  4FRB A;  1H4E A;  2QH5 A;  4LW3 A;  5J49 A;  2YC3 A;  1G23 A;  4B4G A;  2YC5 A;  1Z90 A;  3K8D A;  4B2W A;  1LZ7 A;  3U2X A;  2I7B A;  1SS9 A;  2BO4 A;  4HO5 A;  5IDT A;  4FQW A;  3GUE A;  1LZI A;  2E8B A;  4P02 A;  1G97 A;  5C1L A;  1XZ6 A;  2WGZ A;  4KT7 A;  4MYB A;  1V83 A;  4R7P A;  1VGT A;  1HM0 A;  1HM9 A;  2A8W A;  3TZT A;  4EEG A;  4Y9X A;  2W0W A;  2ZU9 A;  3I0K A;  3EE5 A;  3I0I X;  3SXA A;  1ZJ0 A;  1KWS A;  2JCL A;  4NAI A;  2O1G A;  3D8V A;  2V0L A;  4C2S A;  3N9W A;  5EJ1 A;  1H7G A;  2AM5 A;  1O23 B;  5C4F A;  1G0R A;  1LL3 A;  1O0R A;  4AAW A;  4D11 C;  1OMX A;  5C3B A;  1VGZ A;  3D98 A;  2Z86 A;  2AH9 A;  4FRD A;  1R80 A;  5CMF X;  4YS8 A;  1WT2 A;  3RMW A;  4IRQ A;  1PZY B;  4FRE A;  3I0F A;  1QGS A;  1R7Y A;  3FOQ A;  3Q7U A;  4B42 A;  1VM8 A;  2O1H A;  1ZJP A;  3JUJ A;  4Y63 A;  1H5R B;  5C47 A;  2XWN A;  1TW1 A;  3V0N A;  2D0J A;  3R2W A;  2BO6 A;  4FRH A;  4Y7F A;  1H5S D;  2X65 A;  2P73 A;  2Y4M A;  2P72 A;  3T7N A;  4ZDQ A;  4KC4 A;  3IOJ A;  3ST8 A;  2PGY A;  3OH1 A;  1V82 A;  3T7M A;  4HO3 A;  1JVD A;  4Y7V A;  2QGI A;  2ZU8 A;  3OH2 A;  4HO9 A;  5FU8 A;  3NGW A;  5AJN A;  1FG5 N;  4CJ8 A;  4FRQ A;  2AES A;  4NAN A;  4KNR A;  2WVK A;  2YCM A;  3I0C A;  3SXE A;  2WAW A;  2VS3 A;  2VSI A;  1W77 A;  2Y7A A;  3OAM A;  1FR9 A;  4M2B A;  3V8Y A;  2FFV A;  1S4N A;  3U2W A;  5C4B A;  4CJC A;  3E26 A;  4FRM A;  3K8E A;  3V91 A;  3USQ A;  2V0H A;  1FXJ A;  4CJB A;  5FU0 A;  1VPA A;  1JV1 A;  3V0O A;  2FYB A;  1VH1 A;  2PA4 A;  5CMI A;  3I0E A;  1GWW A;  3PKP A;  1FRW A;  1HV9 A;  2XME A;  1R7U A;  1ZJ1 A;  1G1L A;  3QVB A;  5EJZ A;  1O7Q A;  3U2T A;  1S4P A;  4NAK A;  1I52 A;  1H7T A;  1NMM B;  5C48 A;  2RJ7 A;  2I5K A;  3ZF8 A;  1H5R A;  1TW5 A;  4HCQ A;  5AJO A;  4HO6 A;  4KC1 A;  3JTJ A;  4UEG A;  1HJJ A;  1FGG A;  1ZI1 A;  2RJ0 A;  5C1G A;  5CMH A;  1WVC A;  3SX5 A;  1WT1 A;  4B2X A;  2GGQ A;  1GQ9 A;  4ARW A;  1VGU A;  3SXB A;  1LVW A;  2JCK A;  2XWL A;  1ZI5 A;  1VH3 A;  3SXG A;  4DE7 A;  1ZCV A;  3V0M A;  1MP5 A;  2YQC A;  2WE9 A;  3KIA A;  4FCE A;  4HO4 A;  1NF5 B;  1PZT A;  2V0K A;  4B5B A;  3JUK A;  1G9R A;  3OC9 A;  3OKR A;  1ZCU A;  1ZJ2 A;  1ZIZ A;  2BO8 A;  4EEO A;  1O7O A;  1GX0 A;  3USR A;  4Y7U A;  2RJ8 A;  4HG6 A;  2RJ1 A;  2RIT A;  4M2A A;  1H5S B;  1G8O A;  1WT0 A;  5DDT A;  3O3P A;  1GQC A;  1V84 A;  3SX3 A;  4Y6U A;  3I0G A;  2AM3 A;  4K6R A;  4D0T A;  1QWJ A;  2W0V A;  1G95 A;  4GBP A;  4E1K A;  4NAL A;  3RMV A;  3CGX A;  5HS2 A;  5CQN X;  3IOH A;  4B3U A;  2FY7 A;  2GGO A;  4KPX A;  3ZGG A;  1YRO B;  2VXL A;  2VS5 A;  2X60 A;  3F1C A;  1ON8 A;  1FWY A;  1ZCY A;  2FYD B;  3V90 A;  5IFY A;  1FO9 A;  4FCU A;  1XHB A;  4AC3 A;  1FGX A;  4M4K A;  1FXO A;  2V0J A;  4IRP A;  4EEM A;  2WVL A;  1R7V A;  2ICX A;  5C38 A;  3RSB A;  1FO8 A;  4G3P A;  4FRA A;  1ZJ3 A;  2JCJ A;  4Y64 A;  5L6V A;  1QG8 A;  4L41 C;  1JYK A;  1H7E A;  2VSH A;  1ZDG A;  5AJP A;  2VS4 A;  2XMH A;  4P00 A;  1VGW A;  1YP3 A;  4B4M A;  3CKQ A;  1S4O A;  1EZI A;  5CQO A;  1H4C A;  2P6W A;  1QGQ A;  3I0J A;  1ZI4 A;  2X5S A;  5C36 A;  3V0Q A;  2FYA A;  2OEF A;  1H5S A;  1H7F A;  1MP4 A;  1LZJ A;  2RIZ A;  2RIY A;  3I0L A;  3IOI A;  2YES A;  3FWW A;  4KRV A;  3ZLL A;  3U0X A;  5CMG X;  1FOA A;  1H5T B;  4MND A;  4KQL A;  3CKO A;  5C1H A;  1H7Q A;  5C3A A;  1VZX A;  1H3M A;  2XWM A;  5I1F A;  2RIX A;  5DDV A;  5C4D A;  2AEC A;  3LW6 A;  4KPZ A;  4HO8 A;  1INI A;  1OMZ A;  5FTV A;  4B4B A;  1GA8 A;  3DJ4 A;  1INJ A;  1VIC A;  3SX8 A;  2APC A;  1LZ0 A;  2RJ6 A;  4J18 A;  4EVW A;  1YP4 A;  3SXC A;  2Y4K A;  1H7L A;  3OH3 A;  1ZHJ A;  5CMJ A;  3PKQ A;  4LW6 A;  4AYL A;  4EEA A;  4KNX A;  2Z87 A;  3SPT A;  1TZF A;  5BXC A;  5FV9 A;  2I5E A;  2OI5 A;  1FZW A;  1G2V A;  5IDS A;  1TVY A;  4D48 A;  1NWG B;  1E5K A;  3BRK X;  4Y7T A;  1WT3 A;  4BMA A;  1IIN A;  1NQI B;  4Y6N A;  1ZJO A;  3OH4 A;  3PNN A;  2O1F A;  2OEG A;  5C3D A;  4G3Q A;  2Q4J A;  1NHE B;  4HOC A;  3SX7 A;  4D11 A;  5L6S A;  3OGZ A;  4FRP A;  3I0D A;  4DEC A;  2Y6P A;  1H7H A;  2AM4 A;  1FR8 A;  2UX8 A;  1H5T A;  1R82 A;  3TQD A;  4D0Z A;  2JCO A;  1ZI3 A;  4Y62 A;  2PGV A;  5C4C A;  4HO2 A;  1W55 A;  2RJ5 A;  2YQJ A;  4HO0 A;  1G3L A;  4CVH A;  2QKX A;  2VFZ A;  3CKV A;  1W57 A;  4ASY A;  1K4V A;  3DK5 A;  5EIY A;  3D5N A;  1G93 A;  1R7X A;  5C8R A;  2A8U A;  4EE4 A;  3I0H A;  3V8Z A;  5FUH A;  4M28 A;  1HJL A;  2WEE A;  4ECM A;  4XWI A;  2VD4 A;  2AGD A;  1GX4 A;  1R7T A;  2PX7 A;  5CQP A;  1GWV A;  4Y7G A;  1R81 A;  5CQM X;  2RJ9 A;  3POL A;  3HL3 A;  3V0P A;  2Y4J A;  3U2U A;  2D7R A;  2DPW A;  1VZU A;  3Q4S A;  2X5Z A;  5C4E A;  3ZGF A;  3BCV A;  4EE3 A;  4FRL A;  3R3I A;  1ZCT A;  2VXM A;  4ASJ A;  1OQM B;  2RJ4 A;  1MP3 A;  1IIM A;  3Q80 A;  4KXO A;  4AYJ A;  5FYE A;  3ZLK A;  1LL0 A;  3V0L A;  5JQQ A;  1LL2 A;  1EYR A;  1HM8 A;  2AE7 A;  2OI6 A;  4G87 A;  1NKH B;  3OH0 A;  1ON6 A;  1ZDF A;  4BQH A;  5CQL X;  1JVG A;  4DDZ A;  1H4D A;  2FFU A;  4JD0 A;  1MC3 A;  4G3S A;  1WSZ A; 
#chains in the Genus database with same CATH topology
 3U2V A;  3CU0 A;  2ICY A;  4EE5 A;  2V0I A;  3CKN A;  3F1Y A;  4FRO A;  2OI7 A;  2WVM A;  1H5S C;  3T7O A;  2E3D A;  2NXV A;  3SXD A;  3U0Y A;  2BO7 A;  4KC2 A;  4JIS A;  3DUV A;  2CU2 A;  2Y4L A;  2D7I A;  2MZB A;  3CKJ A;  2YQH A;  2FYC B;  1JYL A;  2YQS A;  1JV3 A;  1VZT A;  2ZU7 A;  5FTS A;  5C49 A;  3E25 A;  1YP2 A;  4FRB A;  1H4E A;  2QH5 A;  4LW3 A;  5J49 A;  2YC3 A;  1G23 A;  4B4G A;  2YC5 A;  1Z90 A;  3K8D A;  4B2W A;  1LZ7 A;  3U2X A;  2I7B A;  1SS9 A;  2BO4 A;  4HO5 A;  5IDT A;  4FQW A;  3GUE A;  1LZI A;  2E8B A;  4P02 A;  1G97 A;  4O6M A;  5C1L A;  1XZ6 A;  2WGZ A;  4KT7 A;  4MYB A;  1V83 A;  4R7P A;  1VGT A;  1HM0 A;  1HM9 A;  2A8W A;  3TZT A;  4EEG A;  4Y9X A;  2W0W A;  2ZU9 A;  3I0K A;  3EE5 A;  3I0I X;  3SXA A;  1ZJ0 A;  1KWS A;  2JCL A;  4NAI A;  2O1G A;  3D8V A;  2V0L A;  4C2S A;  3N9W A;  5EJ1 A;  1H7G A;  2AM5 A;  1O23 B;  5C4F A;  1G0R A;  1LL3 A;  1O0R A;  4AAW A;  4D11 C;  1OMX A;  5C3B A;  1VGZ A;  2Z86 A;  3D98 A;  2AH9 A;  4FRD A;  1R80 A;  5CMF X;  4YS8 A;  1WT2 A;  3RMW A;  4IRQ A;  1PZY B;  4FRE A;  3I0F A;  1QGS A;  1R7Y A;  3FOQ A;  3Q7U A;  5D92 A;  4B42 A;  1VM8 A;  2O1H A;  1ZJP A;  3JUJ A;  4Y63 A;  1H5R B;  5C47 A;  2XWN A;  1TW1 A;  3V0N A;  2D0J A;  3R2W A;  2BO6 A;  4FRH A;  4Y7F A;  1H5S D;  2X65 A;  2P73 A;  2Y4M A;  2P72 A;  3T7N A;  4ZDQ A;  4KC4 A;  3IOJ A;  3ST8 A;  2PGY A;  3OH1 A;  1V82 A;  3T7M A;  4HO3 A;  1JVD A;  4Y7V A;  2QGI A;  2ZU8 A;  3OH2 A;  4HO9 A;  5FU8 A;  3NGW A;  5AJN A;  1FG5 N;  4CJ8 A;  4FRQ A;  2AES A;  4NAN A;  4KNR A;  2WVK A;  2YCM A;  3I0C A;  3SXE A;  2WAW A;  2VS3 A;  2VSI A;  1W77 A;  2Y7A A;  3OAM A;  1FR9 A;  4M2B A;  3V8Y A;  2FFV A;  1S4N A;  3U2W A;  5C4B A;  4CJC A;  3E26 A;  4FRM A;  3K8E A;  2J0B A;  3V91 A;  3USQ A;  2V0H A;  1FXJ A;  4CJB A;  5FU0 A;  1VPA A;  1JV1 A;  3V0O A;  2FYB A;  1VH1 A;  2PA4 A;  5CMI A;  3I0E A;  1GWW A;  3PKP A;  1FRW A;  1HV9 A;  2XME A;  1R7U A;  1ZJ1 A;  1G1L A;  3QVB A;  5EJZ A;  1O7Q A;  3U2T A;  1S4P A;  4NAK A;  1I52 A;  1H7T A;  1NMM B;  5C48 A;  2RJ7 A;  2I5K A;  3ZF8 A;  1H5R A;  1TW5 A;  4HCQ A;  5AJO A;  4HO6 A;  4KC1 A;  3JTJ A;  4UEG A;  1HJJ A;  1FGG A;  4FIX A;  1ZI1 A;  2RJ0 A;  5C1G A;  4MIX A;  5CMH A;  1WVC A;  3SX5 A;  1WT1 A;  4B2X A;  2GGQ A;  1GQ9 A;  4ARW A;  1VGU A;  3SXB A;  1LVW A;  2JCK A;  2XWL A;  1ZI5 A;  1VH3 A;  3SXG A;  4DE7 A;  1ZCV A;  3V0M A;  1MP5 A;  2YQC A;  2WE9 A;  3KIA A;  4FCE A;  4HO4 A;  1NF5 B;  1PZT A;  2V0K A;  4B5B A;  3JUK A;  1G9R A;  3OC9 A;  3OKR A;  1ZCU A;  1ZJ2 A;  1ZIZ A;  2BO8 A;  4EEO A;  1O7O A;  1GX0 A;  3USR A;  4Q7C A;  4Y7U A;  2RJ8 A;  4HG6 A;  2RJ1 A;  2RIT A;  4M2A A;  1H5S B;  1G8O A;  1WT0 A;  5DDT A;  3O3P A;  1GQC A;  1V84 A;  3SX3 A;  4Y6U A;  3I0G A;  2AM3 A;  4K6R A;  4D0T A;  1QWJ A;  2W0V A;  1G95 A;  4GBP A;  4E1K A;  4NAL A;  3RMV A;  3CGX A;  5HS2 A;  5CQN X;  3IOH A;  4B3U A;  2FY7 A;  2GGO A;  4KPX A;  3ZGG A;  1YRO B;  2VXL A;  2VS5 A;  2X60 A;  3F1C A;  1ON8 A;  1FWY A;  1ZCY A;  2FYD B;  3V90 A;  5IFY A;  1FO9 A;  4FCU A;  1XHB A;  4AC3 A;  1FGX A;  4M4K A;  1FXO A;  2V0J A;  4IRP A;  4EEM A;  2WVL A;  1R7V A;  2ICX A;  5C38 A;  3RSB A;  4O6N A;  1FO8 A;  4G3P A;  4FRA A;  1ZJ3 A;  2JCJ A;  4Y64 A;  5L6V A;  1QG8 A;  4L41 C;  1JYK A;  1H7E A;  2VSH A;  1ZDG A;  5AJP A;  2VS4 A;  2XMH A;  4P00 A;  1VGW A;  1YP3 A;  4B4M A;  3CKQ A;  1S4O A;  1EZI A;  5CQO A;  1H4C A;  2P6W A;  1QGQ A;  3I0J A;  1ZI4 A;  2X5S A;  5C36 A;  3V0Q A;  2FYA A;  2OEF A;  1H5S A;  1H7F A;  1MP4 A;  1LZJ A;  2RIZ A;  2RIY A;  3I0L A;  3IOI A;  2YES A;  3FWW A;  4KRV A;  3ZLL A;  3U0X A;  5CMG X;  1FOA A;  1H5T B;  4MND A;  4KQL A;  3CKO A;  5C1H A;  1H7Q A;  5C3A A;  1VZX A;  1H3M A;  2XWM A;  5D91 A;  5I1F A;  2RIX A;  5DDV A;  2C0N A;  5C4D A;  2AEC A;  3LW6 A;  4KPZ A;  4HO8 A;  1INI A;  1OMZ A;  5FTV A;  4B4B A;  1GA8 A;  3DJ4 A;  1INJ A;  1VIC A;  3SX8 A;  2VK9 A;  2APC A;  1LZ0 A;  2RJ6 A;  4J18 A;  4EVW A;  1YP4 A;  3SXC A;  2Y4K A;  1H7L A;  3OH3 A;  1ZHJ A;  5CMJ A;  3PKQ A;  4LW6 A;  4AYL A;  4EEA A;  4KNX A;  4FIY A;  2Z87 A;  3SPT A;  1TZF A;  5BXC A;  5FV9 A;  2I5E A;  2OI5 A;  1FZW A;  1G2V A;  5IDS A;  1TVY A;  4D48 A;  1NWG B;  1E5K A;  3BRK X;  4Y7T A;  1WT3 A;  4BMA A;  1IIN A;  1NQI B;  4Y6N A;  1ZJO A;  3OH4 A;  3PNN A;  2O1F A;  2OEG A;  5C3D A;  4G3Q A;  2Q4J A;  1NHE B;  4HOC A;  3SX7 A;  4D11 A;  5L6S A;  3OGZ A;  4FRP A;  3I0D A;  4DEC A;  2Y6P A;  1H7H A;  2AM4 A;  2J0A A;  1FR8 A;  2UX8 A;  1H5T A;  1R82 A;  3TQD A;  4D0Z A;  2JCO A;  1ZI3 A;  4Y62 A;  2PGV A;  5C4C A;  4HO2 A;  1W55 A;  2RJ5 A;  2YQJ A;  4HO0 A;  1G3L A;  4CVH A;  2QKX A;  2VFZ A;  3CKV A;  1W57 A;  4ASY A;  1K4V A;  3DK5 A;  5EIY A;  3D5N A;  1G93 A;  1R7X A;  5C8R A;  2A8U A;  4EE4 A;  3I0H A;  3V8Z A;  5FUH A;  4M28 A;  1HJL A;  2WEE A;  4ECM A;  4XWI A;  2VD4 A;  2AGD A;  1GX4 A;  1R7T A;  2PX7 A;  5CQP A;  1GWV A;  4Y7G A;  1R81 A;  5CQM X;  2RJ9 A;  3POL A;  3HL3 A;  3V0P A;  2Y4J A;  3U2U A;  2D7R A;  2DPW A;  1VZU A;  3Q4S A;  2X5Z A;  5C4E A;  3ZGF A;  3BCV A;  4EE3 A;  4FRL A;  3R3I A;  1ZCT A;  2VXM A;  4ASJ A;  1OQM B;  2RJ4 A;  1MP3 A;  1IIM A;  3Q80 A;  4KXO A;  4AYJ A;  5FYE A;  3ZLK A;  1LL0 A;  3V0L A;  5JQQ A;  1LL2 A;  1EYR A;  1HM8 A;  2AE7 A;  2OI6 A;  4G87 A;  1NKH B;  3OH0 A;  1ON6 A;  1ZDF A;  4BQH A;  5CQL X;  1JVG A;  4DDZ A;  1H4D A;  2FFU A;  4JD0 A;  1MC3 A;  4G3S A;  1WSZ A; 
#chains in the Genus database with same CATH homology
 3U2V A;  3CU0 A;  2ICY A;  4EE5 A;  2V0I A;  3CKN A;  3F1Y A;  4FRO A;  2OI7 A;  2WVM A;  1H5S C;  3T7O A;  2E3D A;  2NXV A;  3SXD A;  3U0Y A;  2BO7 A;  4KC2 A;  4JIS A;  3DUV A;  2CU2 A;  2Y4L A;  2D7I A;  2MZB A;  3CKJ A;  2YQH A;  2FYC B;  1JYL A;  2YQS A;  1JV3 A;  1VZT A;  2ZU7 A;  5FTS A;  5C49 A;  3E25 A;  1YP2 A;  4FRB A;  1H4E A;  2QH5 A;  4LW3 A;  5J49 A;  2YC3 A;  1G23 A;  4B4G A;  2YC5 A;  1Z90 A;  3K8D A;  4B2W A;  1LZ7 A;  3U2X A;  2I7B A;  1SS9 A;  2BO4 A;  4HO5 A;  5IDT A;  4FQW A;  3GUE A;  1LZI A;  2E8B A;  4P02 A;  1G97 A;  4O6M A;  5C1L A;  1XZ6 A;  2WGZ A;  4KT7 A;  4MYB A;  1V83 A;  4R7P A;  1VGT A;  1HM0 A;  1HM9 A;  2A8W A;  3TZT A;  4EEG A;  4Y9X A;  2W0W A;  2ZU9 A;  3I0K A;  3EE5 A;  3I0I X;  3SXA A;  1ZJ0 A;  1KWS A;  2JCL A;  4NAI A;  2O1G A;  3D8V A;  2V0L A;  4C2S A;  3N9W A;  5EJ1 A;  1H7G A;  2AM5 A;  1O23 B;  5C4F A;  1G0R A;  1LL3 A;  1O0R A;  4AAW A;  4D11 C;  1OMX A;  5C3B A;  1VGZ A;  2Z86 A;  3D98 A;  2AH9 A;  4FRD A;  1R80 A;  5CMF X;  4YS8 A;  1WT2 A;  3RMW A;  4IRQ A;  1PZY B;  4FRE A;  3I0F A;  1QGS A;  1R7Y A;  3FOQ A;  3Q7U A;  5D92 A;  4B42 A;  1VM8 A;  2O1H A;  1ZJP A;  3JUJ A;  4Y63 A;  1H5R B;  5C47 A;  2XWN A;  1TW1 A;  3V0N A;  2D0J A;  3R2W A;  2BO6 A;  4FRH A;  4Y7F A;  1H5S D;  2X65 A;  2P73 A;  2Y4M A;  2P72 A;  3T7N A;  4ZDQ A;  4KC4 A;  3IOJ A;  3ST8 A;  2PGY A;  3OH1 A;  1V82 A;  3T7M A;  4HO3 A;  1JVD A;  4Y7V A;  2QGI A;  2ZU8 A;  3OH2 A;  4HO9 A;  5FU8 A;  3NGW A;  5AJN A;  1FG5 N;  4CJ8 A;  4FRQ A;  2AES A;  4NAN A;  4KNR A;  2WVK A;  2YCM A;  3I0C A;  3SXE A;  2WAW A;  2VS3 A;  2VSI A;  1W77 A;  2Y7A A;  3OAM A;  1FR9 A;  4M2B A;  3V8Y A;  2FFV A;  1S4N A;  3U2W A;  5C4B A;  4CJC A;  3E26 A;  4FRM A;  3K8E A;  2J0B A;  3V91 A;  3USQ A;  2V0H A;  1FXJ A;  4CJB A;  5FU0 A;  1VPA A;  1JV1 A;  3V0O A;  2FYB A;  1VH1 A;  2PA4 A;  5CMI A;  3I0E A;  1GWW A;  3PKP A;  1FRW A;  1HV9 A;  2XME A;  1R7U A;  1ZJ1 A;  1G1L A;  3QVB A;  5EJZ A;  1O7Q A;  3U2T A;  1S4P A;  4NAK A;  1I52 A;  1H7T A;  1NMM B;  5C48 A;  2RJ7 A;  2I5K A;  3ZF8 A;  1H5R A;  1TW5 A;  4HCQ A;  5AJO A;  4HO6 A;  4KC1 A;  3JTJ A;  4UEG A;  1HJJ A;  1FGG A;  4FIX A;  1ZI1 A;  2RJ0 A;  5C1G A;  4MIX A;  5CMH A;  1WVC A;  3SX5 A;  1WT1 A;  4B2X A;  2GGQ A;  1GQ9 A;  4ARW A;  1VGU A;  3SXB A;  1LVW A;  2JCK A;  2XWL A;  1ZI5 A;  1VH3 A;  3SXG A;  4DE7 A;  1ZCV A;  3V0M A;  1MP5 A;  2YQC A;  2WE9 A;  3KIA A;  4FCE A;  4HO4 A;  1NF5 B;  1PZT A;  2V0K A;  4B5B A;  3JUK A;  1G9R A;  3OC9 A;  3OKR A;  1ZCU A;  1ZJ2 A;  1ZIZ A;  2BO8 A;  4EEO A;  1O7O A;  1GX0 A;  3USR A;  4Q7C A;  4Y7U A;  2RJ8 A;  4HG6 A;  2RJ1 A;  2RIT A;  4M2A A;  1H5S B;  1G8O A;  1WT0 A;  5DDT A;  3O3P A;  1GQC A;  1V84 A;  3SX3 A;  4Y6U A;  3I0G A;  2AM3 A;  4K6R A;  4D0T A;  1QWJ A;  2W0V A;  1G95 A;  4GBP A;  4E1K A;  4NAL A;  3RMV A;  3CGX A;  5HS2 A;  5CQN X;  3IOH A;  4B3U A;  2FY7 A;  2GGO A;  4KPX A;  3ZGG A;  1YRO B;  2VXL A;  2VS5 A;  2X60 A;  3F1C A;  1ON8 A;  1FWY A;  1ZCY A;  2FYD B;  3V90 A;  5IFY A;  1FO9 A;  4FCU A;  1XHB A;  4AC3 A;  1FGX A;  4M4K A;  1FXO A;  2V0J A;  4IRP A;  4EEM A;  2WVL A;  1R7V A;  2ICX A;  5C38 A;  3RSB A;  4O6N A;  1FO8 A;  4G3P A;  4FRA A;  1ZJ3 A;  2JCJ A;  4Y64 A;  5L6V A;  1QG8 A;  4L41 C;  1JYK A;  1H7E A;  2VSH A;  1ZDG A;  5AJP A;  2VS4 A;  2XMH A;  4P00 A;  1VGW A;  1YP3 A;  4B4M A;  3CKQ A;  1S4O A;  1EZI A;  5CQO A;  1H4C A;  2P6W A;  1QGQ A;  3I0J A;  1ZI4 A;  2X5S A;  5C36 A;  3V0Q A;  2FYA A;  2OEF A;  1H5S A;  1H7F A;  1MP4 A;  1LZJ A;  2RIZ A;  2RIY A;  3I0L A;  3IOI A;  2YES A;  3FWW A;  4KRV A;  3ZLL A;  3U0X A;  5CMG X;  1FOA A;  1H5T B;  4MND A;  4KQL A;  3CKO A;  5C1H A;  1H7Q A;  5C3A A;  1VZX A;  1H3M A;  2XWM A;  5D91 A;  5I1F A;  2RIX A;  5DDV A;  2C0N A;  5C4D A;  2AEC A;  3LW6 A;  4KPZ A;  4HO8 A;  1INI A;  1OMZ A;  5FTV A;  4B4B A;  1GA8 A;  3DJ4 A;  1INJ A;  1VIC A;  3SX8 A;  2VK9 A;  2APC A;  1LZ0 A;  2RJ6 A;  4J18 A;  4EVW A;  1YP4 A;  3SXC A;  2Y4K A;  1H7L A;  3OH3 A;  1ZHJ A;  5CMJ A;  3PKQ A;  4LW6 A;  4AYL A;  4EEA A;  4KNX A;  4FIY A;  2Z87 A;  3SPT A;  1TZF A;  5BXC A;  5FV9 A;  2I5E A;  2OI5 A;  1FZW A;  1G2V A;  5IDS A;  1TVY A;  4D48 A;  1NWG B;  1E5K A;  3BRK X;  4Y7T A;  1WT3 A;  4BMA A;  1IIN A;  1NQI B;  4Y6N A;  1ZJO A;  3OH4 A;  3PNN A;  2O1F A;  2OEG A;  5C3D A;  4G3Q A;  2Q4J A;  1NHE B;  4HOC A;  3SX7 A;  4D11 A;  5L6S A;  3OGZ A;  4FRP A;  3I0D A;  4DEC A;  2Y6P A;  1H7H A;  2AM4 A;  2J0A A;  1FR8 A;  2UX8 A;  1H5T A;  1R82 A;  3TQD A;  4D0Z A;  2JCO A;  1ZI3 A;  4Y62 A;  2PGV A;  5C4C A;  4HO2 A;  1W55 A;  2RJ5 A;  2YQJ A;  4HO0 A;  1G3L A;  4CVH A;  2QKX A;  2VFZ A;  3CKV A;  1W57 A;  4ASY A;  1K4V A;  3DK5 A;  5EIY A;  3D5N A;  1G93 A;  1R7X A;  5C8R A;  2A8U A;  4EE4 A;  3I0H A;  3V8Z A;  5FUH A;  4M28 A;  1HJL A;  2WEE A;  4ECM A;  4XWI A;  2VD4 A;  2AGD A;  1GX4 A;  1R7T A;  2PX7 A;  5CQP A;  1GWV A;  4Y7G A;  1R81 A;  5CQM X;  2RJ9 A;  3POL A;  3HL3 A;  3V0P A;  2Y4J A;  3U2U A;  2D7R A;  2DPW A;  1VZU A;  3Q4S A;  2X5Z A;  5C4E A;  3ZGF A;  3BCV A;  4EE3 A;  4FRL A;  3R3I A;  1ZCT A;  2VXM A;  4ASJ A;  1OQM B;  2RJ4 A;  1MP3 A;  1IIM A;  3Q80 A;  4KXO A;  4AYJ A;  5FYE A;  3ZLK A;  1LL0 A;  3V0L A;  5JQQ A;  1LL2 A;  1EYR A;  1HM8 A;  2AE7 A;  2OI6 A;  4G87 A;  1NKH B;  3OH0 A;  1ON6 A;  1ZDF A;  4BQH A;  5CQL X;  1JVG A;  4DDZ A;  1H4D A;  2FFU A;  4JD0 A;  1MC3 A;  4G3S A;  1WSZ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...