3SXEA

Crystal structure of aaaa+udp+gal with glycerol as the cryoprotectant
Total Genus 99
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
99
sequence length
293
structure length
293
Chain Sequence
FMVSLPRMVYPQPKVLTPCRKDVLVVTPWLAPIVWEGTFNIDILNEQFRLQNTTIGLTVFAIKKYVAFLKLFLETAEKHFMVGHRVHYYVFTDQPAAVPRVTLGTGRQLSVLEVRAYKRWQDVSMRRMEMISDFCERRFLSEVDYLVCVDVDMEFRDHVGVEILTPLFGTLHPGFYGSSREAFTYERRPQSQAYIPKDEGDFYYLGGFFGGSVQEVQRLTRACHQAMMVDQANGIEAVWHDESHLNKYLLRHKPTKVLSPEYLWDQQLLGWPAVLRKLRFTAVPKNHQAVRNP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Histo-blood group ABO system transferase
publication title Sequence-dependent effects of cryoprotectants on the active sites of the human ABO(H) blood group A and B glycosyltransferases.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 99
structure length 293
sequence length 293
ec nomenclature ec 2.4.1.37: Fucosylgalactoside 3-alpha-galactosyltransferase.
pdb deposition date 2011-07-14
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.550.10 Alpha Beta Alpha-Beta Complex Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A 3sxeA00
1LL0A 2PGVA 5EJ1A 1WSZA 3D8VA 4MYBA 1OMXA 5FU8A 1G97A 4ZDQA 4LW6A 5C1LA 4AC3A 3NGWA 5CQPA 5EJZA 4HO2A 4KRVA 2Y4LA 5CMGX 3GUEA 5C3AA 2V0IA 3U0YA 1NWGB 1G0RA 4FRHA 4KPZA 3CGXA 4BQHA 1HM9A 1VZTA 1MP3A 2WGZA 4NAKA 3I0KA 3OGZA 1G95A 3OC9A 1MP4A 2RJ4A 1G23A 1V82A 3CKOA 4CJBA 1GWWA 1FXJA 3OH1A 3V0NA 1TZFA 1ON8A 1R81A 1I52A 1JV3A 4B2XA 2A8UA 4DECA 1FXOA 1Z90A 1H5TB 3SXDA 2OEFA 1ZI1A 4HO3A 5C49A 5C4DA 5DDVA 3T7OA 3V90A 5BXCA 4HO9A 1JYLA 5CMJA 1HV9A 2P73A 2E3DA 1INJA 1O7QA 5IDSA 1NF5B 4KT7A 1H5SD 3I0LA 4M2AA 1G93A 1PZYB 2P72A 3R2WA 3OH0A 2BO6A 2P6WA 5C8RA 4M2BA 3V0MA 4FROA 1H7EA 4D0ZA 3D98A 2YCMA 3JTJA 1R82A 1GX4A 5C3DA 1YP4A 1H5SB 4FRQA 4Y7VA 1TVYA 2YQHA 3BCVA 3V8ZA 1ON6A 2WVLA 4NAIA 4GBPA 5C4BA 4FRLA 2JCKA 5C36A 3DJ4A 1O0RA 1JVGA 3U2VA 1V83A 3SXAA 2Q4JA 2AE7A 2RJ7A 4HG6A 1EZIA 1IIMA 3CKQA 1VGZA 3I0HA 2Y6PA 3Q4SA 3E26A 1GA8A 3U2TA 1G8OA 3DK5A 3K8DA 1HM0A 4HCQA 1G1LA 4KC2A 3PKPA 5C4EA 1KWSA 3F1YA 1H5RB 4G3PA 1HM8A 3U2WA 2BO8A 4DE7A 1JVDA 2ZU8A 2VXMA 4KNRA 3SX5A 4Y64A 4E1KA 3OKRA 2QGIA 2Y4MA 3RSBA 3V0OA 1HJJA 1VPAA 1R7UA 2VXLA 2FYAA 4FRBA 3V0QA 2YQCA 4Y6UA 1ZJ0A 1H7QA 3Q80A 3ZLLA 3SXBA 3JUKA 4Y63A 4FRDA 1HJLA 2D0JA 2FYCB 4Y7GA 3USRA 2OI5A 2MZBA 2RIXA 2AGDA 4AYJA 3OH4A 1ZJ1A 1YROB 2RJ5A 2X5ZA 4ECMA 1VH1A 4KXOA 1GWVA 1LVWA 1LZ7A 1VGTA 4AAWA 1W77A 1ZHJA 1ZJ3A 3CU0A 4B4MA 1GQ9A 2RJ6A 4EE4A 3SXEA 1FGGA 3I0EA 3JUJA 3I0DA 4FCUA 2YESA 3FOQA 2JCLA 4LW3A 3EE5A 4HOCA 1G3LA 3QVBA 1NKHB 5FUHA 2VFZA 5AJOA 1NMMB 4HO0A 2YC5A 2RIYA 4HO5A 5DDTA 5C4CA 1LZ0A 2I5KA 2D7IA 4L41C 4CVHA 4EEAA 3T7NA 5C48A 4EE3A 2V0LA 2GGOA 5FYEA 5CQMX 2VD4A 3I0FA 4G3QA 2X5SA 5CQNX 3CKJA 5C4FA 2VS3A 2PA4A 1INIA 4EE5A 1VGUA 2VSIA 3HL3A 3IOJA 1QG8A 2XMHA 2AM4A 5C38A 1FRWA 1S4NA 3SPTA 2RJ8A 4DDZA 3R3IA 4MNDA 2Z87A 1QGQA 5C1GA 1G9RA 2CU2A 5CMHA 1H5TA 3T7MA 2OI6A 4Y7UA 4Y7FA 4B42A 2AECA 1GX0A 1ZJOA 4FCEA 4EVWA 3I0CA 1S4PA 2JCOA 1MC3A 3SX7A 3SX8A 1H3MA 1V84A 3D5NA 4B4BA 2O1HA 1ZCUA 4ASJA 4FQWA 2APCA 2QH5A 3V91A 4HO8A 2Y4JA 1YP2A 3CKVA 4M4KA 3KIAA 3PNNA 1E5KA 1FGXA 1XZ6A 5JQQA 1GQCA 2V0KA 5L6SA 2X65A 4Y9XA 1FG5N 5AJPA 1H5SC 2PGYA 2BO4A 2RJ0A 1OQMB 1ZDGA 4D11A 1FO9A 2I5EA 3BRKX 1H5SA 4KC4A 3USQA 5C1HA 4EEMA 1ZCVA 1IINA 1SS9A 3V0PA 3PKQA 3RMWA 4B4GA 4CJ8A 3U0XA 4ASYA 4Y7TA 2VSHA 2XWMA 1H7LA 4KQLA 4R7PA 1ZCYA 2V0JA 2WAWA 1LL2A 1R80A 4HO4A 1ZI4A 3TQDA 5AJNA 2RIZA 1W55A 2NXVA 2DPWA 1H4EA 1H5RA 5CMIA 2FY7A 4JISA 4Y62A 1W57A 1ZJ2A 2WEEA 4HO6A 3U2UA 2AM5A 3OAMA 1FO8A 1WT0A 1NQIB 2XWLA 1H7HA 1VGWA 3N9WA 5FTVA 3SXCA 1R7VA 1XHBA 4NALA 1NHEB 4C2SA 1FZWA 2E8BA 2XWNA 1VM8A 1S4OA 1TW5A 3ST8A 5HS2A 2FFVA 1FOAA 1PZTA 5EIYA 1ZIZA 3ZGFA 4P00A 2OI7A 3F1CA 4IRPA 5FU0A 2AH9A 3K8EA 1WVCA 3CKNA 1MP5A 1FWYA 1H4DA 2OEGA 4EEGA 1FR8A 5IFYA 3DUVA 1WT1A 2PX7A 4BMAA 4G3SA 2W0WA 4FRMA 1JYKA 3V8YA 4NANA 1JV1A 4IRQA 4B5BA 3LW6A 2ICYA 3OH3A 4UEGA 1VH3A 4FREA 2Z86A 2O1FA 1ZCTA 1LZJA 4G87A 3SX3A 4KNXA 2YQJA 2YQSA 1O23B 4M28A 4KPXA 5CMFX 1EYRA 4K6RA 4D48A 1R7YA 3O3PA 2QKXA 1WT3A 3TZTA 1ZI5A 4P02A 1YP3A 2UX8A 1K4VA 3OH2A 3RMVA 1ZI3A 4JD0A 3Q7UA 3ZLKA 1OMZA 2GGQA 2FYBA 2JCJA 4B2WA 2W0VA 4CJCA 1QGSA 2Y7AA 1VICA 2ZU7A 2X60A 2WE9A 1LZIA 1VZXA 2FFUA 2V0HA 2RJ1A 5CQLX 1ZJPA 2VS4A 4B3UA 2XMEA 3SXGA 3ZGGA 2A8WA 2WVKA 3ZF8A 3POLA 4AYLA 5FTSA 5C3BA 4XWIA 1G2VA 2AM3A 5FV9A 2D7RA 2RJ9A 4D11C 1R7TA 4ARWA 3IOHA 1TW1A 2Y4KA 1O7OA 2RITA 1VZUA 1R7XA 5CQOA 1LL3A 2BO7A 1FR9A 2O1GA 2WVMA 4FRAA 5I1FA 1ZDFA 4D0TA 2YC3A 1QWJA 4YS8A 2VS5A 5J49A 3I0JA 4KC1A 3E25A 1H4CA 2ZU9A 3IOIA 4Y6NA 2I7BA 4FRPA 3I0IX 3I0GA 5C47A 5IDTA 3FWWA 4EEOA 3V0LA 2AESA 1H7TA 1WT2A 2ICXA 1H7FA 4J18A 5L6VA 1H7GA 3U2XA 2FYDB
chains in the Genus database with same CATH superfamily
1LL0A 2PGVA 5EJ1A 1WSZA 3D8VA 4MYBA 1OMXA 5FU8A 1G97A 4ZDQA 4LW6A 5C1LA 4AC3A 3NGWA 5CQPA 5EJZA 4HO2A 4KRVA 2Y4LA 5CMGX 3GUEA 5C3AA 2J0BA 2V0IA 3U0YA 1NWGB 1G0RA 4FRHA 4KPZA 3CGXA 4BQHA 1HM9A 1VZTA 1MP3A 2WGZA 4NAKA 3I0KA 3OGZA 1G95A 3OC9A 1MP4A 2RJ4A 1G23A 1V82A 3CKOA 4CJBA 1GWWA 1FXJA 3OH1A 3V0NA 1TZFA 1ON8A 1R81A 1I52A 1JV3A 4B2XA 2A8UA 4DECA 1FXOA 1Z90A 1H5TB 3SXDA 2OEFA 1ZI1A 4HO3A 5C49A 5C4DA 5DDVA 3T7OA 3V90A 5BXCA 4HO9A 4FIXA 1JYLA 5CMJA 1HV9A 2P73A 2E3DA 1INJA 1O7QA 5IDSA 1NF5B 4KT7A 1H5SD 3I0LA 4M2AA 1G93A 1PZYB 2P72A 3R2WA 3OH0A 2BO6A 2P6WA 5C8RA 4M2BA 3V0MA 4FROA 1H7EA 4D0ZA 3D98A 2YCMA 3JTJA 1R82A 1GX4A 5C3DA 1YP4A 1H5SB 4FRQA 4Y7VA 1TVYA 2YQHA 3BCVA 3V8ZA 1ON6A 2WVLA 4NAIA 4GBPA 5C4BA 4FRLA 2JCKA 5C36A 3DJ4A 1O0RA 1JVGA 3U2VA 1V83A 3SXAA 2Q4JA 2AE7A 2RJ7A 4HG6A 1EZIA 1IIMA 3CKQA 1VGZA 3I0HA 2Y6PA 3Q4SA 3E26A 1GA8A 3U2TA 1G8OA 3DK5A 3K8DA 1HM0A 4HCQA 1G1LA 4KC2A 3PKPA 5C4EA 1KWSA 3F1YA 1H5RB 4G3PA 1HM8A 3U2WA 2BO8A 4DE7A 1JVDA 2ZU8A 2VXMA 4KNRA 3SX5A 4Y64A 4E1KA 3OKRA 2QGIA 2Y4MA 3RSBA 3V0OA 1HJJA 1VPAA 1R7UA 2VXLA 2FYAA 5D91A 4FRBA 3V0QA 2YQCA 4Y6UA 1ZJ0A 1H7QA 3Q80A 3ZLLA 3SXBA 3JUKA 4Y63A 4FRDA 1HJLA 2D0JA 2FYCB 4Y7GA 3USRA 2OI5A 2MZBA 2RIXA 4Q7CA 2AGDA 4AYJA 3OH4A 1ZJ1A 1YROB 2RJ5A 2X5ZA 4ECMA 1VH1A 4KXOA 1GWVA 1LVWA 1LZ7A 1VGTA 4AAWA 1W77A 1ZHJA 1ZJ3A 3CU0A 4B4MA 1GQ9A 2RJ6A 4EE4A 3SXEA 1FGGA 3I0EA 3JUJA 3I0DA 4FCUA 2YESA 3FOQA 2JCLA 4LW3A 3EE5A 4HOCA 1G3LA 3QVBA 1NKHB 5FUHA 2VFZA 5AJOA 1NMMB 4HO0A 2YC5A 2RIYA 4HO5A 5DDTA 5C4CA 1LZ0A 2I5KA 2D7IA 4L41C 4CVHA 4EEAA 3T7NA 5C48A 4EE3A 2V0LA 2GGOA 5FYEA 5CQMX 2VD4A 3I0FA 4G3QA 2X5SA 5CQNX 3CKJA 5C4FA 2VS3A 2PA4A 1INIA 4EE5A 1VGUA 2VSIA 3HL3A 3IOJA 1QG8A 2XMHA 2AM4A 5C38A 1FRWA 1S4NA 3SPTA 2RJ8A 4DDZA 3R3IA 4MNDA 2Z87A 1QGQA 5C1GA 1G9RA 2CU2A 5CMHA 1H5TA 3T7MA 2OI6A 4Y7UA 4Y7FA 4B42A 2AECA 1GX0A 1ZJOA 4FCEA 4EVWA 3I0CA 1S4PA 2JCOA 1MC3A 3SX7A 3SX8A 1H3MA 1V84A 3D5NA 4B4BA 2O1HA 1ZCUA 4ASJA 4FQWA 2APCA 2QH5A 3V91A 4HO8A 2Y4JA 1YP2A 3CKVA 4M4KA 3KIAA 3PNNA 4O6MA 1E5KA 1FGXA 1XZ6A 5JQQA 2C0NA 1GQCA 2V0KA 5L6SA 2X65A 4Y9XA 1FG5N 2VK9A 5AJPA 1H5SC 2PGYA 2BO4A 2RJ0A 1OQMB 1ZDGA 4D11A 1FO9A 2I5EA 3BRKX 1H5SA 4KC4A 3USQA 5C1HA 4EEMA 1ZCVA 1IINA 1SS9A 3V0PA 3PKQA 3RMWA 4B4GA 4CJ8A 3U0XA 4ASYA 4Y7TA 2VSHA 2XWMA 1H7LA 4KQLA 4R7PA 1ZCYA 2V0JA 2WAWA 4FIYA 1LL2A 1R80A 4HO4A 1ZI4A 3TQDA 5AJNA 2RIZA 1W55A 2NXVA 2DPWA 1H4EA 1H5RA 5CMIA 2FY7A 4JISA 4Y62A 1W57A 1ZJ2A 2WEEA 4HO6A 3U2UA 2AM5A 3OAMA 1FO8A 1WT0A 1NQIB 2XWLA 1H7HA 1VGWA 3N9WA 5FTVA 3SXCA 1R7VA 1XHBA 4NALA 1NHEB 4C2SA 1FZWA 2E8BA 4O6NA 2XWNA 1VM8A 1S4OA 1TW5A 3ST8A 5HS2A 2FFVA 1FOAA 1PZTA 5EIYA 1ZIZA 3ZGFA 4P00A 2OI7A 3F1CA 4IRPA 5FU0A 2AH9A 3K8EA 1WVCA 3CKNA 1MP5A 1FWYA 1H4DA 2OEGA 4EEGA 1FR8A 5IFYA 3DUVA 1WT1A 2PX7A 4BMAA 4G3SA 2W0WA 4FRMA 1JYKA 3V8YA 4NANA 1JV1A 4IRQA 4B5BA 3LW6A 2ICYA 3OH3A 4UEGA 1VH3A 4FREA 2Z86A 2O1FA 1ZCTA 1LZJA 4G87A 3SX3A 4KNXA 2YQJA 2YQSA 1O23B 4M28A 4KPXA 5CMFX 1EYRA 4K6RA 4D48A 1R7YA 3O3PA 2QKXA 1WT3A 3TZTA 1ZI5A 2J0AA 4P02A 1YP3A 2UX8A 1K4VA 3OH2A 3RMVA 1ZI3A 4JD0A 3Q7UA 3ZLKA 1OMZA 2GGQA 2FYBA 2JCJA 4B2WA 2W0VA 4CJCA 1QGSA 2Y7AA 1VICA 2ZU7A 2X60A 2WE9A 1LZIA 1VZXA 2FFUA 2V0HA 2RJ1A 5CQLX 5D92A 1ZJPA 2VS4A 4B3UA 2XMEA 3SXGA 3ZGGA 2A8WA 2WVKA 3ZF8A 3POLA 4AYLA 4MIXA 5FTSA 5C3BA 4XWIA 1G2VA 2AM3A 5FV9A 2D7RA 2RJ9A 4D11C 1R7TA 4ARWA 3IOHA 1TW1A 2Y4KA 1O7OA 2RITA 1VZUA 1R7XA 5CQOA 1LL3A 2BO7A 1FR9A 2O1GA 2WVMA 4FRAA 5I1FA 1ZDFA 4D0TA 2YC3A 1QWJA 4YS8A 2VS5A 5J49A 3I0JA 4KC1A 3E25A 1H4CA 2ZU9A 3IOIA 4Y6NA 2I7BA 4FRPA 3I0IX 3I0GA 5C47A 5IDTA 3FWWA 4EEOA 3V0LA 2AESA 1H7TA 1WT2A 2ICXA 1H7FA 4J18A 5L6VA 1H7GA 3U2XA 2FYDB
chains in the Genus database with same CATH topology
1LL0A 2PGVA 5EJ1A 1WSZA 3D8VA 4MYBA 1OMXA 5FU8A 1G97A 4ZDQA 4LW6A 5C1LA 4AC3A 3NGWA 5CQPA 5EJZA 4HO2A 4KRVA 2Y4LA 5CMGX 3GUEA 5C3AA 2J0BA 2V0IA 3U0YA 1NWGB 1G0RA 4FRHA 4KPZA 3CGXA 4BQHA 1HM9A 1VZTA 1MP3A 2WGZA 4NAKA 3I0KA 3OGZA 1G95A 3OC9A 1MP4A 2RJ4A 1G23A 1V82A 3CKOA 4CJBA 1GWWA 1FXJA 3OH1A 3V0NA 1TZFA 1ON8A 1R81A 1I52A 1JV3A 4B2XA 2A8UA 4DECA 1FXOA 1Z90A 1H5TB 3SXDA 2OEFA 1ZI1A 4HO3A 5C49A 5C4DA 5DDVA 3T7OA 3V90A 5BXCA 4HO9A 4FIXA 1JYLA 5CMJA 1HV9A 2P73A 2E3DA 1INJA 1O7QA 5IDSA 1NF5B 4KT7A 1H5SD 3I0LA 4M2AA 1G93A 1PZYB 2P72A 3R2WA 3OH0A 2BO6A 2P6WA 5C8RA 4M2BA 3V0MA 4FROA 1H7EA 4D0ZA 3D98A 2YCMA 3JTJA 1R82A 1GX4A 5C3DA 1YP4A 1H5SB 4FRQA 4Y7VA 1TVYA 2YQHA 3BCVA 3V8ZA 1ON6A 2WVLA 4NAIA 4GBPA 5C4BA 4FRLA 2JCKA 5C36A 3DJ4A 1O0RA 1JVGA 3U2VA 1V83A 3SXAA 2Q4JA 2AE7A 2RJ7A 4HG6A 1EZIA 1IIMA 3CKQA 1VGZA 3I0HA 2Y6PA 3Q4SA 3E26A 1GA8A 3U2TA 1G8OA 3DK5A 3K8DA 1HM0A 4HCQA 1G1LA 4KC2A 3PKPA 5C4EA 1KWSA 3F1YA 1H5RB 4G3PA 1HM8A 3U2WA 2BO8A 4DE7A 1JVDA 2ZU8A 2VXMA 4KNRA 3SX5A 4Y64A 4E1KA 3OKRA 2QGIA 2Y4MA 3RSBA 3V0OA 1HJJA 1VPAA 1R7UA 2VXLA 2FYAA 5D91A 4FRBA 3V0QA 2YQCA 4Y6UA 1ZJ0A 1H7QA 3Q80A 3ZLLA 3SXBA 3JUKA 4Y63A 4FRDA 1HJLA 2D0JA 2FYCB 4Y7GA 3USRA 2OI5A 2MZBA 2RIXA 4Q7CA 2AGDA 4AYJA 3OH4A 1ZJ1A 1YROB 2RJ5A 2X5ZA 4ECMA 1VH1A 4KXOA 1GWVA 1LVWA 1LZ7A 1VGTA 4AAWA 1W77A 1ZHJA 1ZJ3A 3CU0A 4B4MA 1GQ9A 2RJ6A 4EE4A 3SXEA 1FGGA 3I0EA 3JUJA 3I0DA 4FCUA 2YESA 3FOQA 2JCLA 4LW3A 3EE5A 4HOCA 1G3LA 3QVBA 1NKHB 5FUHA 2VFZA 5AJOA 1NMMB 4HO0A 2YC5A 2RIYA 4HO5A 5DDTA 5C4CA 1LZ0A 2I5KA 2D7IA 4L41C 4CVHA 4EEAA 3T7NA 5C48A 4EE3A 2V0LA 2GGOA 5FYEA 5CQMX 2VD4A 3I0FA 4G3QA 2X5SA 5CQNX 3CKJA 5C4FA 2VS3A 2PA4A 1INIA 4EE5A 1VGUA 2VSIA 3HL3A 3IOJA 1QG8A 2XMHA 2AM4A 5C38A 1FRWA 1S4NA 3SPTA 2RJ8A 4DDZA 3R3IA 4MNDA 2Z87A 1QGQA 5C1GA 1G9RA 2CU2A 5CMHA 1H5TA 3T7MA 2OI6A 4Y7UA 4Y7FA 4B42A 2AECA 1GX0A 1ZJOA 4FCEA 4EVWA 3I0CA 1S4PA 2JCOA 1MC3A 3SX7A 3SX8A 1H3MA 1V84A 3D5NA 4B4BA 2O1HA 1ZCUA 4ASJA 4FQWA 2APCA 2QH5A 3V91A 4HO8A 2Y4JA 1YP2A 3CKVA 4M4KA 3KIAA 3PNNA 4O6MA 1E5KA 1FGXA 1XZ6A 5JQQA 2C0NA 1GQCA 2V0KA 5L6SA 2X65A 4Y9XA 1FG5N 2VK9A 5AJPA 1H5SC 2PGYA 2BO4A 2RJ0A 1OQMB 1ZDGA 4D11A 1FO9A 2I5EA 3BRKX 1H5SA 4KC4A 3USQA 5C1HA 4EEMA 1ZCVA 1IINA 1SS9A 3V0PA 3PKQA 3RMWA 4B4GA 4CJ8A 3U0XA 4ASYA 4Y7TA 2VSHA 2XWMA 1H7LA 4KQLA 4R7PA 1ZCYA 2V0JA 2WAWA 4FIYA 1LL2A 1R80A 4HO4A 1ZI4A 3TQDA 5AJNA 2RIZA 1W55A 2NXVA 2DPWA 1H4EA 1H5RA 5CMIA 2FY7A 4JISA 4Y62A 1W57A 1ZJ2A 2WEEA 4HO6A 3U2UA 2AM5A 3OAMA 1FO8A 1WT0A 1NQIB 2XWLA 1H7HA 1VGWA 3N9WA 5FTVA 3SXCA 1R7VA 1XHBA 4NALA 1NHEB 4C2SA 1FZWA 2E8BA 4O6NA 2XWNA 1VM8A 1S4OA 1TW5A 3ST8A 5HS2A 2FFVA 1FOAA 1PZTA 5EIYA 1ZIZA 3ZGFA 4P00A 2OI7A 3F1CA 4IRPA 5FU0A 2AH9A 3K8EA 1WVCA 3CKNA 1MP5A 1FWYA 1H4DA 2OEGA 4EEGA 1FR8A 5IFYA 3DUVA 1WT1A 2PX7A 4BMAA 4G3SA 2W0WA 4FRMA 1JYKA 3V8YA 4NANA 1JV1A 4IRQA 4B5BA 3LW6A 2ICYA 3OH3A 4UEGA 1VH3A 4FREA 2Z86A 2O1FA 1ZCTA 1LZJA 4G87A 3SX3A 4KNXA 2YQJA 2YQSA 1O23B 4M28A 4KPXA 5CMFX 1EYRA 4K6RA 4D48A 1R7YA 3O3PA 2QKXA 1WT3A 3TZTA 1ZI5A 2J0AA 4P02A 1YP3A 2UX8A 1K4VA 3OH2A 3RMVA 1ZI3A 4JD0A 3Q7UA 3ZLKA 1OMZA 2GGQA 2FYBA 2JCJA 4B2WA 2W0VA 4CJCA 1QGSA 2Y7AA 1VICA 2ZU7A 2X60A 2WE9A 1LZIA 1VZXA 2FFUA 2V0HA 2RJ1A 5CQLX 5D92A 1ZJPA 2VS4A 4B3UA 2XMEA 3SXGA 3ZGGA 2A8WA 2WVKA 3ZF8A 3POLA 4AYLA 4MIXA 5FTSA 5C3BA 4XWIA 1G2VA 2AM3A 5FV9A 2D7RA 2RJ9A 4D11C 1R7TA 4ARWA 3IOHA 1TW1A 2Y4KA 1O7OA 2RITA 1VZUA 1R7XA 5CQOA 1LL3A 2BO7A 1FR9A 2O1GA 2WVMA 4FRAA 5I1FA 1ZDFA 4D0TA 2YC3A 1QWJA 4YS8A 2VS5A 5J49A 3I0JA 4KC1A 3E25A 1H4CA 2ZU9A 3IOIA 4Y6NA 2I7BA 4FRPA 3I0IX 3I0GA 5C47A 5IDTA 3FWWA 4EEOA 3V0LA 2AESA 1H7TA 1WT2A 2ICXA 1H7FA 4J18A 5L6VA 1H7GA 3U2XA 2FYDB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1LL0 A;  2PGV A;  5EJ1 A;  1WSZ A;  3D8V A;  4MYB A;  1OMX A;  5FU8 A;  1G97 A;  4ZDQ A;  4LW6 A;  5C1L A;  4AC3 A;  3NGW A;  5CQP A;  5EJZ A;  4HO2 A;  4KRV A;  2Y4L A;  5CMG X;  3GUE A;  5C3A A;  2V0I A;  3U0Y A;  1NWG B;  1G0R A;  4FRH A;  4KPZ A;  3CGX A;  4BQH A;  1HM9 A;  1VZT A;  1MP3 A;  2WGZ A;  4NAK A;  3I0K A;  3OGZ A;  1G95 A;  3OC9 A;  1MP4 A;  2RJ4 A;  1G23 A;  1V82 A;  3CKO A;  4CJB A;  1GWW A;  1FXJ A;  3OH1 A;  3V0N A;  1TZF A;  1ON8 A;  1R81 A;  1I52 A;  1JV3 A;  4B2X A;  2A8U A;  4DEC A;  1FXO A;  1Z90 A;  1H5T B;  3SXD A;  2OEF A;  1ZI1 A;  4HO3 A;  5C49 A;  5C4D A;  5DDV A;  3T7O A;  3V90 A;  5BXC A;  4HO9 A;  1JYL A;  5CMJ A;  1HV9 A;  2P73 A;  2E3D A;  1INJ A;  1O7Q A;  5IDS A;  1NF5 B;  4KT7 A;  1H5S D;  3I0L A;  4M2A A;  1G93 A;  1PZY B;  2P72 A;  3R2W A;  3OH0 A;  2BO6 A;  2P6W A;  5C8R A;  4M2B A;  3V0M A;  4FRO A;  1H7E A;  4D0Z A;  3D98 A;  2YCM A;  3JTJ A;  1R82 A;  1GX4 A;  5C3D A;  1YP4 A;  1H5S B;  4FRQ A;  4Y7V A;  1TVY A;  2YQH A;  3BCV A;  3V8Z A;  1ON6 A;  2WVL A;  4NAI A;  4GBP A;  5C4B A;  4FRL A;  2JCK A;  5C36 A;  3DJ4 A;  1O0R A;  1JVG A;  3U2V A;  1V83 A;  3SXA A;  2Q4J A;  2AE7 A;  2RJ7 A;  4HG6 A;  1EZI A;  1IIM A;  3CKQ A;  1VGZ A;  3I0H A;  2Y6P A;  3Q4S A;  3E26 A;  1GA8 A;  3U2T A;  1G8O A;  3DK5 A;  3K8D A;  1HM0 A;  4HCQ A;  1G1L A;  4KC2 A;  3PKP A;  5C4E A;  1KWS A;  3F1Y A;  1H5R B;  4G3P A;  1HM8 A;  3U2W A;  2BO8 A;  4DE7 A;  1JVD A;  2ZU8 A;  2VXM A;  4KNR A;  3SX5 A;  4Y64 A;  4E1K A;  3OKR A;  2QGI A;  2Y4M A;  3RSB A;  3V0O A;  1HJJ A;  1VPA A;  1R7U A;  2VXL A;  2FYA A;  4FRB A;  3V0Q A;  2YQC A;  4Y6U A;  1ZJ0 A;  1H7Q A;  3Q80 A;  3ZLL A;  3SXB A;  3JUK A;  4Y63 A;  4FRD A;  1HJL A;  2D0J A;  2FYC B;  4Y7G A;  3USR A;  2OI5 A;  2MZB A;  2RIX A;  2AGD A;  4AYJ A;  3OH4 A;  1ZJ1 A;  1YRO B;  2RJ5 A;  2X5Z A;  4ECM A;  1VH1 A;  4KXO A;  1GWV A;  1LVW A;  1LZ7 A;  1VGT A;  4AAW A;  1W77 A;  1ZHJ A;  1ZJ3 A;  3CU0 A;  4B4M A;  1GQ9 A;  2RJ6 A;  4EE4 A;  3SXE A;  1FGG A;  3I0E A;  3JUJ A;  3I0D A;  4FCU A;  2YES A;  3FOQ A;  2JCL A;  4LW3 A;  3EE5 A;  4HOC A;  1G3L A;  3QVB A;  1NKH B;  5FUH A;  2VFZ A;  5AJO A;  1NMM B;  4HO0 A;  2YC5 A;  2RIY A;  4HO5 A;  5DDT A;  5C4C A;  1LZ0 A;  2I5K A;  2D7I A;  4L41 C;  4CVH A;  4EEA A;  3T7N A;  5C48 A;  4EE3 A;  2V0L A;  2GGO A;  5FYE A;  5CQM X;  2VD4 A;  3I0F A;  4G3Q A;  2X5S A;  5CQN X;  3CKJ A;  5C4F A;  2VS3 A;  2PA4 A;  1INI A;  4EE5 A;  1VGU A;  2VSI A;  3HL3 A;  3IOJ A;  1QG8 A;  2XMH A;  2AM4 A;  5C38 A;  1FRW A;  1S4N A;  3SPT A;  2RJ8 A;  4DDZ A;  3R3I A;  4MND A;  2Z87 A;  1QGQ A;  5C1G A;  1G9R A;  2CU2 A;  5CMH A;  1H5T A;  3T7M A;  2OI6 A;  4Y7U A;  4Y7F A;  4B42 A;  2AEC A;  1GX0 A;  1ZJO A;  4FCE A;  4EVW A;  3I0C A;  1S4P A;  2JCO A;  1MC3 A;  3SX7 A;  3SX8 A;  1H3M A;  1V84 A;  3D5N A;  4B4B A;  2O1H A;  1ZCU A;  4ASJ A;  4FQW A;  2APC A;  2QH5 A;  3V91 A;  4HO8 A;  2Y4J A;  1YP2 A;  3CKV A;  4M4K A;  3KIA A;  3PNN A;  1E5K A;  1FGX A;  1XZ6 A;  5JQQ A;  1GQC A;  2V0K A;  5L6S A;  2X65 A;  4Y9X A;  1FG5 N;  5AJP A;  1H5S C;  2PGY A;  2BO4 A;  2RJ0 A;  1OQM B;  1ZDG A;  4D11 A;  1FO9 A;  2I5E A;  3BRK X;  1H5S A;  4KC4 A;  3USQ A;  5C1H A;  4EEM A;  1ZCV A;  1IIN A;  1SS9 A;  3V0P A;  3PKQ A;  3RMW A;  4B4G A;  4CJ8 A;  3U0X A;  4ASY A;  4Y7T A;  2VSH A;  2XWM A;  1H7L A;  4KQL A;  4R7P A;  1ZCY A;  2V0J A;  2WAW A;  1LL2 A;  1R80 A;  4HO4 A;  1ZI4 A;  3TQD A;  5AJN A;  2RIZ A;  1W55 A;  2NXV A;  2DPW A;  1H4E A;  1H5R A;  5CMI A;  2FY7 A;  4JIS A;  4Y62 A;  1W57 A;  1ZJ2 A;  2WEE A;  4HO6 A;  3U2U A;  2AM5 A;  3OAM A;  1FO8 A;  1WT0 A;  1NQI B;  2XWL A;  1H7H A;  1VGW A;  3N9W A;  5FTV A;  3SXC A;  1R7V A;  1XHB A;  4NAL A;  1NHE B;  4C2S A;  1FZW A;  2E8B A;  2XWN A;  1VM8 A;  1S4O A;  1TW5 A;  3ST8 A;  5HS2 A;  2FFV A;  1FOA A;  1PZT A;  5EIY A;  1ZIZ A;  3ZGF A;  4P00 A;  2OI7 A;  3F1C A;  4IRP A;  5FU0 A;  2AH9 A;  3K8E A;  1WVC A;  3CKN A;  1MP5 A;  1FWY A;  1H4D A;  2OEG A;  4EEG A;  1FR8 A;  5IFY A;  3DUV A;  1WT1 A;  2PX7 A;  4BMA A;  4G3S A;  2W0W A;  4FRM A;  1JYK A;  3V8Y A;  4NAN A;  1JV1 A;  4IRQ A;  4B5B A;  3LW6 A;  2ICY A;  3OH3 A;  4UEG A;  1VH3 A;  4FRE A;  2Z86 A;  2O1F A;  1ZCT A;  1LZJ A;  4G87 A;  3SX3 A;  4KNX A;  2YQJ A;  2YQS A;  1O23 B;  4M28 A;  4KPX A;  5CMF X;  1EYR A;  4K6R A;  4D48 A;  1R7Y A;  3O3P A;  2QKX A;  1WT3 A;  3TZT A;  1ZI5 A;  4P02 A;  1YP3 A;  2UX8 A;  1K4V A;  3OH2 A;  3RMV A;  1ZI3 A;  4JD0 A;  3Q7U A;  3ZLK A;  1OMZ A;  2GGQ A;  2FYB A;  2JCJ A;  4B2W A;  2W0V A;  4CJC A;  1QGS A;  2Y7A A;  1VIC A;  2ZU7 A;  2X60 A;  2WE9 A;  1LZI A;  1VZX A;  2FFU A;  2V0H A;  2RJ1 A;  5CQL X;  1ZJP A;  2VS4 A;  4B3U A;  2XME A;  3SXG A;  3ZGG A;  2A8W A;  2WVK A;  3ZF8 A;  3POL A;  4AYL A;  5FTS A;  5C3B A;  4XWI A;  1G2V A;  2AM3 A;  5FV9 A;  2D7R A;  2RJ9 A;  4D11 C;  1R7T A;  4ARW A;  3IOH A;  1TW1 A;  2Y4K A;  1O7O A;  2RIT A;  1VZU A;  1R7X A;  5CQO A;  1LL3 A;  2BO7 A;  1FR9 A;  2O1G A;  2WVM A;  4FRA A;  5I1F A;  1ZDF A;  4D0T A;  2YC3 A;  1QWJ A;  4YS8 A;  2VS5 A;  5J49 A;  3I0J A;  4KC1 A;  3E25 A;  1H4C A;  2ZU9 A;  3IOI A;  4Y6N A;  2I7B A;  4FRP A;  3I0I X;  3I0G A;  5C47 A;  5IDT A;  3FWW A;  4EEO A;  3V0L A;  2AES A;  1H7T A;  1WT2 A;  2ICX A;  1H7F A;  4J18 A;  5L6V A;  1H7G A;  3U2X A;  2FYD B; 
#chains in the Genus database with same CATH topology
 1LL0 A;  2PGV A;  5EJ1 A;  1WSZ A;  3D8V A;  4MYB A;  1OMX A;  5FU8 A;  1G97 A;  4ZDQ A;  4LW6 A;  5C1L A;  4AC3 A;  3NGW A;  5CQP A;  5EJZ A;  4HO2 A;  4KRV A;  2Y4L A;  5CMG X;  3GUE A;  5C3A A;  2J0B A;  2V0I A;  3U0Y A;  1NWG B;  1G0R A;  4FRH A;  4KPZ A;  3CGX A;  4BQH A;  1HM9 A;  1VZT A;  1MP3 A;  2WGZ A;  4NAK A;  3I0K A;  3OGZ A;  1G95 A;  3OC9 A;  1MP4 A;  2RJ4 A;  1G23 A;  1V82 A;  3CKO A;  4CJB A;  1GWW A;  1FXJ A;  3OH1 A;  3V0N A;  1TZF A;  1ON8 A;  1R81 A;  1I52 A;  1JV3 A;  4B2X A;  2A8U A;  4DEC A;  1FXO A;  1Z90 A;  1H5T B;  3SXD A;  2OEF A;  1ZI1 A;  4HO3 A;  5C49 A;  5C4D A;  5DDV A;  3T7O A;  3V90 A;  5BXC A;  4HO9 A;  4FIX A;  1JYL A;  5CMJ A;  1HV9 A;  2P73 A;  2E3D A;  1INJ A;  1O7Q A;  5IDS A;  1NF5 B;  4KT7 A;  1H5S D;  3I0L A;  4M2A A;  1G93 A;  1PZY B;  2P72 A;  3R2W A;  3OH0 A;  2BO6 A;  2P6W A;  5C8R A;  4M2B A;  3V0M A;  4FRO A;  1H7E A;  4D0Z A;  3D98 A;  2YCM A;  3JTJ A;  1R82 A;  1GX4 A;  5C3D A;  1YP4 A;  1H5S B;  4FRQ A;  4Y7V A;  1TVY A;  2YQH A;  3BCV A;  3V8Z A;  1ON6 A;  2WVL A;  4NAI A;  4GBP A;  5C4B A;  4FRL A;  2JCK A;  5C36 A;  3DJ4 A;  1O0R A;  1JVG A;  3U2V A;  1V83 A;  3SXA A;  2Q4J A;  2AE7 A;  2RJ7 A;  4HG6 A;  1EZI A;  1IIM A;  3CKQ A;  1VGZ A;  3I0H A;  2Y6P A;  3Q4S A;  3E26 A;  1GA8 A;  3U2T A;  1G8O A;  3DK5 A;  3K8D A;  1HM0 A;  4HCQ A;  1G1L A;  4KC2 A;  3PKP A;  5C4E A;  1KWS A;  3F1Y A;  1H5R B;  4G3P A;  1HM8 A;  3U2W A;  2BO8 A;  4DE7 A;  1JVD A;  2ZU8 A;  2VXM A;  4KNR A;  3SX5 A;  4Y64 A;  4E1K A;  3OKR A;  2QGI A;  2Y4M A;  3RSB A;  3V0O A;  1HJJ A;  1VPA A;  1R7U A;  2VXL A;  2FYA A;  5D91 A;  4FRB A;  3V0Q A;  2YQC A;  4Y6U A;  1ZJ0 A;  1H7Q A;  3Q80 A;  3ZLL A;  3SXB A;  3JUK A;  4Y63 A;  4FRD A;  1HJL A;  2D0J A;  2FYC B;  4Y7G A;  3USR A;  2OI5 A;  2MZB A;  2RIX A;  4Q7C A;  2AGD A;  4AYJ A;  3OH4 A;  1ZJ1 A;  1YRO B;  2RJ5 A;  2X5Z A;  4ECM A;  1VH1 A;  4KXO A;  1GWV A;  1LVW A;  1LZ7 A;  1VGT A;  4AAW A;  1W77 A;  1ZHJ A;  1ZJ3 A;  3CU0 A;  4B4M A;  1GQ9 A;  2RJ6 A;  4EE4 A;  3SXE A;  1FGG A;  3I0E A;  3JUJ A;  3I0D A;  4FCU A;  2YES A;  3FOQ A;  2JCL A;  4LW3 A;  3EE5 A;  4HOC A;  1G3L A;  3QVB A;  1NKH B;  5FUH A;  2VFZ A;  5AJO A;  1NMM B;  4HO0 A;  2YC5 A;  2RIY A;  4HO5 A;  5DDT A;  5C4C A;  1LZ0 A;  2I5K A;  2D7I A;  4L41 C;  4CVH A;  4EEA A;  3T7N A;  5C48 A;  4EE3 A;  2V0L A;  2GGO A;  5FYE A;  5CQM X;  2VD4 A;  3I0F A;  4G3Q A;  2X5S A;  5CQN X;  3CKJ A;  5C4F A;  2VS3 A;  2PA4 A;  1INI A;  4EE5 A;  1VGU A;  2VSI A;  3HL3 A;  3IOJ A;  1QG8 A;  2XMH A;  2AM4 A;  5C38 A;  1FRW A;  1S4N A;  3SPT A;  2RJ8 A;  4DDZ A;  3R3I A;  4MND A;  2Z87 A;  1QGQ A;  5C1G A;  1G9R A;  2CU2 A;  5CMH A;  1H5T A;  3T7M A;  2OI6 A;  4Y7U A;  4Y7F A;  4B42 A;  2AEC A;  1GX0 A;  1ZJO A;  4FCE A;  4EVW A;  3I0C A;  1S4P A;  2JCO A;  1MC3 A;  3SX7 A;  3SX8 A;  1H3M A;  1V84 A;  3D5N A;  4B4B A;  2O1H A;  1ZCU A;  4ASJ A;  4FQW A;  2APC A;  2QH5 A;  3V91 A;  4HO8 A;  2Y4J A;  1YP2 A;  3CKV A;  4M4K A;  3KIA A;  3PNN A;  4O6M A;  1E5K A;  1FGX A;  1XZ6 A;  5JQQ A;  2C0N A;  1GQC A;  2V0K A;  5L6S A;  2X65 A;  4Y9X A;  1FG5 N;  2VK9 A;  5AJP A;  1H5S C;  2PGY A;  2BO4 A;  2RJ0 A;  1OQM B;  1ZDG A;  4D11 A;  1FO9 A;  2I5E A;  3BRK X;  1H5S A;  4KC4 A;  3USQ A;  5C1H A;  4EEM A;  1ZCV A;  1IIN A;  1SS9 A;  3V0P A;  3PKQ A;  3RMW A;  4B4G A;  4CJ8 A;  3U0X A;  4ASY A;  4Y7T A;  2VSH A;  2XWM A;  1H7L A;  4KQL A;  4R7P A;  1ZCY A;  2V0J A;  2WAW A;  4FIY A;  1LL2 A;  1R80 A;  4HO4 A;  1ZI4 A;  3TQD A;  5AJN A;  2RIZ A;  1W55 A;  2NXV A;  2DPW A;  1H4E A;  1H5R A;  5CMI A;  2FY7 A;  4JIS A;  4Y62 A;  1W57 A;  1ZJ2 A;  2WEE A;  4HO6 A;  3U2U A;  2AM5 A;  3OAM A;  1FO8 A;  1WT0 A;  1NQI B;  2XWL A;  1H7H A;  1VGW A;  3N9W A;  5FTV A;  3SXC A;  1R7V A;  1XHB A;  4NAL A;  1NHE B;  4C2S A;  1FZW A;  2E8B A;  4O6N A;  2XWN A;  1VM8 A;  1S4O A;  1TW5 A;  3ST8 A;  5HS2 A;  2FFV A;  1FOA A;  1PZT A;  5EIY A;  1ZIZ A;  3ZGF A;  4P00 A;  2OI7 A;  3F1C A;  4IRP A;  5FU0 A;  2AH9 A;  3K8E A;  1WVC A;  3CKN A;  1MP5 A;  1FWY A;  1H4D A;  2OEG A;  4EEG A;  1FR8 A;  5IFY A;  3DUV A;  1WT1 A;  2PX7 A;  4BMA A;  4G3S A;  2W0W A;  4FRM A;  1JYK A;  3V8Y A;  4NAN A;  1JV1 A;  4IRQ A;  4B5B A;  3LW6 A;  2ICY A;  3OH3 A;  4UEG A;  1VH3 A;  4FRE A;  2Z86 A;  2O1F A;  1ZCT A;  1LZJ A;  4G87 A;  3SX3 A;  4KNX A;  2YQJ A;  2YQS A;  1O23 B;  4M28 A;  4KPX A;  5CMF X;  1EYR A;  4K6R A;  4D48 A;  1R7Y A;  3O3P A;  2QKX A;  1WT3 A;  3TZT A;  1ZI5 A;  2J0A A;  4P02 A;  1YP3 A;  2UX8 A;  1K4V A;  3OH2 A;  3RMV A;  1ZI3 A;  4JD0 A;  3Q7U A;  3ZLK A;  1OMZ A;  2GGQ A;  2FYB A;  2JCJ A;  4B2W A;  2W0V A;  4CJC A;  1QGS A;  2Y7A A;  1VIC A;  2ZU7 A;  2X60 A;  2WE9 A;  1LZI A;  1VZX A;  2FFU A;  2V0H A;  2RJ1 A;  5CQL X;  5D92 A;  1ZJP A;  2VS4 A;  4B3U A;  2XME A;  3SXG A;  3ZGG A;  2A8W A;  2WVK A;  3ZF8 A;  3POL A;  4AYL A;  4MIX A;  5FTS A;  5C3B A;  4XWI A;  1G2V A;  2AM3 A;  5FV9 A;  2D7R A;  2RJ9 A;  4D11 C;  1R7T A;  4ARW A;  3IOH A;  1TW1 A;  2Y4K A;  1O7O A;  2RIT A;  1VZU A;  1R7X A;  5CQO A;  1LL3 A;  2BO7 A;  1FR9 A;  2O1G A;  2WVM A;  4FRA A;  5I1F A;  1ZDF A;  4D0T A;  2YC3 A;  1QWJ A;  4YS8 A;  2VS5 A;  5J49 A;  3I0J A;  4KC1 A;  3E25 A;  1H4C A;  2ZU9 A;  3IOI A;  4Y6N A;  2I7B A;  4FRP A;  3I0I X;  3I0G A;  5C47 A;  5IDT A;  3FWW A;  4EEO A;  3V0L A;  2AES A;  1H7T A;  1WT2 A;  2ICX A;  1H7F A;  4J18 A;  5L6V A;  1H7G A;  3U2X A;  2FYD B; 
#chains in the Genus database with same CATH homology
 1LL0 A;  2PGV A;  5EJ1 A;  1WSZ A;  3D8V A;  4MYB A;  1OMX A;  5FU8 A;  1G97 A;  4ZDQ A;  4LW6 A;  5C1L A;  4AC3 A;  3NGW A;  5CQP A;  5EJZ A;  4HO2 A;  4KRV A;  2Y4L A;  5CMG X;  3GUE A;  5C3A A;  2J0B A;  2V0I A;  3U0Y A;  1NWG B;  1G0R A;  4FRH A;  4KPZ A;  3CGX A;  4BQH A;  1HM9 A;  1VZT A;  1MP3 A;  2WGZ A;  4NAK A;  3I0K A;  3OGZ A;  1G95 A;  3OC9 A;  1MP4 A;  2RJ4 A;  1G23 A;  1V82 A;  3CKO A;  4CJB A;  1GWW A;  1FXJ A;  3OH1 A;  3V0N A;  1TZF A;  1ON8 A;  1R81 A;  1I52 A;  1JV3 A;  4B2X A;  2A8U A;  4DEC A;  1FXO A;  1Z90 A;  1H5T B;  3SXD A;  2OEF A;  1ZI1 A;  4HO3 A;  5C49 A;  5C4D A;  5DDV A;  3T7O A;  3V90 A;  5BXC A;  4HO9 A;  4FIX A;  1JYL A;  5CMJ A;  1HV9 A;  2P73 A;  2E3D A;  1INJ A;  1O7Q A;  5IDS A;  1NF5 B;  4KT7 A;  1H5S D;  3I0L A;  4M2A A;  1G93 A;  1PZY B;  2P72 A;  3R2W A;  3OH0 A;  2BO6 A;  2P6W A;  5C8R A;  4M2B A;  3V0M A;  4FRO A;  1H7E A;  4D0Z A;  3D98 A;  2YCM A;  3JTJ A;  1R82 A;  1GX4 A;  5C3D A;  1YP4 A;  1H5S B;  4FRQ A;  4Y7V A;  1TVY A;  2YQH A;  3BCV A;  3V8Z A;  1ON6 A;  2WVL A;  4NAI A;  4GBP A;  5C4B A;  4FRL A;  2JCK A;  5C36 A;  3DJ4 A;  1O0R A;  1JVG A;  3U2V A;  1V83 A;  3SXA A;  2Q4J A;  2AE7 A;  2RJ7 A;  4HG6 A;  1EZI A;  1IIM A;  3CKQ A;  1VGZ A;  3I0H A;  2Y6P A;  3Q4S A;  3E26 A;  1GA8 A;  3U2T A;  1G8O A;  3DK5 A;  3K8D A;  1HM0 A;  4HCQ A;  1G1L A;  4KC2 A;  3PKP A;  5C4E A;  1KWS A;  3F1Y A;  1H5R B;  4G3P A;  1HM8 A;  3U2W A;  2BO8 A;  4DE7 A;  1JVD A;  2ZU8 A;  2VXM A;  4KNR A;  3SX5 A;  4Y64 A;  4E1K A;  3OKR A;  2QGI A;  2Y4M A;  3RSB A;  3V0O A;  1HJJ A;  1VPA A;  1R7U A;  2VXL A;  2FYA A;  5D91 A;  4FRB A;  3V0Q A;  2YQC A;  4Y6U A;  1ZJ0 A;  1H7Q A;  3Q80 A;  3ZLL A;  3SXB A;  3JUK A;  4Y63 A;  4FRD A;  1HJL A;  2D0J A;  2FYC B;  4Y7G A;  3USR A;  2OI5 A;  2MZB A;  2RIX A;  4Q7C A;  2AGD A;  4AYJ A;  3OH4 A;  1ZJ1 A;  1YRO B;  2RJ5 A;  2X5Z A;  4ECM A;  1VH1 A;  4KXO A;  1GWV A;  1LVW A;  1LZ7 A;  1VGT A;  4AAW A;  1W77 A;  1ZHJ A;  1ZJ3 A;  3CU0 A;  4B4M A;  1GQ9 A;  2RJ6 A;  4EE4 A;  3SXE A;  1FGG A;  3I0E A;  3JUJ A;  3I0D A;  4FCU A;  2YES A;  3FOQ A;  2JCL A;  4LW3 A;  3EE5 A;  4HOC A;  1G3L A;  3QVB A;  1NKH B;  5FUH A;  2VFZ A;  5AJO A;  1NMM B;  4HO0 A;  2YC5 A;  2RIY A;  4HO5 A;  5DDT A;  5C4C A;  1LZ0 A;  2I5K A;  2D7I A;  4L41 C;  4CVH A;  4EEA A;  3T7N A;  5C48 A;  4EE3 A;  2V0L A;  2GGO A;  5FYE A;  5CQM X;  2VD4 A;  3I0F A;  4G3Q A;  2X5S A;  5CQN X;  3CKJ A;  5C4F A;  2VS3 A;  2PA4 A;  1INI A;  4EE5 A;  1VGU A;  2VSI A;  3HL3 A;  3IOJ A;  1QG8 A;  2XMH A;  2AM4 A;  5C38 A;  1FRW A;  1S4N A;  3SPT A;  2RJ8 A;  4DDZ A;  3R3I A;  4MND A;  2Z87 A;  1QGQ A;  5C1G A;  1G9R A;  2CU2 A;  5CMH A;  1H5T A;  3T7M A;  2OI6 A;  4Y7U A;  4Y7F A;  4B42 A;  2AEC A;  1GX0 A;  1ZJO A;  4FCE A;  4EVW A;  3I0C A;  1S4P A;  2JCO A;  1MC3 A;  3SX7 A;  3SX8 A;  1H3M A;  1V84 A;  3D5N A;  4B4B A;  2O1H A;  1ZCU A;  4ASJ A;  4FQW A;  2APC A;  2QH5 A;  3V91 A;  4HO8 A;  2Y4J A;  1YP2 A;  3CKV A;  4M4K A;  3KIA A;  3PNN A;  4O6M A;  1E5K A;  1FGX A;  1XZ6 A;  5JQQ A;  2C0N A;  1GQC A;  2V0K A;  5L6S A;  2X65 A;  4Y9X A;  1FG5 N;  2VK9 A;  5AJP A;  1H5S C;  2PGY A;  2BO4 A;  2RJ0 A;  1OQM B;  1ZDG A;  4D11 A;  1FO9 A;  2I5E A;  3BRK X;  1H5S A;  4KC4 A;  3USQ A;  5C1H A;  4EEM A;  1ZCV A;  1IIN A;  1SS9 A;  3V0P A;  3PKQ A;  3RMW A;  4B4G A;  4CJ8 A;  3U0X A;  4ASY A;  4Y7T A;  2VSH A;  2XWM A;  1H7L A;  4KQL A;  4R7P A;  1ZCY A;  2V0J A;  2WAW A;  4FIY A;  1LL2 A;  1R80 A;  4HO4 A;  1ZI4 A;  3TQD A;  5AJN A;  2RIZ A;  1W55 A;  2NXV A;  2DPW A;  1H4E A;  1H5R A;  5CMI A;  2FY7 A;  4JIS A;  4Y62 A;  1W57 A;  1ZJ2 A;  2WEE A;  4HO6 A;  3U2U A;  2AM5 A;  3OAM A;  1FO8 A;  1WT0 A;  1NQI B;  2XWL A;  1H7H A;  1VGW A;  3N9W A;  5FTV A;  3SXC A;  1R7V A;  1XHB A;  4NAL A;  1NHE B;  4C2S A;  1FZW A;  2E8B A;  4O6N A;  2XWN A;  1VM8 A;  1S4O A;  1TW5 A;  3ST8 A;  5HS2 A;  2FFV A;  1FOA A;  1PZT A;  5EIY A;  1ZIZ A;  3ZGF A;  4P00 A;  2OI7 A;  3F1C A;  4IRP A;  5FU0 A;  2AH9 A;  3K8E A;  1WVC A;  3CKN A;  1MP5 A;  1FWY A;  1H4D A;  2OEG A;  4EEG A;  1FR8 A;  5IFY A;  3DUV A;  1WT1 A;  2PX7 A;  4BMA A;  4G3S A;  2W0W A;  4FRM A;  1JYK A;  3V8Y A;  4NAN A;  1JV1 A;  4IRQ A;  4B5B A;  3LW6 A;  2ICY A;  3OH3 A;  4UEG A;  1VH3 A;  4FRE A;  2Z86 A;  2O1F A;  1ZCT A;  1LZJ A;  4G87 A;  3SX3 A;  4KNX A;  2YQJ A;  2YQS A;  1O23 B;  4M28 A;  4KPX A;  5CMF X;  1EYR A;  4K6R A;  4D48 A;  1R7Y A;  3O3P A;  2QKX A;  1WT3 A;  3TZT A;  1ZI5 A;  2J0A A;  4P02 A;  1YP3 A;  2UX8 A;  1K4V A;  3OH2 A;  3RMV A;  1ZI3 A;  4JD0 A;  3Q7U A;  3ZLK A;  1OMZ A;  2GGQ A;  2FYB A;  2JCJ A;  4B2W A;  2W0V A;  4CJC A;  1QGS A;  2Y7A A;  1VIC A;  2ZU7 A;  2X60 A;  2WE9 A;  1LZI A;  1VZX A;  2FFU A;  2V0H A;  2RJ1 A;  5CQL X;  5D92 A;  1ZJP A;  2VS4 A;  4B3U A;  2XME A;  3SXG A;  3ZGG A;  2A8W A;  2WVK A;  3ZF8 A;  3POL A;  4AYL A;  4MIX A;  5FTS A;  5C3B A;  4XWI A;  1G2V A;  2AM3 A;  5FV9 A;  2D7R A;  2RJ9 A;  4D11 C;  1R7T A;  4ARW A;  3IOH A;  1TW1 A;  2Y4K A;  1O7O A;  2RIT A;  1VZU A;  1R7X A;  5CQO A;  1LL3 A;  2BO7 A;  1FR9 A;  2O1G A;  2WVM A;  4FRA A;  5I1F A;  1ZDF A;  4D0T A;  2YC3 A;  1QWJ A;  4YS8 A;  2VS5 A;  5J49 A;  3I0J A;  4KC1 A;  3E25 A;  1H4C A;  2ZU9 A;  3IOI A;  4Y6N A;  2I7B A;  4FRP A;  3I0I X;  3I0G A;  5C47 A;  5IDT A;  3FWW A;  4EEO A;  3V0L A;  2AES A;  1H7T A;  1WT2 A;  2ICX A;  1H7F A;  4J18 A;  5L6V A;  1H7G A;  3U2X A;  2FYD B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...