3SXEA

Crystal structure of aaaa+udp+gal with glycerol as the cryoprotectant
Total Genus 99
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
99
sequence length
293
structure length
293
Chain Sequence
FMVSLPRMVYPQPKVLTPCRKDVLVVTPWLAPIVWEGTFNIDILNEQFRLQNTTIGLTVFAIKKYVAFLKLFLETAEKHFMVGHRVHYYVFTDQPAAVPRVTLGTGRQLSVLEVRAYKRWQDVSMRRMEMISDFCERRFLSEVDYLVCVDVDMEFRDHVGVEILTPLFGTLHPGFYGSSREAFTYERRPQSQAYIPKDEGDFYYLGGFFGGSVQEVQRLTRACHQAMMVDQANGIEAVWHDESHLNKYLLRHKPTKVLSPEYLWDQQLLGWPAVLRKLRFTAVPKNHQAVRNP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords Histo-blood group ABO system transferase
publication title Sequence-dependent effects of cryoprotectants on the active sites of the human ABO(H) blood group A and B glycosyltransferases.
pubmed doi rcsb
source organism Homo sapiens
total genus 99
structure length 293
sequence length 293
ec nomenclature ec 2.4.1.37: Fucosylgalactoside 3-alpha-galactosyltransferase.
pdb deposition date 2011-07-14
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.550.10 Alpha Beta Alpha-Beta Complex Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A 3sxeA00
1V82A 2BO7A 2RJ5A 1JV1A 4D0TA 3I0HA 1IIMA 1VM8A 2BO4A 2OI7A 1G1LA 5FU8A 3ZLKA 2XMEA 1VZXA 3SX7A 2AE7A 4HO6A 2VSIA 1VZTA 5FTVA 1EYRA 1QWJA 3U2WA 4Y63A 4HOCA 3ST8A 2AH9A 1KWSA 4G87A 4HO8A 4Y6NA 4AYLA 2VFZA 4DE7A 2JCJA 1WT1A 2VS4A 1JV3A 3E25A 4FRLA 1H5TB 2O1GA 2QH5A 3LW6A 4IRPA 1MC3A 3POLA 2JCLA 1WVCA 1LZ7A 1H5SA 4NAKA 4KC4A 5C49A 2RITA 5C4FA 5L6SA 2WVKA 2E8BA 1XHBA 3JTJA 1H5SD 3R3IA 2E3DA 1HM9A 3V90A 2VSHA 3CKVA 1H7FA 2Z87A 3CGXA 1ZI3A 2RIXA 2RJ4A 3OH1A 3JUKA 3RMVA 3I0KA 2D0JA 2Y4KA 1R7YA 2OEFA 2OI6A 4FREA 2CU2A 2V0LA 4C2SA 4FQWA 3IOIA 2RJ9A 1QG8A 4HO9A 4KPXA 1ZJ2A 2UX8A 3ZF8A 1GX0A 1G93A 5CQMX 1FWYA 1OMXA 5AJOA 1H5SC 4HO0A 1H3MA 4CJ8A 1W57A 3QVBA 2MZBA 1ZI5A 4KQLA 1FOAA 2ZU9A 5C1LA 1K4VA 4EE3A 2PA4A 1LZ0A 2FYDB 5C1GA 1FR9A 3U2TA 5C3AA 5C3BA 1HV9A 1NHEB 2XWMA 3RMWA 4AAWA 1PZTA 4M2AA 2RJ0A 4NANA 3TQDA 4Y7VA 3CKOA 2WE9A 2QKXA 3ZLLA 2O1HA 2JCOA 4KNRA 5DDTA 3K8EA 2RIZA 1NF5B 1WT3A 2AM4A 1E5KA 1G2VA 2D7RA 4D0ZA 3CKJA 1GWVA 1VPAA 4BMAA 2RJ6A 2V0KA 3FOQA 4D48A 3PKQA 5J49A 5CQOA 4AYJA 1FGGA 4B42A 1VGUA 4IRQA 1W77A 1ZCTA 2ZU7A 3I0CA 4UEGA 3V0LA 1G9RA 4P02A 4D11A 5CMIA 2V0HA 2WGZA 1WSZA 5I1FA 1HJLA 3Q80A 5IDTA 1O23B 1ZJ3A 3OH0A 3PKPA 4Y7GA 3DK5A 3I0FA 1VICA 3V0NA 5C38A 5BXCA 2QGIA 3EE5A 5FV9A 2OI5A 1ZCYA 1TZFA 4Y64A 4EEGA 3SXCA 1G95A 1INJA 2FY7A 3SXBA 4HO2A 4BQHA 1V83A 1ZDGA 2FFVA 4JD0A 5C4BA 1H7LA 4DECA 1G23A 3KIAA 1GA8A 2V0JA 1LL0A 2RIYA 4M28A 1H5RA 1ZIZA 3PNNA 4KNXA 1GQCA 1R7TA 4D11C 3V91A 4LW6A 1MP4A 4EE5A 1VZUA 4ASYA 3BCVA 1Z90A 3I0GA 1H5TA 2VD4A 2AESA 5C3DA 2WVLA 4B5BA 3I0DA 3OAMA 2YQSA 1VGWA 2BO6A 4KRVA 1ZJPA 3FWWA 1ZJOA 1IINA 2DPWA 2FFUA 4M4KA 3DUVA 4KC1A 4FRDA 1R81A 1LZJA 3GUEA 2ICXA 3V8YA 4FRHA 1H7TA 2OEGA 1JYKA 2WEEA 4EE4A 3OH4A 1R7VA 4KPZA 2AM5A 4GBPA 5DDVA 1S4PA 4CJCA 1R82A 3OC9A 2AM3A 4LW3A 2Y7AA 3SXAA 1H5SB 4B2XA 5L6VA 2O1FA 1PZYB 2P73A 3IOHA 2RJ8A 1TW1A 2RJ1A 4Y9XA 1OMZA 1YP3A 2YCMA 2I5KA 2P6WA 2YC5A 3Q4SA 1FG5N 4FRPA 3V0PA 4B3UA 5FUHA 3F1YA 2Q4JA 4P00A 5C4EA 3HL3A 3SX8A 5EIYA 3OGZA 2GGQA 5FU0A 4ZDQA 1TVYA 3V0MA 5CMHA 3D98A 1S4OA 5FTSA 1NKHB 4R7PA 2JCKA 4FROA 2D7IA 1FXOA 4E1KA 3Q7UA 4FCEA 1R7UA 4B4GA 3I0EA 1O7QA 1G97A 3OH2A 3CKNA 2Y4MA 1LZIA 5AJNA 4G3SA 2ICYA 1LVWA 1FZWA 2Y6PA 5CMJA 1V84A 3U2VA 3T7OA 4ASJA 3K8DA 3TZTA 3ZGGA 4B4BA 1QGSA 2FYBA 1ZCUA 3D8VA 4KC2A 4CJBA 4MYBA 3DJ4A 3E26A 3I0IX 2VXLA 2YQCA 3SPTA 1G8OA 1G3LA 2WAWA 2WVMA 1LL3A 2FYCB 4K6RA 4YS8A 2X65A 4AC3A 1W55A 1YP4A 4XWIA 2XMHA 4NALA 4NAIA 4EEOA 1VH3A 3F1CA 1R80A 5CQNX 3U0YA 1GQ9A 1VGTA 1WT0A 4HO5A 1ON8A 1G0RA 3U2XA 2RJ7A 1YROB 1ON6A 4B4MA 1NMMB 3I0LA 4FRBA 1HM8A 1FRWA 3V8ZA 2Y4JA 1FR8A 4Y62A 3SXDA 2YQJA 5C48A 1ZI1A 5C4DA 3T7MA 2X5SA 5AJPA 2YQHA 1HJJA 2Z86A 2P72A 1H4EA 1MP5A 1OQMB 2V0IA 3BRKX 4HCQA 5CMFX 3T7NA 2XWLA 5C8RA 2W0WA 1FXJA 1H5RB 5C1HA 1HM0A 4J18A 4FRAA 4M2BA 5IFYA 4MNDA 3O3PA 1LL2A 4KXOA 2I7BA 1MP3A 1EZIA 2VXMA 5C4CA 4G3PA 2Y4LA 4FRQA 3OH3A 2VS3A 2PX7A 4DDZA 2W0VA 1S4NA 5C47A 1QGQA 1H7GA 4FCUA 3U2UA 1TW5A 5EJ1A 4FRMA 1XZ6A 1R7XA 1H7QA 3ZGFA 2X60A 4Y7UA 3CKQA 3U0XA 1YP2A 5CQLX 1VH1A 1ZJ1A 5EJZA 1ZDFA 2FYAA 3SXEA 5JQQA 2PGYA 4HO4A 1H7EA 1ZJ0A 3V0OA 4EEAA 1ZHJA 1JVDA 2BO8A 2YC3A 2PGVA 3SX5A 2A8WA 2APCA 1SS9A 3SXGA 3SX3A 2VS5A 1H4CA 3USRA 3RSBA 2XWNA 1O0RA 1O7OA 4Y6UA 2AGDA 1H4DA 1INIA 4KT7A 4Y7FA 3R2WA 1FO9A 3JUJA 2NXVA 3NGWA 4JISA 4ARWA 3USQA 2GGOA 1NQIB 2A8UA 1ZCVA 1FO8A 3I0JA 2AECA 3V0QA 2ZU8A 4L41C 1H7HA 1JVGA 1VGZA 5IDSA 1ZI4A 2YESA 5CQPA 1NWGB 4B2WA 4Y7TA 5CMGX 4EVWA 4G3QA 4CVHA 1FGXA 4HG6A 3N9WA 3IOJA 4EEMA 1GWWA 5FYEA 4HO3A 1GX4A 2I5EA 3OKRA 1I52A 5C36A 3D5NA 2X5ZA 1JYLA 3CU0A 4ECMA 5HS2A 1WT2A
chains in the Genus database with same CATH superfamily
1V82A 2BO7A 2RJ5A 1JV1A 4D0TA 3I0HA 1IIMA 1VM8A 2BO4A 2OI7A 1G1LA 5FU8A 3ZLKA 2XMEA 1VZXA 3SX7A 2AE7A 4HO6A 2VSIA 1VZTA 5FTVA 1EYRA 1QWJA 3U2WA 4Y63A 4HOCA 3ST8A 2AH9A 1KWSA 4G87A 4HO8A 4Y6NA 4AYLA 2VFZA 4DE7A 2JCJA 1WT1A 2VS4A 1JV3A 3E25A 4FRLA 1H5TB 2O1GA 2QH5A 3LW6A 4IRPA 1MC3A 3POLA 2JCLA 1WVCA 1LZ7A 1H5SA 4NAKA 4KC4A 5C49A 5D92A 2RITA 5C4FA 5L6SA 2WVKA 2E8BA 1XHBA 3JTJA 1H5SD 3R3IA 2E3DA 1HM9A 3V90A 2VSHA 3CKVA 1H7FA 2Z87A 3CGXA 1ZI3A 2RIXA 2RJ4A 3OH1A 3JUKA 3RMVA 3I0KA 2D0JA 2Y4KA 1R7YA 2OEFA 2OI6A 4FREA 2CU2A 2V0LA 4C2SA 4FQWA 3IOIA 2RJ9A 1QG8A 4HO9A 4KPXA 1ZJ2A 2UX8A 3ZF8A 1GX0A 1G93A 5CQMX 1FWYA 1OMXA 5AJOA 1H5SC 4HO0A 1H3MA 4CJ8A 1W57A 3QVBA 2MZBA 1ZI5A 4KQLA 1FOAA 2ZU9A 5C1LA 1K4VA 4EE3A 2PA4A 1LZ0A 2FYDB 2VK9A 1FR9A 5C1GA 5C3AA 3U2TA 5C3BA 4Q7CA 1HV9A 1NHEB 2XWMA 3RMWA 4AAWA 1PZTA 4M2AA 2RJ0A 4NANA 3TQDA 4Y7VA 3CKOA 2WE9A 2QKXA 3ZLLA 2O1HA 2JCOA 4KNRA 5DDTA 3K8EA 2RIZA 1NF5B 1WT3A 2AM4A 1E5KA 1G2VA 2D7RA 4D0ZA 3CKJA 1GWVA 1VPAA 4BMAA 2RJ6A 2V0KA 3FOQA 4D48A 3PKQA 5J49A 5CQOA 4AYJA 1FGGA 4B42A 1VGUA 4IRQA 1W77A 1ZCTA 2ZU7A 3I0CA 4UEGA 3V0LA 1G9RA 4P02A 2C0NA 4D11A 5CMIA 2V0HA 2WGZA 1WSZA 5I1FA 1HJLA 3Q80A 5IDTA 1O23B 1ZJ3A 4FIYA 3OH0A 3PKPA 4Y7GA 3DK5A 3I0FA 1VICA 3V0NA 5C38A 5BXCA 2QGIA 3EE5A 5FV9A 2OI5A 1ZCYA 1TZFA 4Y64A 4EEGA 3SXCA 1G95A 1INJA 2FY7A 3SXBA 4HO2A 4BQHA 1V83A 1ZDGA 2FFVA 4JD0A 5C4BA 1H7LA 4DECA 1G23A 3KIAA 1GA8A 2V0JA 1LL0A 2RIYA 4M28A 1H5RA 1ZIZA 3PNNA 4KNXA 1GQCA 1R7TA 4D11C 3V91A 4LW6A 1MP4A 4EE5A 1VZUA 4ASYA 3BCVA 1Z90A 3I0GA 1H5TA 2VD4A 2AESA 5C3DA 2WVLA 4B5BA 3I0DA 3OAMA 2YQSA 1VGWA 2BO6A 4KRVA 1ZJPA 3FWWA 1ZJOA 1IINA 2DPWA 2FFUA 4M4KA 3DUVA 4KC1A 4FRDA 1R81A 1LZJA 3GUEA 2ICXA 3V8YA 4FRHA 1H7TA 2OEGA 1JYKA 2WEEA 4EE4A 3OH4A 1R7VA 4KPZA 2AM5A 4GBPA 5DDVA 1S4PA 4CJCA 1R82A 3OC9A 2AM3A 4LW3A 2Y7AA 3SXAA 1H5SB 4B2XA 5L6VA 2O1FA 1PZYB 2P73A 3IOHA 2RJ8A 1TW1A 2RJ1A 4Y9XA 1OMZA 1YP3A 2YCMA 2I5KA 2P6WA 2YC5A 3Q4SA 1FG5N 4FRPA 3V0PA 4B3UA 5FUHA 3F1YA 2Q4JA 4P00A 5C4EA 3HL3A 3SX8A 5EIYA 3OGZA 2GGQA 5FU0A 4ZDQA 1TVYA 3V0MA 5CMHA 3D98A 1S4OA 5FTSA 1NKHB 4R7PA 2JCKA 4FROA 2D7IA 1FXOA 4E1KA 3Q7UA 4FCEA 1R7UA 4B4GA 3I0EA 1O7QA 1G97A 3OH2A 3CKNA 2Y4MA 1LZIA 5AJNA 4G3SA 2ICYA 1LVWA 1FZWA 2Y6PA 5CMJA 1V84A 3U2VA 3T7OA 4ASJA 3K8DA 3TZTA 4O6MA 3ZGGA 4B4BA 1QGSA 2FYBA 1ZCUA 3D8VA 4KC2A 4CJBA 4MYBA 3DJ4A 3E26A 3I0IX 2VXLA 2YQCA 3SPTA 1G8OA 1G3LA 2WAWA 2WVMA 1LL3A 2FYCB 4K6RA 4O6NA 4YS8A 2X65A 4AC3A 1W55A 1YP4A 4XWIA 2XMHA 4NALA 4NAIA 4EEOA 1VH3A 3F1CA 1R80A 5CQNX 3U0YA 1GQ9A 1VGTA 1WT0A 4HO5A 1ON8A 1G0RA 3U2XA 2RJ7A 1YROB 1ON6A 4B4MA 4FIXA 1NMMB 3I0LA 4FRBA 1HM8A 1FRWA 3V8ZA 2Y4JA 1FR8A 4Y62A 3SXDA 2YQJA 5C48A 1ZI1A 5C4DA 3T7MA 2X5SA 5AJPA 2YQHA 1HJJA 2Z86A 2P72A 1H4EA 1MP5A 1OQMB 2V0IA 3BRKX 4HCQA 5CMFX 3T7NA 2XWLA 5C8RA 2W0WA 1FXJA 1H5RB 5C1HA 4MIXA 1HM0A 4J18A 4FRAA 4M2BA 5IFYA 4MNDA 3O3PA 1LL2A 4KXOA 2I7BA 1MP3A 1EZIA 2VXMA 5C4CA 4G3PA 2Y4LA 4FRQA 3OH3A 2VS3A 2PX7A 4DDZA 2W0VA 1S4NA 5C47A 1QGQA 1H7GA 4FCUA 3U2UA 1TW5A 5EJ1A 4FRMA 1XZ6A 1R7XA 1H7QA 3ZGFA 2X60A 4Y7UA 3CKQA 3U0XA 1YP2A 5CQLX 1VH1A 1ZJ1A 5EJZA 1ZDFA 2FYAA 3SXEA 5JQQA 2PGYA 4HO4A 1H7EA 1ZJ0A 3V0OA 4EEAA 1ZHJA 1JVDA 2BO8A 2YC3A 2PGVA 3SX5A 2A8WA 2APCA 1SS9A 3SXGA 3SX3A 2VS5A 1H4CA 3USRA 3RSBA 2XWNA 1O0RA 1O7OA 5D91A 4Y6UA 2AGDA 1H4DA 1INIA 4KT7A 4Y7FA 3R2WA 1FO9A 3JUJA 2NXVA 3NGWA 4JISA 2J0BA 4ARWA 3USQA 2GGOA 1NQIB 2J0AA 2A8UA 1ZCVA 1FO8A 3I0JA 2AECA 3V0QA 2ZU8A 4L41C 1H7HA 1JVGA 1VGZA 5IDSA 1ZI4A 2YESA 5CQPA 1NWGB 4B2WA 4Y7TA 5CMGX 4EVWA 4G3QA 4CVHA 1FGXA 4HG6A 3N9WA 3IOJA 4EEMA 1GWWA 5FYEA 4HO3A 1GX4A 2I5EA 3OKRA 1I52A 5C36A 3D5NA 2X5ZA 1JYLA 3CU0A 4ECMA 5HS2A 1WT2A
chains in the Genus database with same CATH topology
1V82A 2BO7A 2RJ5A 1JV1A 4D0TA 3I0HA 1IIMA 1VM8A 2BO4A 2OI7A 1G1LA 5FU8A 3ZLKA 2XMEA 1VZXA 3SX7A 2AE7A 4HO6A 2VSIA 1VZTA 5FTVA 1EYRA 1QWJA 3U2WA 4Y63A 4HOCA 3ST8A 2AH9A 1KWSA 4G87A 4HO8A 4Y6NA 4AYLA 2VFZA 4DE7A 2JCJA 1WT1A 2VS4A 1JV3A 3E25A 4FRLA 1H5TB 2O1GA 2QH5A 3LW6A 4IRPA 1MC3A 3POLA 2JCLA 1WVCA 1LZ7A 1H5SA 4NAKA 4KC4A 5C49A 5D92A 2RITA 5C4FA 5L6SA 2WVKA 2E8BA 1XHBA 3JTJA 1H5SD 3R3IA 2E3DA 1HM9A 3V90A 2VSHA 3CKVA 1H7FA 2Z87A 3CGXA 1ZI3A 2RIXA 2RJ4A 3OH1A 3JUKA 3RMVA 3I0KA 2D0JA 2Y4KA 1R7YA 2OEFA 2OI6A 4FREA 2CU2A 2V0LA 4C2SA 4FQWA 3IOIA 2RJ9A 1QG8A 4HO9A 4KPXA 1ZJ2A 2UX8A 3ZF8A 1GX0A 1G93A 5CQMX 1FWYA 1OMXA 5AJOA 1H5SC 4HO0A 1H3MA 4CJ8A 1W57A 3QVBA 2MZBA 1ZI5A 4KQLA 1FOAA 2ZU9A 5C1LA 1K4VA 4EE3A 2PA4A 1LZ0A 2FYDB 2VK9A 1FR9A 5C1GA 5C3AA 3U2TA 5C3BA 4Q7CA 1HV9A 1NHEB 2XWMA 3RMWA 4AAWA 1PZTA 4M2AA 2RJ0A 4NANA 3TQDA 4Y7VA 3CKOA 2WE9A 2QKXA 3ZLLA 2O1HA 2JCOA 4KNRA 5DDTA 3K8EA 2RIZA 1NF5B 1WT3A 2AM4A 1E5KA 1G2VA 2D7RA 4D0ZA 3CKJA 1GWVA 1VPAA 4BMAA 2RJ6A 2V0KA 3FOQA 4D48A 3PKQA 5J49A 5CQOA 4AYJA 1FGGA 4B42A 1VGUA 4IRQA 1W77A 1ZCTA 2ZU7A 3I0CA 4UEGA 3V0LA 1G9RA 4P02A 2C0NA 4D11A 5CMIA 2V0HA 2WGZA 1WSZA 5I1FA 1HJLA 3Q80A 5IDTA 1O23B 1ZJ3A 4FIYA 3OH0A 3PKPA 4Y7GA 3DK5A 3I0FA 1VICA 3V0NA 5C38A 5BXCA 2QGIA 3EE5A 5FV9A 2OI5A 1ZCYA 1TZFA 4Y64A 4EEGA 3SXCA 1G95A 1INJA 2FY7A 3SXBA 4HO2A 4BQHA 1V83A 1ZDGA 2FFVA 4JD0A 5C4BA 1H7LA 4DECA 1G23A 3KIAA 1GA8A 2V0JA 1LL0A 2RIYA 4M28A 1H5RA 1ZIZA 3PNNA 4KNXA 1GQCA 1R7TA 4D11C 3V91A 4LW6A 1MP4A 4EE5A 1VZUA 4ASYA 3BCVA 1Z90A 3I0GA 1H5TA 2VD4A 2AESA 5C3DA 2WVLA 4B5BA 3I0DA 3OAMA 2YQSA 1VGWA 2BO6A 4KRVA 1ZJPA 3FWWA 1ZJOA 1IINA 2DPWA 2FFUA 4M4KA 3DUVA 4KC1A 4FRDA 1R81A 1LZJA 3GUEA 2ICXA 3V8YA 4FRHA 1H7TA 2OEGA 1JYKA 2WEEA 4EE4A 3OH4A 1R7VA 4KPZA 2AM5A 4GBPA 5DDVA 1S4PA 4CJCA 1R82A 3OC9A 2AM3A 4LW3A 2Y7AA 3SXAA 1H5SB 4B2XA 5L6VA 2O1FA 1PZYB 2P73A 3IOHA 2RJ8A 1TW1A 2RJ1A 4Y9XA 1OMZA 1YP3A 2YCMA 2I5KA 2P6WA 2YC5A 3Q4SA 1FG5N 4FRPA 3V0PA 4B3UA 5FUHA 3F1YA 2Q4JA 4P00A 5C4EA 3HL3A 3SX8A 5EIYA 3OGZA 2GGQA 5FU0A 4ZDQA 1TVYA 3V0MA 5CMHA 3D98A 1S4OA 5FTSA 1NKHB 4R7PA 2JCKA 4FROA 2D7IA 1FXOA 4E1KA 3Q7UA 4FCEA 1R7UA 4B4GA 3I0EA 1O7QA 1G97A 3OH2A 3CKNA 2Y4MA 1LZIA 5AJNA 4G3SA 2ICYA 1LVWA 1FZWA 2Y6PA 5CMJA 1V84A 3U2VA 3T7OA 4ASJA 3K8DA 3TZTA 4O6MA 3ZGGA 4B4BA 1QGSA 2FYBA 1ZCUA 3D8VA 4KC2A 4CJBA 4MYBA 3DJ4A 3E26A 3I0IX 2VXLA 2YQCA 3SPTA 1G8OA 1G3LA 2WAWA 2WVMA 1LL3A 2FYCB 4K6RA 4O6NA 4YS8A 2X65A 4AC3A 1W55A 1YP4A 4XWIA 2XMHA 4NALA 4NAIA 4EEOA 1VH3A 3F1CA 1R80A 5CQNX 3U0YA 1GQ9A 1VGTA 1WT0A 4HO5A 1ON8A 1G0RA 3U2XA 2RJ7A 1YROB 1ON6A 4B4MA 4FIXA 1NMMB 3I0LA 4FRBA 1HM8A 1FRWA 3V8ZA 2Y4JA 1FR8A 4Y62A 3SXDA 2YQJA 5C48A 1ZI1A 5C4DA 3T7MA 2X5SA 5AJPA 2YQHA 1HJJA 2Z86A 2P72A 1H4EA 1MP5A 1OQMB 2V0IA 3BRKX 4HCQA 5CMFX 3T7NA 2XWLA 5C8RA 2W0WA 1FXJA 1H5RB 5C1HA 4MIXA 1HM0A 4J18A 4FRAA 4M2BA 5IFYA 4MNDA 3O3PA 1LL2A 4KXOA 2I7BA 1MP3A 1EZIA 2VXMA 5C4CA 4G3PA 2Y4LA 4FRQA 3OH3A 2VS3A 2PX7A 4DDZA 2W0VA 1S4NA 5C47A 1QGQA 1H7GA 4FCUA 3U2UA 1TW5A 5EJ1A 4FRMA 1XZ6A 1R7XA 1H7QA 3ZGFA 2X60A 4Y7UA 3CKQA 3U0XA 1YP2A 5CQLX 1VH1A 1ZJ1A 5EJZA 1ZDFA 2FYAA 3SXEA 5JQQA 2PGYA 4HO4A 1H7EA 1ZJ0A 3V0OA 4EEAA 1ZHJA 1JVDA 2BO8A 2YC3A 2PGVA 3SX5A 2A8WA 2APCA 1SS9A 3SXGA 3SX3A 2VS5A 1H4CA 3USRA 3RSBA 2XWNA 1O0RA 1O7OA 5D91A 4Y6UA 2AGDA 1H4DA 1INIA 4KT7A 4Y7FA 3R2WA 1FO9A 3JUJA 2NXVA 3NGWA 4JISA 2J0BA 4ARWA 3USQA 2GGOA 1NQIB 2J0AA 2A8UA 1ZCVA 1FO8A 3I0JA 2AECA 3V0QA 2ZU8A 4L41C 1H7HA 1JVGA 1VGZA 5IDSA 1ZI4A 2YESA 5CQPA 1NWGB 4B2WA 4Y7TA 5CMGX 4EVWA 4G3QA 4CVHA 1FGXA 4HG6A 3N9WA 3IOJA 4EEMA 1GWWA 5FYEA 4HO3A 1GX4A 2I5EA 3OKRA 1I52A 5C36A 3D5NA 2X5ZA 1JYLA 3CU0A 4ECMA 5HS2A 1WT2A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1V82 A;  2BO7 A;  2RJ5 A;  1JV1 A;  4D0T A;  3I0H A;  1IIM A;  1VM8 A;  2BO4 A;  2OI7 A;  1G1L A;  5FU8 A;  3ZLK A;  2XME A;  1VZX A;  3SX7 A;  2AE7 A;  4HO6 A;  2VSI A;  1VZT A;  5FTV A;  1EYR A;  1QWJ A;  3U2W A;  4Y63 A;  4HOC A;  3ST8 A;  2AH9 A;  1KWS A;  4G87 A;  4HO8 A;  4Y6N A;  4AYL A;  2VFZ A;  4DE7 A;  2JCJ A;  1WT1 A;  2VS4 A;  1JV3 A;  3E25 A;  4FRL A;  1H5T B;  2O1G A;  2QH5 A;  3LW6 A;  4IRP A;  1MC3 A;  3POL A;  2JCL A;  1WVC A;  1LZ7 A;  1H5S A;  4NAK A;  4KC4 A;  5C49 A;  2RIT A;  5C4F A;  5L6S A;  2WVK A;  2E8B A;  1XHB A;  3JTJ A;  1H5S D;  3R3I A;  2E3D A;  1HM9 A;  3V90 A;  2VSH A;  3CKV A;  1H7F A;  2Z87 A;  3CGX A;  1ZI3 A;  2RIX A;  2RJ4 A;  3OH1 A;  3JUK A;  3RMV A;  3I0K A;  2D0J A;  2Y4K A;  1R7Y A;  2OEF A;  2OI6 A;  4FRE A;  2CU2 A;  2V0L A;  4C2S A;  4FQW A;  3IOI A;  2RJ9 A;  1QG8 A;  4HO9 A;  4KPX A;  1ZJ2 A;  2UX8 A;  3ZF8 A;  1GX0 A;  1G93 A;  5CQM X;  1FWY A;  1OMX A;  5AJO A;  1H5S C;  4HO0 A;  1H3M A;  4CJ8 A;  1W57 A;  3QVB A;  2MZB A;  1ZI5 A;  4KQL A;  1FOA A;  2ZU9 A;  5C1L A;  1K4V A;  4EE3 A;  2PA4 A;  1LZ0 A;  2FYD B;  5C1G A;  1FR9 A;  3U2T A;  5C3A A;  5C3B A;  1HV9 A;  1NHE B;  2XWM A;  3RMW A;  4AAW A;  1PZT A;  4M2A A;  2RJ0 A;  4NAN A;  3TQD A;  4Y7V A;  3CKO A;  2WE9 A;  2QKX A;  3ZLL A;  2O1H A;  2JCO A;  4KNR A;  5DDT A;  3K8E A;  2RIZ A;  1NF5 B;  1WT3 A;  2AM4 A;  1E5K A;  1G2V A;  2D7R A;  4D0Z A;  3CKJ A;  1GWV A;  1VPA A;  4BMA A;  2RJ6 A;  2V0K A;  3FOQ A;  4D48 A;  3PKQ A;  5J49 A;  5CQO A;  4AYJ A;  1FGG A;  4B42 A;  1VGU A;  4IRQ A;  1W77 A;  1ZCT A;  2ZU7 A;  3I0C A;  4UEG A;  3V0L A;  1G9R A;  4P02 A;  4D11 A;  5CMI A;  2V0H A;  2WGZ A;  1WSZ A;  5I1F A;  1HJL A;  3Q80 A;  5IDT A;  1O23 B;  1ZJ3 A;  3OH0 A;  3PKP A;  4Y7G A;  3DK5 A;  3I0F A;  1VIC A;  3V0N A;  5C38 A;  5BXC A;  2QGI A;  3EE5 A;  5FV9 A;  2OI5 A;  1ZCY A;  1TZF A;  4Y64 A;  4EEG A;  3SXC A;  1G95 A;  1INJ A;  2FY7 A;  3SXB A;  4HO2 A;  4BQH A;  1V83 A;  1ZDG A;  2FFV A;  4JD0 A;  5C4B A;  1H7L A;  4DEC A;  1G23 A;  3KIA A;  1GA8 A;  2V0J A;  1LL0 A;  2RIY A;  4M28 A;  1H5R A;  1ZIZ A;  3PNN A;  4KNX A;  1GQC A;  1R7T A;  4D11 C;  3V91 A;  4LW6 A;  1MP4 A;  4EE5 A;  1VZU A;  4ASY A;  3BCV A;  1Z90 A;  3I0G A;  1H5T A;  2VD4 A;  2AES A;  5C3D A;  2WVL A;  4B5B A;  3I0D A;  3OAM A;  2YQS A;  1VGW A;  2BO6 A;  4KRV A;  1ZJP A;  3FWW A;  1ZJO A;  1IIN A;  2DPW A;  2FFU A;  4M4K A;  3DUV A;  4KC1 A;  4FRD A;  1R81 A;  1LZJ A;  3GUE A;  2ICX A;  3V8Y A;  4FRH A;  1H7T A;  2OEG A;  1JYK A;  2WEE A;  4EE4 A;  3OH4 A;  1R7V A;  4KPZ A;  2AM5 A;  4GBP A;  5DDV A;  1S4P A;  4CJC A;  1R82 A;  3OC9 A;  2AM3 A;  4LW3 A;  2Y7A A;  3SXA A;  1H5S B;  4B2X A;  5L6V A;  2O1F A;  1PZY B;  2P73 A;  3IOH A;  2RJ8 A;  1TW1 A;  2RJ1 A;  4Y9X A;  1OMZ A;  1YP3 A;  2YCM A;  2I5K A;  2P6W A;  2YC5 A;  3Q4S A;  1FG5 N;  4FRP A;  3V0P A;  4B3U A;  5FUH A;  3F1Y A;  2Q4J A;  4P00 A;  5C4E A;  3HL3 A;  3SX8 A;  5EIY A;  3OGZ A;  2GGQ A;  5FU0 A;  4ZDQ A;  1TVY A;  3V0M A;  5CMH A;  3D98 A;  1S4O A;  5FTS A;  1NKH B;  4R7P A;  2JCK A;  4FRO A;  2D7I A;  1FXO A;  4E1K A;  3Q7U A;  4FCE A;  1R7U A;  4B4G A;  3I0E A;  1O7Q A;  1G97 A;  3OH2 A;  3CKN A;  2Y4M A;  1LZI A;  5AJN A;  4G3S A;  2ICY A;  1LVW A;  1FZW A;  2Y6P A;  5CMJ A;  1V84 A;  3U2V A;  3T7O A;  4ASJ A;  3K8D A;  3TZT A;  3ZGG A;  4B4B A;  1QGS A;  2FYB A;  1ZCU A;  3D8V A;  4KC2 A;  4CJB A;  4MYB A;  3DJ4 A;  3E26 A;  3I0I X;  2VXL A;  2YQC A;  3SPT A;  1G8O A;  1G3L A;  2WAW A;  2WVM A;  1LL3 A;  2FYC B;  4K6R A;  4YS8 A;  2X65 A;  4AC3 A;  1W55 A;  1YP4 A;  4XWI A;  2XMH A;  4NAL A;  4NAI A;  4EEO A;  1VH3 A;  3F1C A;  1R80 A;  5CQN X;  3U0Y A;  1GQ9 A;  1VGT A;  1WT0 A;  4HO5 A;  1ON8 A;  1G0R A;  3U2X A;  2RJ7 A;  1YRO B;  1ON6 A;  4B4M A;  1NMM B;  3I0L A;  4FRB A;  1HM8 A;  1FRW A;  3V8Z A;  2Y4J A;  1FR8 A;  4Y62 A;  3SXD A;  2YQJ A;  5C48 A;  1ZI1 A;  5C4D A;  3T7M A;  2X5S A;  5AJP A;  2YQH A;  1HJJ A;  2Z86 A;  2P72 A;  1H4E A;  1MP5 A;  1OQM B;  2V0I A;  3BRK X;  4HCQ A;  5CMF X;  3T7N A;  2XWL A;  5C8R A;  2W0W A;  1FXJ A;  1H5R B;  5C1H A;  1HM0 A;  4J18 A;  4FRA A;  4M2B A;  5IFY A;  4MND A;  3O3P A;  1LL2 A;  4KXO A;  2I7B A;  1MP3 A;  1EZI A;  2VXM A;  5C4C A;  4G3P A;  2Y4L A;  4FRQ A;  3OH3 A;  2VS3 A;  2PX7 A;  4DDZ A;  2W0V A;  1S4N A;  5C47 A;  1QGQ A;  1H7G A;  4FCU A;  3U2U A;  1TW5 A;  5EJ1 A;  4FRM A;  1XZ6 A;  1R7X A;  1H7Q A;  3ZGF A;  2X60 A;  4Y7U A;  3CKQ A;  3U0X A;  1YP2 A;  5CQL X;  1VH1 A;  1ZJ1 A;  5EJZ A;  1ZDF A;  2FYA A;  3SXE A;  5JQQ A;  2PGY A;  4HO4 A;  1H7E A;  1ZJ0 A;  3V0O A;  4EEA A;  1ZHJ A;  1JVD A;  2BO8 A;  2YC3 A;  2PGV A;  3SX5 A;  2A8W A;  2APC A;  1SS9 A;  3SXG A;  3SX3 A;  2VS5 A;  1H4C A;  3USR A;  3RSB A;  2XWN A;  1O0R A;  1O7O A;  4Y6U A;  2AGD A;  1H4D A;  1INI A;  4KT7 A;  4Y7F A;  3R2W A;  1FO9 A;  3JUJ A;  2NXV A;  3NGW A;  4JIS A;  4ARW A;  3USQ A;  2GGO A;  1NQI B;  2A8U A;  1ZCV A;  1FO8 A;  3I0J A;  2AEC A;  3V0Q A;  2ZU8 A;  4L41 C;  1H7H A;  1JVG A;  1VGZ A;  5IDS A;  1ZI4 A;  2YES A;  5CQP A;  1NWG B;  4B2W A;  4Y7T A;  5CMG X;  4EVW A;  4G3Q A;  4CVH A;  1FGX A;  4HG6 A;  3N9W A;  3IOJ A;  4EEM A;  1GWW A;  5FYE A;  4HO3 A;  1GX4 A;  2I5E A;  3OKR A;  1I52 A;  5C36 A;  3D5N A;  2X5Z A;  1JYL A;  3CU0 A;  4ECM A;  5HS2 A;  1WT2 A; 
#chains in the Genus database with same CATH topology
 1V82 A;  2BO7 A;  2RJ5 A;  1JV1 A;  4D0T A;  3I0H A;  1IIM A;  1VM8 A;  2BO4 A;  2OI7 A;  1G1L A;  5FU8 A;  3ZLK A;  2XME A;  1VZX A;  3SX7 A;  2AE7 A;  4HO6 A;  2VSI A;  1VZT A;  5FTV A;  1EYR A;  1QWJ A;  3U2W A;  4Y63 A;  4HOC A;  3ST8 A;  2AH9 A;  1KWS A;  4G87 A;  4HO8 A;  4Y6N A;  4AYL A;  2VFZ A;  4DE7 A;  2JCJ A;  1WT1 A;  2VS4 A;  1JV3 A;  3E25 A;  4FRL A;  1H5T B;  2O1G A;  2QH5 A;  3LW6 A;  4IRP A;  1MC3 A;  3POL A;  2JCL A;  1WVC A;  1LZ7 A;  1H5S A;  4NAK A;  4KC4 A;  5C49 A;  5D92 A;  2RIT A;  5C4F A;  5L6S A;  2WVK A;  2E8B A;  1XHB A;  3JTJ A;  1H5S D;  3R3I A;  2E3D A;  1HM9 A;  3V90 A;  2VSH A;  3CKV A;  1H7F A;  2Z87 A;  3CGX A;  1ZI3 A;  2RIX A;  2RJ4 A;  3OH1 A;  3JUK A;  3RMV A;  3I0K A;  2D0J A;  2Y4K A;  1R7Y A;  2OEF A;  2OI6 A;  4FRE A;  2CU2 A;  2V0L A;  4C2S A;  4FQW A;  3IOI A;  2RJ9 A;  1QG8 A;  4HO9 A;  4KPX A;  1ZJ2 A;  2UX8 A;  3ZF8 A;  1GX0 A;  1G93 A;  5CQM X;  1FWY A;  1OMX A;  5AJO A;  1H5S C;  4HO0 A;  1H3M A;  4CJ8 A;  1W57 A;  3QVB A;  2MZB A;  1ZI5 A;  4KQL A;  1FOA A;  2ZU9 A;  5C1L A;  1K4V A;  4EE3 A;  2PA4 A;  1LZ0 A;  2FYD B;  2VK9 A;  1FR9 A;  5C1G A;  5C3A A;  3U2T A;  5C3B A;  4Q7C A;  1HV9 A;  1NHE B;  2XWM A;  3RMW A;  4AAW A;  1PZT A;  4M2A A;  2RJ0 A;  4NAN A;  3TQD A;  4Y7V A;  3CKO A;  2WE9 A;  2QKX A;  3ZLL A;  2O1H A;  2JCO A;  4KNR A;  5DDT A;  3K8E A;  2RIZ A;  1NF5 B;  1WT3 A;  2AM4 A;  1E5K A;  1G2V A;  2D7R A;  4D0Z A;  3CKJ A;  1GWV A;  1VPA A;  4BMA A;  2RJ6 A;  2V0K A;  3FOQ A;  4D48 A;  3PKQ A;  5J49 A;  5CQO A;  4AYJ A;  1FGG A;  4B42 A;  1VGU A;  4IRQ A;  1W77 A;  1ZCT A;  2ZU7 A;  3I0C A;  4UEG A;  3V0L A;  1G9R A;  4P02 A;  2C0N A;  4D11 A;  5CMI A;  2V0H A;  2WGZ A;  1WSZ A;  5I1F A;  1HJL A;  3Q80 A;  5IDT A;  1O23 B;  1ZJ3 A;  4FIY A;  3OH0 A;  3PKP A;  4Y7G A;  3DK5 A;  3I0F A;  1VIC A;  3V0N A;  5C38 A;  5BXC A;  2QGI A;  3EE5 A;  5FV9 A;  2OI5 A;  1ZCY A;  1TZF A;  4Y64 A;  4EEG A;  3SXC A;  1G95 A;  1INJ A;  2FY7 A;  3SXB A;  4HO2 A;  4BQH A;  1V83 A;  1ZDG A;  2FFV A;  4JD0 A;  5C4B A;  1H7L A;  4DEC A;  1G23 A;  3KIA A;  1GA8 A;  2V0J A;  1LL0 A;  2RIY A;  4M28 A;  1H5R A;  1ZIZ A;  3PNN A;  4KNX A;  1GQC A;  1R7T A;  4D11 C;  3V91 A;  4LW6 A;  1MP4 A;  4EE5 A;  1VZU A;  4ASY A;  3BCV A;  1Z90 A;  3I0G A;  1H5T A;  2VD4 A;  2AES A;  5C3D A;  2WVL A;  4B5B A;  3I0D A;  3OAM A;  2YQS A;  1VGW A;  2BO6 A;  4KRV A;  1ZJP A;  3FWW A;  1ZJO A;  1IIN A;  2DPW A;  2FFU A;  4M4K A;  3DUV A;  4KC1 A;  4FRD A;  1R81 A;  1LZJ A;  3GUE A;  2ICX A;  3V8Y A;  4FRH A;  1H7T A;  2OEG A;  1JYK A;  2WEE A;  4EE4 A;  3OH4 A;  1R7V A;  4KPZ A;  2AM5 A;  4GBP A;  5DDV A;  1S4P A;  4CJC A;  1R82 A;  3OC9 A;  2AM3 A;  4LW3 A;  2Y7A A;  3SXA A;  1H5S B;  4B2X A;  5L6V A;  2O1F A;  1PZY B;  2P73 A;  3IOH A;  2RJ8 A;  1TW1 A;  2RJ1 A;  4Y9X A;  1OMZ A;  1YP3 A;  2YCM A;  2I5K A;  2P6W A;  2YC5 A;  3Q4S A;  1FG5 N;  4FRP A;  3V0P A;  4B3U A;  5FUH A;  3F1Y A;  2Q4J A;  4P00 A;  5C4E A;  3HL3 A;  3SX8 A;  5EIY A;  3OGZ A;  2GGQ A;  5FU0 A;  4ZDQ A;  1TVY A;  3V0M A;  5CMH A;  3D98 A;  1S4O A;  5FTS A;  1NKH B;  4R7P A;  2JCK A;  4FRO A;  2D7I A;  1FXO A;  4E1K A;  3Q7U A;  4FCE A;  1R7U A;  4B4G A;  3I0E A;  1O7Q A;  1G97 A;  3OH2 A;  3CKN A;  2Y4M A;  1LZI A;  5AJN A;  4G3S A;  2ICY A;  1LVW A;  1FZW A;  2Y6P A;  5CMJ A;  1V84 A;  3U2V A;  3T7O A;  4ASJ A;  3K8D A;  3TZT A;  4O6M A;  3ZGG A;  4B4B A;  1QGS A;  2FYB A;  1ZCU A;  3D8V A;  4KC2 A;  4CJB A;  4MYB A;  3DJ4 A;  3E26 A;  3I0I X;  2VXL A;  2YQC A;  3SPT A;  1G8O A;  1G3L A;  2WAW A;  2WVM A;  1LL3 A;  2FYC B;  4K6R A;  4O6N A;  4YS8 A;  2X65 A;  4AC3 A;  1W55 A;  1YP4 A;  4XWI A;  2XMH A;  4NAL A;  4NAI A;  4EEO A;  1VH3 A;  3F1C A;  1R80 A;  5CQN X;  3U0Y A;  1GQ9 A;  1VGT A;  1WT0 A;  4HO5 A;  1ON8 A;  1G0R A;  3U2X A;  2RJ7 A;  1YRO B;  1ON6 A;  4B4M A;  4FIX A;  1NMM B;  3I0L A;  4FRB A;  1HM8 A;  1FRW A;  3V8Z A;  2Y4J A;  1FR8 A;  4Y62 A;  3SXD A;  2YQJ A;  5C48 A;  1ZI1 A;  5C4D A;  3T7M A;  2X5S A;  5AJP A;  2YQH A;  1HJJ A;  2Z86 A;  2P72 A;  1H4E A;  1MP5 A;  1OQM B;  2V0I A;  3BRK X;  4HCQ A;  5CMF X;  3T7N A;  2XWL A;  5C8R A;  2W0W A;  1FXJ A;  1H5R B;  5C1H A;  4MIX A;  1HM0 A;  4J18 A;  4FRA A;  4M2B A;  5IFY A;  4MND A;  3O3P A;  1LL2 A;  4KXO A;  2I7B A;  1MP3 A;  1EZI A;  2VXM A;  5C4C A;  4G3P A;  2Y4L A;  4FRQ A;  3OH3 A;  2VS3 A;  2PX7 A;  4DDZ A;  2W0V A;  1S4N A;  5C47 A;  1QGQ A;  1H7G A;  4FCU A;  3U2U A;  1TW5 A;  5EJ1 A;  4FRM A;  1XZ6 A;  1R7X A;  1H7Q A;  3ZGF A;  2X60 A;  4Y7U A;  3CKQ A;  3U0X A;  1YP2 A;  5CQL X;  1VH1 A;  1ZJ1 A;  5EJZ A;  1ZDF A;  2FYA A;  3SXE A;  5JQQ A;  2PGY A;  4HO4 A;  1H7E A;  1ZJ0 A;  3V0O A;  4EEA A;  1ZHJ A;  1JVD A;  2BO8 A;  2YC3 A;  2PGV A;  3SX5 A;  2A8W A;  2APC A;  1SS9 A;  3SXG A;  3SX3 A;  2VS5 A;  1H4C A;  3USR A;  3RSB A;  2XWN A;  1O0R A;  1O7O A;  5D91 A;  4Y6U A;  2AGD A;  1H4D A;  1INI A;  4KT7 A;  4Y7F A;  3R2W A;  1FO9 A;  3JUJ A;  2NXV A;  3NGW A;  4JIS A;  2J0B A;  4ARW A;  3USQ A;  2GGO A;  1NQI B;  2J0A A;  2A8U A;  1ZCV A;  1FO8 A;  3I0J A;  2AEC A;  3V0Q A;  2ZU8 A;  4L41 C;  1H7H A;  1JVG A;  1VGZ A;  5IDS A;  1ZI4 A;  2YES A;  5CQP A;  1NWG B;  4B2W A;  4Y7T A;  5CMG X;  4EVW A;  4G3Q A;  4CVH A;  1FGX A;  4HG6 A;  3N9W A;  3IOJ A;  4EEM A;  1GWW A;  5FYE A;  4HO3 A;  1GX4 A;  2I5E A;  3OKR A;  1I52 A;  5C36 A;  3D5N A;  2X5Z A;  1JYL A;  3CU0 A;  4ECM A;  5HS2 A;  1WT2 A; 
#chains in the Genus database with same CATH homology
 1V82 A;  2BO7 A;  2RJ5 A;  1JV1 A;  4D0T A;  3I0H A;  1IIM A;  1VM8 A;  2BO4 A;  2OI7 A;  1G1L A;  5FU8 A;  3ZLK A;  2XME A;  1VZX A;  3SX7 A;  2AE7 A;  4HO6 A;  2VSI A;  1VZT A;  5FTV A;  1EYR A;  1QWJ A;  3U2W A;  4Y63 A;  4HOC A;  3ST8 A;  2AH9 A;  1KWS A;  4G87 A;  4HO8 A;  4Y6N A;  4AYL A;  2VFZ A;  4DE7 A;  2JCJ A;  1WT1 A;  2VS4 A;  1JV3 A;  3E25 A;  4FRL A;  1H5T B;  2O1G A;  2QH5 A;  3LW6 A;  4IRP A;  1MC3 A;  3POL A;  2JCL A;  1WVC A;  1LZ7 A;  1H5S A;  4NAK A;  4KC4 A;  5C49 A;  5D92 A;  2RIT A;  5C4F A;  5L6S A;  2WVK A;  2E8B A;  1XHB A;  3JTJ A;  1H5S D;  3R3I A;  2E3D A;  1HM9 A;  3V90 A;  2VSH A;  3CKV A;  1H7F A;  2Z87 A;  3CGX A;  1ZI3 A;  2RIX A;  2RJ4 A;  3OH1 A;  3JUK A;  3RMV A;  3I0K A;  2D0J A;  2Y4K A;  1R7Y A;  2OEF A;  2OI6 A;  4FRE A;  2CU2 A;  2V0L A;  4C2S A;  4FQW A;  3IOI A;  2RJ9 A;  1QG8 A;  4HO9 A;  4KPX A;  1ZJ2 A;  2UX8 A;  3ZF8 A;  1GX0 A;  1G93 A;  5CQM X;  1FWY A;  1OMX A;  5AJO A;  1H5S C;  4HO0 A;  1H3M A;  4CJ8 A;  1W57 A;  3QVB A;  2MZB A;  1ZI5 A;  4KQL A;  1FOA A;  2ZU9 A;  5C1L A;  1K4V A;  4EE3 A;  2PA4 A;  1LZ0 A;  2FYD B;  2VK9 A;  1FR9 A;  5C1G A;  5C3A A;  3U2T A;  5C3B A;  4Q7C A;  1HV9 A;  1NHE B;  2XWM A;  3RMW A;  4AAW A;  1PZT A;  4M2A A;  2RJ0 A;  4NAN A;  3TQD A;  4Y7V A;  3CKO A;  2WE9 A;  2QKX A;  3ZLL A;  2O1H A;  2JCO A;  4KNR A;  5DDT A;  3K8E A;  2RIZ A;  1NF5 B;  1WT3 A;  2AM4 A;  1E5K A;  1G2V A;  2D7R A;  4D0Z A;  3CKJ A;  1GWV A;  1VPA A;  4BMA A;  2RJ6 A;  2V0K A;  3FOQ A;  4D48 A;  3PKQ A;  5J49 A;  5CQO A;  4AYJ A;  1FGG A;  4B42 A;  1VGU A;  4IRQ A;  1W77 A;  1ZCT A;  2ZU7 A;  3I0C A;  4UEG A;  3V0L A;  1G9R A;  4P02 A;  2C0N A;  4D11 A;  5CMI A;  2V0H A;  2WGZ A;  1WSZ A;  5I1F A;  1HJL A;  3Q80 A;  5IDT A;  1O23 B;  1ZJ3 A;  4FIY A;  3OH0 A;  3PKP A;  4Y7G A;  3DK5 A;  3I0F A;  1VIC A;  3V0N A;  5C38 A;  5BXC A;  2QGI A;  3EE5 A;  5FV9 A;  2OI5 A;  1ZCY A;  1TZF A;  4Y64 A;  4EEG A;  3SXC A;  1G95 A;  1INJ A;  2FY7 A;  3SXB A;  4HO2 A;  4BQH A;  1V83 A;  1ZDG A;  2FFV A;  4JD0 A;  5C4B A;  1H7L A;  4DEC A;  1G23 A;  3KIA A;  1GA8 A;  2V0J A;  1LL0 A;  2RIY A;  4M28 A;  1H5R A;  1ZIZ A;  3PNN A;  4KNX A;  1GQC A;  1R7T A;  4D11 C;  3V91 A;  4LW6 A;  1MP4 A;  4EE5 A;  1VZU A;  4ASY A;  3BCV A;  1Z90 A;  3I0G A;  1H5T A;  2VD4 A;  2AES A;  5C3D A;  2WVL A;  4B5B A;  3I0D A;  3OAM A;  2YQS A;  1VGW A;  2BO6 A;  4KRV A;  1ZJP A;  3FWW A;  1ZJO A;  1IIN A;  2DPW A;  2FFU A;  4M4K A;  3DUV A;  4KC1 A;  4FRD A;  1R81 A;  1LZJ A;  3GUE A;  2ICX A;  3V8Y A;  4FRH A;  1H7T A;  2OEG A;  1JYK A;  2WEE A;  4EE4 A;  3OH4 A;  1R7V A;  4KPZ A;  2AM5 A;  4GBP A;  5DDV A;  1S4P A;  4CJC A;  1R82 A;  3OC9 A;  2AM3 A;  4LW3 A;  2Y7A A;  3SXA A;  1H5S B;  4B2X A;  5L6V A;  2O1F A;  1PZY B;  2P73 A;  3IOH A;  2RJ8 A;  1TW1 A;  2RJ1 A;  4Y9X A;  1OMZ A;  1YP3 A;  2YCM A;  2I5K A;  2P6W A;  2YC5 A;  3Q4S A;  1FG5 N;  4FRP A;  3V0P A;  4B3U A;  5FUH A;  3F1Y A;  2Q4J A;  4P00 A;  5C4E A;  3HL3 A;  3SX8 A;  5EIY A;  3OGZ A;  2GGQ A;  5FU0 A;  4ZDQ A;  1TVY A;  3V0M A;  5CMH A;  3D98 A;  1S4O A;  5FTS A;  1NKH B;  4R7P A;  2JCK A;  4FRO A;  2D7I A;  1FXO A;  4E1K A;  3Q7U A;  4FCE A;  1R7U A;  4B4G A;  3I0E A;  1O7Q A;  1G97 A;  3OH2 A;  3CKN A;  2Y4M A;  1LZI A;  5AJN A;  4G3S A;  2ICY A;  1LVW A;  1FZW A;  2Y6P A;  5CMJ A;  1V84 A;  3U2V A;  3T7O A;  4ASJ A;  3K8D A;  3TZT A;  4O6M A;  3ZGG A;  4B4B A;  1QGS A;  2FYB A;  1ZCU A;  3D8V A;  4KC2 A;  4CJB A;  4MYB A;  3DJ4 A;  3E26 A;  3I0I X;  2VXL A;  2YQC A;  3SPT A;  1G8O A;  1G3L A;  2WAW A;  2WVM A;  1LL3 A;  2FYC B;  4K6R A;  4O6N A;  4YS8 A;  2X65 A;  4AC3 A;  1W55 A;  1YP4 A;  4XWI A;  2XMH A;  4NAL A;  4NAI A;  4EEO A;  1VH3 A;  3F1C A;  1R80 A;  5CQN X;  3U0Y A;  1GQ9 A;  1VGT A;  1WT0 A;  4HO5 A;  1ON8 A;  1G0R A;  3U2X A;  2RJ7 A;  1YRO B;  1ON6 A;  4B4M A;  4FIX A;  1NMM B;  3I0L A;  4FRB A;  1HM8 A;  1FRW A;  3V8Z A;  2Y4J A;  1FR8 A;  4Y62 A;  3SXD A;  2YQJ A;  5C48 A;  1ZI1 A;  5C4D A;  3T7M A;  2X5S A;  5AJP A;  2YQH A;  1HJJ A;  2Z86 A;  2P72 A;  1H4E A;  1MP5 A;  1OQM B;  2V0I A;  3BRK X;  4HCQ A;  5CMF X;  3T7N A;  2XWL A;  5C8R A;  2W0W A;  1FXJ A;  1H5R B;  5C1H A;  4MIX A;  1HM0 A;  4J18 A;  4FRA A;  4M2B A;  5IFY A;  4MND A;  3O3P A;  1LL2 A;  4KXO A;  2I7B A;  1MP3 A;  1EZI A;  2VXM A;  5C4C A;  4G3P A;  2Y4L A;  4FRQ A;  3OH3 A;  2VS3 A;  2PX7 A;  4DDZ A;  2W0V A;  1S4N A;  5C47 A;  1QGQ A;  1H7G A;  4FCU A;  3U2U A;  1TW5 A;  5EJ1 A;  4FRM A;  1XZ6 A;  1R7X A;  1H7Q A;  3ZGF A;  2X60 A;  4Y7U A;  3CKQ A;  3U0X A;  1YP2 A;  5CQL X;  1VH1 A;  1ZJ1 A;  5EJZ A;  1ZDF A;  2FYA A;  3SXE A;  5JQQ A;  2PGY A;  4HO4 A;  1H7E A;  1ZJ0 A;  3V0O A;  4EEA A;  1ZHJ A;  1JVD A;  2BO8 A;  2YC3 A;  2PGV A;  3SX5 A;  2A8W A;  2APC A;  1SS9 A;  3SXG A;  3SX3 A;  2VS5 A;  1H4C A;  3USR A;  3RSB A;  2XWN A;  1O0R A;  1O7O A;  5D91 A;  4Y6U A;  2AGD A;  1H4D A;  1INI A;  4KT7 A;  4Y7F A;  3R2W A;  1FO9 A;  3JUJ A;  2NXV A;  3NGW A;  4JIS A;  2J0B A;  4ARW A;  3USQ A;  2GGO A;  1NQI B;  2J0A A;  2A8U A;  1ZCV A;  1FO8 A;  3I0J A;  2AEC A;  3V0Q A;  2ZU8 A;  4L41 C;  1H7H A;  1JVG A;  1VGZ A;  5IDS A;  1ZI4 A;  2YES A;  5CQP A;  1NWG B;  4B2W A;  4Y7T A;  5CMG X;  4EVW A;  4G3Q A;  4CVH A;  1FGX A;  4HG6 A;  3N9W A;  3IOJ A;  4EEM A;  1GWW A;  5FYE A;  4HO3 A;  1GX4 A;  2I5E A;  3OKR A;  1I52 A;  5C36 A;  3D5N A;  2X5Z A;  1JYL A;  3CU0 A;  4ECM A;  5HS2 A;  1WT2 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...