2O1FA

Natural occuring mutation of human abo(h) galactosyltransferase: gtb/m214r
Total Genus 81
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
81
sequence length
284
structure length
264
Chain Sequence
FMVSLPRMVYPQPKVLTPCRKDVLVVTPWLAPIVWEGTFNIDILNEQFRLQNTTIGLTVFAIKKYVAFLKLFLETAEKHFMVGHRVHYYVFTDQPAAVPRVTLGTGRQLSVLEVCERRFLSEVDYLVCVDVDREFRDHVGVEILTPLFGTLHPSFYGSSREAFTYERRPQSQAYIPKDEGDFYYMGAFFGGSVQEVQRLTRACHQAMMVDQANGIEAVWHDESHLNKYLLRHKPTKVLSPEYLWDQQLLGWPAVLRKLRFTAVP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ABO glycosyltransferase
publication title Structural effects of naturally occurring human blood group B galactosyltransferase mutations adjacent to the DXD motif.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 81
structure length 264
sequence length 284
ec nomenclature ec 2.4.1.37: Fucosylgalactoside 3-alpha-galactosyltransferase.
pdb deposition date 2006-11-28
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.550.10 Alpha Beta Alpha-Beta Complex Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A 2o1fA00
2YC5A 2X5SA 3T7NA 1FO8A 1H7EA 1FO9A 2JCKA 1GQ9A 2AM5A 4MNDA 1WT1A 3FWWA 4K6RA 1ZCTA 3T7MA 1VZUA 4L41C 2D7IA 5C1GA 2QH5A 1H7LA 2I7BA 4B2WA 2PGVA 1O7QA 2Y7AA 1WVCA 3SX8A 1SS9A 1FGXA 5C3AA 3U0YA 4C2SA 2FFUA 1S4PA 2ICXA 3U2TA 4ASJA 3U2XA 4G87A 1TVYA 3V8ZA 3F1CA 1VZXA 2AH9A 2RIYA 2WVLA 5C4FA 3CKOA 1HM9A 3CKNA 4FQWA 4P02A 1VGZA 4IRPA 3CKJA 3FOQA 4JISA 3SXDA 2GGQA 2RJ9A 3OC9A 1ZDGA 3D5NA 1S4NA 5AJOA 1OQMB 4Y7VA 4KRVA 3OH2A 4B5BA 1VICA 1R81A 4G3QA 1V82A 1JVGA 3IOIA 1PZTA 2OEFA 2PGYA 4B3UA 5FV9A 3DUVA 4HCQA 4CJ8A 1ZDFA 3U2VA 2Q4JA 3RMVA 2V0KA 2ICYA 5CMFX 1JYLA 3N9WA 2WGZA 3JUJA 4DECA 4E1KA 2P6WA 1G93A 1VH3A 3V0MA 1H4EA 1INJA 3PNNA 1V84A 4HO5A 5DDTA 4KC4A 1G9RA 1HJJA 4KQLA 1EYRA 1GQCA 1ZI5A 1TW5A 1WT0A 2VS3A 1H5RB 5CMIA 3OH0A 1G97A 1H5SB 1JV3A 4FROA 1R7UA 3V0PA 2XWNA 5C36A 1MP4A 2RJ5A 3V0LA 2PA4A 1GX0A 3LW6A 5BXCA 3K8EA 1R7TA 3RMWA 2ZU9A 4KC2A 3OAMA 1YP3A 5CQPA 1ZHJA 2FFVA 2GGOA 2XMEA 3E25A 3BRKX 1H5TB 2X60A 3D8VA 4Y6UA 1QG8A 4DE7A 1ZCVA 4KNXA 1H7QA 5JQQA 2P73A 3SXEA 1W77A 3V8YA 2YQJA 1W55A 1K4VA 4Y6NA 2A8UA 3Q4SA 1WT3A 2BO7A 3OKRA 3OGZA 4FRHA 4Y7UA 5C49A 2RJ1A 1G95A 2X5ZA 2I5EA 1TZFA 1O0RA 5C4CA 4KPXA 4B42A 1ZJOA 4NANA 4HO2A 4EE3A 4FCEA 3SXAA 3R3IA 1ZCUA 3POLA 3OH4A 4FRQA 4EEMA 4AAWA 3CKVA 2NXVA 3OH1A 1I52A 2O1GA 4ZDQA 5FTVA 1OMXA 2RIXA 3SPTA 3V0QA 1LL2A 1FXOA 1H5SD 1HV9A 4HOCA 4ECMA 4B2XA 5HS2A 4FRPA 2YCMA 2AECA 3IOHA 5CQOA 5EJ1A 5L6SA 1JVDA 4Y63A 1FZWA 2JCOA 2V0IA 5I1FA 3SXCA 1YROB 4M2AA 4FCUA 4Y64A 3PKPA 1ZI3A 1LZ0A 2WE9A 2XWMA 2PX7A 3V0OA 4HO3A 3I0GA 1HM0A 5DDVA 4HO9A 2AM4A 2APCA 2UX8A 1JV1A 1LL0A 1MP5A 2AGDA 2QGIA 2JCLA 4G3PA 1WT2A 1ZJPA 4KT7A 4Y9XA 4HG6A 4AYJA 2QKXA 1G3LA 5EIYA 1FR9A 3JTJA 1FGGA 1R7XA 1FRWA 3CKQA 3I0KA 3T7OA 1TW1A 1XZ6A 4KPZA 2V0LA 3V90A 4B4BA 5C3BA 5CMHA 2BO6A 1R7YA 4CJCA 1FR8A 1NQIB 2Y4JA 3K8DA 4HO4A 1NMMB 2WVKA 2O1HA 2W0VA 1E5KA 1R80A 5IFYA 1HM8A 1H3MA 4LW6A 2Y6PA 5C48A 2FYCB 5FU0A 4EEOA 4CVHA 2WEEA 1ON8A 3D98A 4KC1A 2ZU7A 4B4GA 2WAWA 2V0JA 1ZI4A 4D0ZA 3RSBA 3ZGGA 1O23B 1LZJA 4UEGA 5C38A 5FTSA 3DK5A 4GBPA 4FRBA 3ST8A 3E26A 4JD0A 4EVWA 2JCJA 3ZGFA 3Q80A 1ZJ3A 1OMZA 5AJNA 4NALA 4MYBA 3USRA 2XMHA 3BCVA 2ZU8A 1MC3A 4AC3A 4FRMA 3SX3A 4FREA 5FUHA 4EE5A 2D0JA 4HO8A 1QGSA 2OI7A 1NKHB 1WSZA 4G3SA 2VFZA 3JUKA 1NF5B 2W0WA 5C4BA 1HJLA 5CMJA 2AM3A 4J18A 4Y62A 2P72A 2A8WA 1ZI1A 1ON6A 2I5KA 1FXJA 4R7PA 4D0TA 1KWSA 1G1LA 2CU2A 2FYBA 1LVWA 1PZYB 1IINA 1GA8A 4M4KA 3I0HA 2O1FA 1ZCYA 2E3DA 2Y4MA 4Y7FA 3I0EA 3SXGA 4D11A 5IDTA 1QWJA 3Q7UA 2RIZA 1H7FA 3I0CA 1JYKA 3TQDA 4B4MA 3I0DA 1GWWA 3HL3A 4M2BA 1ZJ2A 1VM8A 2Y4LA 3U2WA 1VGTA 2DPWA 2OI6A 2X65A 3SX5A 1VH1A 1VGWA 1ZJ1A 4NAIA 2RJ7A 4BMAA 4FRAA 5C1HA 1VGUA 4AYLA 3I0JA 4EEGA 1H4DA 1H5RA 1NHEB 1H4CA 2RJ0A 2RJ4A 1VPAA 4KNRA 4EEAA 1H5SA 1Z90A 4EE4A 4DDZA 2AE7A 2VXMA 1R7VA 2VD4A 2XWLA 2MZBA 5C3DA 2Y4KA 5C47A 2YQHA 1QGQA 2Z87A 2RJ6A 5CQMX 1FOAA 3V0NA 1XHBA 3CGXA 2FYAA 3I0LA 3ZF8A 1H5TA 3SX7A 2FYDB 4D48A 4XWIA 5CQLX 4ASYA 1YP2A 4NAKA 4LW3A 3TZTA 1FWYA 4FRDA 3GUEA 3ZLKA 3U2UA 4YS8A 2RITA 1G23A 2WVMA 3U0XA 2AESA 1O7OA 1H7TA 1FG5N 2VS5A 4ARWA 1LZIA 4BQHA 3R2WA 3PKQA 1G0RA 1V83A 2D7RA 3DJ4A 3I0IX 5J49A 2YQSA 3OH3A 3NGWA 5IDSA 3EE5A 2VSHA 4CJBA 4KXOA 5C4EA 3F1YA 3KIAA 1GX4A 3QVBA 1NWGB 4D11C 5C4DA 2FY7A 4FRLA 3I0FA 3CU0A 1INIA 3O3PA 1GWVA 1ZJ0A 2E8BA 4Y7GA 1LZ7A 1G2VA 1R82A 5AJPA 4IRQA 2BO8A 2VSIA 1H7GA 5CQNX 4HO6A 5C1LA 1H7HA 3SXBA 2YQCA 3ZLLA 4M28A 2RJ8A 5C8RA 1LL3A 3IOJA 1MP3A 4P00A 5FU8A 2VS4A 5CMGX 2V0HA 5L6VA 1YP4A 4Y7TA 2BO4A 1W57A 2Z86A 1VZTA 2OEGA 1G8OA 3USQA 1EZIA 5FYEA 1IIMA 5EJZA 2YC3A 2YESA 1H5SC 2VXLA 1S4OA 3V91A 4HO0A 1ZIZA 2OI5A
chains in the Genus database with same CATH superfamily
2YC5A 2X5SA 3T7NA 1FO8A 1H7EA 1FO9A 2JCKA 1GQ9A 2AM5A 4MNDA 1WT1A 3FWWA 4K6RA 1ZCTA 3T7MA 1VZUA 4L41C 2D7IA 5C1GA 2QH5A 1H7LA 2I7BA 4B2WA 2PGVA 1O7QA 2Y7AA 1WVCA 3SX8A 1SS9A 1FGXA 5C3AA 3U0YA 4C2SA 2FFUA 1S4PA 2ICXA 3U2TA 4ASJA 3U2XA 4G87A 1TVYA 3V8ZA 3F1CA 1VZXA 2AH9A 2RIYA 2WVLA 2C0NA 5C4FA 3CKOA 1HM9A 3CKNA 4FQWA 4P02A 1VGZA 4IRPA 3CKJA 3FOQA 4JISA 3SXDA 2GGQA 2RJ9A 3OC9A 1ZDGA 3D5NA 1S4NA 5AJOA 1OQMB 4Y7VA 4KRVA 3OH2A 4B5BA 1VICA 1R81A 4G3QA 1V82A 1JVGA 3IOIA 1PZTA 2OEFA 2PGYA 4B3UA 2VK9A 5FV9A 3DUVA 4HCQA 4CJ8A 1ZDFA 3U2VA 2Q4JA 3RMVA 2V0KA 2ICYA 2J0BA 5CMFX 1JYLA 3N9WA 4O6NA 2WGZA 3JUJA 4DECA 4E1KA 2P6WA 1G93A 1VH3A 3V0MA 1H4EA 1INJA 3PNNA 1V84A 4HO5A 5DDTA 4KC4A 1G9RA 1HJJA 4KQLA 1EYRA 1GQCA 1ZI5A 1TW5A 1WT0A 2VS3A 1H5RB 5CMIA 3OH0A 1G97A 1H5SB 1JV3A 4FROA 1R7UA 3V0PA 2XWNA 5C36A 1MP4A 2RJ5A 3V0LA 2PA4A 1GX0A 3LW6A 5BXCA 3K8EA 1R7TA 3RMWA 2ZU9A 4KC2A 3OAMA 1YP3A 5CQPA 1ZHJA 2FFVA 2GGOA 2XMEA 3E25A 3BRKX 1H5TB 2X60A 3D8VA 4Y6UA 1QG8A 4DE7A 1ZCVA 4KNXA 1H7QA 5JQQA 2P73A 3SXEA 1W77A 3V8YA 2YQJA 1W55A 1K4VA 4Y6NA 2A8UA 3Q4SA 1WT3A 2BO7A 3OKRA 3OGZA 4FRHA 4Y7UA 5C49A 2RJ1A 1G95A 2X5ZA 2I5EA 1TZFA 1O0RA 5C4CA 4KPXA 4B42A 1ZJOA 4NANA 4HO2A 4EE3A 4FCEA 3SXAA 3R3IA 1ZCUA 3POLA 3OH4A 4FRQA 4EEMA 4AAWA 3CKVA 2NXVA 3OH1A 1I52A 2O1GA 4ZDQA 5FTVA 1OMXA 2RIXA 3SPTA 3V0QA 1LL2A 1FXOA 1H5SD 1HV9A 4HOCA 4ECMA 4B2XA 5HS2A 4FRPA 2YCMA 2AECA 3IOHA 5CQOA 5EJ1A 5L6SA 1JVDA 4Y63A 1FZWA 2JCOA 2V0IA 5I1FA 3SXCA 1YROB 4M2AA 4FCUA 4Y64A 3PKPA 1ZI3A 1LZ0A 2WE9A 2XWMA 2PX7A 3V0OA 4HO3A 3I0GA 1HM0A 5DDVA 4HO9A 2AM4A 2APCA 2UX8A 1JV1A 1LL0A 1MP5A 2AGDA 2QGIA 2JCLA 4G3PA 1WT2A 1ZJPA 4KT7A 4Y9XA 4HG6A 4AYJA 2QKXA 1G3LA 5EIYA 1FR9A 3JTJA 1FGGA 1R7XA 1FRWA 3CKQA 3I0KA 3T7OA 1TW1A 1XZ6A 4KPZA 2V0LA 3V90A 4B4BA 5C3BA 5CMHA 2BO6A 1R7YA 4CJCA 1FR8A 1NQIB 2Y4JA 3K8DA 4HO4A 1NMMB 2WVKA 2O1HA 2W0VA 1E5KA 1R80A 5IFYA 1HM8A 1H3MA 4LW6A 2Y6PA 5C48A 2FYCB 5FU0A 4MIXA 4EEOA 4CVHA 2WEEA 1ON8A 4O6MA 3D98A 4KC1A 2ZU7A 4B4GA 2WAWA 2V0JA 1ZI4A 4D0ZA 3RSBA 3ZGGA 1O23B 2J0AA 1LZJA 4UEGA 5C38A 5FTSA 3DK5A 4GBPA 4FRBA 3ST8A 3E26A 4JD0A 4EVWA 2JCJA 3ZGFA 3Q80A 1ZJ3A 1OMZA 5AJNA 4NALA 4MYBA 3USRA 2XMHA 3BCVA 2ZU8A 1MC3A 4AC3A 4FRMA 3SX3A 4FREA 5FUHA 4EE5A 2D0JA 4HO8A 1QGSA 2OI7A 1NKHB 1WSZA 4G3SA 2VFZA 3JUKA 1NF5B 2W0WA 5C4BA 1HJLA 5CMJA 2AM3A 4J18A 4Y62A 2P72A 2A8WA 1ZI1A 1ON6A 2I5KA 1FXJA 4R7PA 4D0TA 1KWSA 1G1LA 2CU2A 2FYBA 1LVWA 1PZYB 1IINA 1GA8A 4M4KA 3I0HA 2O1FA 1ZCYA 2E3DA 2Y4MA 4Y7FA 3I0EA 3SXGA 4D11A 5IDTA 1QWJA 3Q7UA 2RIZA 1H7FA 3I0CA 1JYKA 3TQDA 4B4MA 3I0DA 1GWWA 3HL3A 4M2BA 1ZJ2A 1VM8A 2Y4LA 3U2WA 1VGTA 2DPWA 2OI6A 2X65A 3SX5A 1VH1A 1VGWA 1ZJ1A 4NAIA 2RJ7A 4BMAA 4FRAA 4FIYA 5C1HA 1VGUA 4AYLA 3I0JA 4EEGA 1H4DA 1H5RA 1NHEB 1H4CA 2RJ0A 2RJ4A 1VPAA 4KNRA 4EEAA 1H5SA 1Z90A 4EE4A 4DDZA 2AE7A 2VXMA 1R7VA 2VD4A 2XWLA 2MZBA 5C3DA 2Y4KA 5C47A 2YQHA 1QGQA 2Z87A 2RJ6A 5CQMX 1FOAA 3V0NA 1XHBA 3CGXA 2FYAA 3I0LA 3ZF8A 1H5TA 3SX7A 2FYDB 4D48A 4XWIA 5CQLX 4ASYA 1YP2A 4NAKA 4LW3A 3TZTA 1FWYA 4FRDA 3GUEA 3ZLKA 3U2UA 4YS8A 2RITA 1G23A 2WVMA 3U0XA 2AESA 4FIXA 1O7OA 1H7TA 1FG5N 2VS5A 5D92A 4ARWA 1LZIA 4BQHA 3R2WA 3PKQA 1G0RA 1V83A 2D7RA 3DJ4A 3I0IX 5J49A 2YQSA 3OH3A 3NGWA 5IDSA 3EE5A 2VSHA 4CJBA 4KXOA 5C4EA 3F1YA 3KIAA 1GX4A 3QVBA 1NWGB 4D11C 5C4DA 2FY7A 4FRLA 3I0FA 3CU0A 1INIA 3O3PA 1GWVA 1ZJ0A 2E8BA 4Y7GA 1LZ7A 1G2VA 1R82A 5AJPA 4IRQA 2BO8A 2VSIA 1H7GA 5CQNX 4HO6A 5C1LA 1H7HA 3SXBA 2YQCA 3ZLLA 4M28A 2RJ8A 5C8RA 1LL3A 3IOJA 1MP3A 4P00A 5FU8A 2VS4A 5CMGX 5D91A 2V0HA 5L6VA 1YP4A 4Y7TA 2BO4A 1W57A 2Z86A 1VZTA 2OEGA 1G8OA 3USQA 1EZIA 5FYEA 1IIMA 5EJZA 2YC3A 2YESA 1H5SC 2VXLA 1S4OA 4Q7CA 3V91A 4HO0A 1ZIZA 2OI5A
chains in the Genus database with same CATH topology
2YC5A 2X5SA 3T7NA 1FO8A 1H7EA 1FO9A 2JCKA 1GQ9A 2AM5A 4MNDA 1WT1A 3FWWA 4K6RA 1ZCTA 3T7MA 1VZUA 4L41C 2D7IA 5C1GA 2QH5A 1H7LA 2I7BA 4B2WA 2PGVA 1O7QA 2Y7AA 1WVCA 3SX8A 1SS9A 1FGXA 5C3AA 3U0YA 4C2SA 2FFUA 1S4PA 2ICXA 3U2TA 4ASJA 3U2XA 4G87A 1TVYA 3V8ZA 3F1CA 1VZXA 2AH9A 2RIYA 2WVLA 2C0NA 5C4FA 3CKOA 1HM9A 3CKNA 4FQWA 4P02A 1VGZA 4IRPA 3CKJA 3FOQA 4JISA 3SXDA 2GGQA 2RJ9A 3OC9A 1ZDGA 3D5NA 1S4NA 5AJOA 1OQMB 4Y7VA 4KRVA 3OH2A 4B5BA 1VICA 1R81A 4G3QA 1V82A 1JVGA 3IOIA 1PZTA 2OEFA 2PGYA 4B3UA 2VK9A 5FV9A 3DUVA 4HCQA 4CJ8A 1ZDFA 3U2VA 2Q4JA 3RMVA 2V0KA 2ICYA 2J0BA 5CMFX 1JYLA 3N9WA 4O6NA 2WGZA 3JUJA 4DECA 4E1KA 2P6WA 1G93A 1VH3A 3V0MA 1H4EA 1INJA 3PNNA 1V84A 4HO5A 5DDTA 4KC4A 1G9RA 1HJJA 4KQLA 1EYRA 1GQCA 1ZI5A 1TW5A 1WT0A 2VS3A 1H5RB 5CMIA 3OH0A 1G97A 1H5SB 1JV3A 4FROA 1R7UA 3V0PA 2XWNA 5C36A 1MP4A 2RJ5A 3V0LA 2PA4A 1GX0A 3LW6A 5BXCA 3K8EA 1R7TA 3RMWA 2ZU9A 4KC2A 3OAMA 1YP3A 5CQPA 1ZHJA 2FFVA 2GGOA 2XMEA 3E25A 3BRKX 1H5TB 2X60A 3D8VA 4Y6UA 1QG8A 4DE7A 1ZCVA 4KNXA 1H7QA 5JQQA 2P73A 3SXEA 1W77A 3V8YA 2YQJA 1W55A 1K4VA 4Y6NA 2A8UA 3Q4SA 1WT3A 2BO7A 3OKRA 3OGZA 4FRHA 4Y7UA 5C49A 2RJ1A 1G95A 2X5ZA 2I5EA 1TZFA 1O0RA 5C4CA 4KPXA 4B42A 1ZJOA 4NANA 4HO2A 4EE3A 4FCEA 3SXAA 3R3IA 1ZCUA 3POLA 3OH4A 4FRQA 4EEMA 4AAWA 3CKVA 2NXVA 3OH1A 1I52A 2O1GA 4ZDQA 5FTVA 1OMXA 2RIXA 3SPTA 3V0QA 1LL2A 1FXOA 1H5SD 1HV9A 4HOCA 4ECMA 4B2XA 5HS2A 4FRPA 2YCMA 2AECA 3IOHA 5CQOA 5EJ1A 5L6SA 1JVDA 4Y63A 1FZWA 2JCOA 2V0IA 5I1FA 3SXCA 1YROB 4M2AA 4FCUA 4Y64A 3PKPA 1ZI3A 1LZ0A 2WE9A 2XWMA 2PX7A 3V0OA 4HO3A 3I0GA 1HM0A 5DDVA 4HO9A 2AM4A 2APCA 2UX8A 1JV1A 1LL0A 1MP5A 2AGDA 2QGIA 2JCLA 4G3PA 1WT2A 1ZJPA 4KT7A 4Y9XA 4HG6A 4AYJA 2QKXA 1G3LA 5EIYA 1FR9A 3JTJA 1FGGA 1R7XA 1FRWA 3CKQA 3I0KA 3T7OA 1TW1A 1XZ6A 4KPZA 2V0LA 3V90A 4B4BA 5C3BA 5CMHA 2BO6A 1R7YA 4CJCA 1FR8A 1NQIB 2Y4JA 3K8DA 4HO4A 1NMMB 2WVKA 2O1HA 2W0VA 1E5KA 1R80A 5IFYA 1HM8A 1H3MA 4LW6A 2Y6PA 5C48A 2FYCB 5FU0A 4MIXA 4EEOA 4CVHA 2WEEA 1ON8A 4O6MA 3D98A 4KC1A 2ZU7A 4B4GA 2WAWA 2V0JA 1ZI4A 4D0ZA 3RSBA 3ZGGA 1O23B 2J0AA 1LZJA 4UEGA 5C38A 5FTSA 3DK5A 4GBPA 4FRBA 3ST8A 3E26A 4JD0A 4EVWA 2JCJA 3ZGFA 3Q80A 1ZJ3A 1OMZA 5AJNA 4NALA 4MYBA 3USRA 2XMHA 3BCVA 2ZU8A 1MC3A 4AC3A 4FRMA 3SX3A 4FREA 5FUHA 4EE5A 2D0JA 4HO8A 1QGSA 2OI7A 1NKHB 1WSZA 4G3SA 2VFZA 3JUKA 1NF5B 2W0WA 5C4BA 1HJLA 5CMJA 2AM3A 4J18A 4Y62A 2P72A 2A8WA 1ZI1A 1ON6A 2I5KA 1FXJA 4R7PA 4D0TA 1KWSA 1G1LA 2CU2A 2FYBA 1LVWA 1PZYB 1IINA 1GA8A 4M4KA 3I0HA 2O1FA 1ZCYA 2E3DA 2Y4MA 4Y7FA 3I0EA 3SXGA 4D11A 5IDTA 1QWJA 3Q7UA 2RIZA 1H7FA 3I0CA 1JYKA 3TQDA 4B4MA 3I0DA 1GWWA 3HL3A 4M2BA 1ZJ2A 1VM8A 2Y4LA 3U2WA 1VGTA 2DPWA 2OI6A 2X65A 3SX5A 1VH1A 1VGWA 1ZJ1A 4NAIA 2RJ7A 4BMAA 4FRAA 4FIYA 5C1HA 1VGUA 4AYLA 3I0JA 4EEGA 1H4DA 1H5RA 1NHEB 1H4CA 2RJ0A 2RJ4A 1VPAA 4KNRA 4EEAA 1H5SA 1Z90A 4EE4A 4DDZA 2AE7A 2VXMA 1R7VA 2VD4A 2XWLA 2MZBA 5C3DA 2Y4KA 5C47A 2YQHA 1QGQA 2Z87A 2RJ6A 5CQMX 1FOAA 3V0NA 1XHBA 3CGXA 2FYAA 3I0LA 3ZF8A 1H5TA 3SX7A 2FYDB 4D48A 4XWIA 5CQLX 4ASYA 1YP2A 4NAKA 4LW3A 3TZTA 1FWYA 4FRDA 3GUEA 3ZLKA 3U2UA 4YS8A 2RITA 1G23A 2WVMA 3U0XA 2AESA 4FIXA 1O7OA 1H7TA 1FG5N 2VS5A 5D92A 4ARWA 1LZIA 4BQHA 3R2WA 3PKQA 1G0RA 1V83A 2D7RA 3DJ4A 3I0IX 5J49A 2YQSA 3OH3A 3NGWA 5IDSA 3EE5A 2VSHA 4CJBA 4KXOA 5C4EA 3F1YA 3KIAA 1GX4A 3QVBA 1NWGB 4D11C 5C4DA 2FY7A 4FRLA 3I0FA 3CU0A 1INIA 3O3PA 1GWVA 1ZJ0A 2E8BA 4Y7GA 1LZ7A 1G2VA 1R82A 5AJPA 4IRQA 2BO8A 2VSIA 1H7GA 5CQNX 4HO6A 5C1LA 1H7HA 3SXBA 2YQCA 3ZLLA 4M28A 2RJ8A 5C8RA 1LL3A 3IOJA 1MP3A 4P00A 5FU8A 2VS4A 5CMGX 5D91A 2V0HA 5L6VA 1YP4A 4Y7TA 2BO4A 1W57A 2Z86A 1VZTA 2OEGA 1G8OA 3USQA 1EZIA 5FYEA 1IIMA 5EJZA 2YC3A 2YESA 1H5SC 2VXLA 1S4OA 4Q7CA 3V91A 4HO0A 1ZIZA 2OI5A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2YC5 A;  2X5S A;  3T7N A;  1FO8 A;  1H7E A;  1FO9 A;  2JCK A;  1GQ9 A;  2AM5 A;  4MND A;  1WT1 A;  3FWW A;  4K6R A;  1ZCT A;  3T7M A;  1VZU A;  4L41 C;  2D7I A;  5C1G A;  2QH5 A;  1H7L A;  2I7B A;  4B2W A;  2PGV A;  1O7Q A;  2Y7A A;  1WVC A;  3SX8 A;  1SS9 A;  1FGX A;  5C3A A;  3U0Y A;  4C2S A;  2FFU A;  1S4P A;  2ICX A;  3U2T A;  4ASJ A;  3U2X A;  4G87 A;  1TVY A;  3V8Z A;  3F1C A;  1VZX A;  2AH9 A;  2RIY A;  2WVL A;  5C4F A;  3CKO A;  1HM9 A;  3CKN A;  4FQW A;  4P02 A;  1VGZ A;  4IRP A;  3CKJ A;  3FOQ A;  4JIS A;  3SXD A;  2GGQ A;  2RJ9 A;  3OC9 A;  1ZDG A;  3D5N A;  1S4N A;  5AJO A;  1OQM B;  4Y7V A;  4KRV A;  3OH2 A;  4B5B A;  1VIC A;  1R81 A;  4G3Q A;  1V82 A;  1JVG A;  3IOI A;  1PZT A;  2OEF A;  2PGY A;  4B3U A;  5FV9 A;  3DUV A;  4HCQ A;  4CJ8 A;  1ZDF A;  3U2V A;  2Q4J A;  3RMV A;  2V0K A;  2ICY A;  5CMF X;  1JYL A;  3N9W A;  2WGZ A;  3JUJ A;  4DEC A;  4E1K A;  2P6W A;  1G93 A;  1VH3 A;  3V0M A;  1H4E A;  1INJ A;  3PNN A;  1V84 A;  4HO5 A;  5DDT A;  4KC4 A;  1G9R A;  1HJJ A;  4KQL A;  1EYR A;  1GQC A;  1ZI5 A;  1TW5 A;  1WT0 A;  2VS3 A;  1H5R B;  5CMI A;  3OH0 A;  1G97 A;  1H5S B;  1JV3 A;  4FRO A;  1R7U A;  3V0P A;  2XWN A;  5C36 A;  1MP4 A;  2RJ5 A;  3V0L A;  2PA4 A;  1GX0 A;  3LW6 A;  5BXC A;  3K8E A;  1R7T A;  3RMW A;  2ZU9 A;  4KC2 A;  3OAM A;  1YP3 A;  5CQP A;  1ZHJ A;  2FFV A;  2GGO A;  2XME A;  3E25 A;  3BRK X;  1H5T B;  2X60 A;  3D8V A;  4Y6U A;  1QG8 A;  4DE7 A;  1ZCV A;  4KNX A;  1H7Q A;  5JQQ A;  2P73 A;  3SXE A;  1W77 A;  3V8Y A;  2YQJ A;  1W55 A;  1K4V A;  4Y6N A;  2A8U A;  3Q4S A;  1WT3 A;  2BO7 A;  3OKR A;  3OGZ A;  4FRH A;  4Y7U A;  5C49 A;  2RJ1 A;  1G95 A;  2X5Z A;  2I5E A;  1TZF A;  1O0R A;  5C4C A;  4KPX A;  4B42 A;  1ZJO A;  4NAN A;  4HO2 A;  4EE3 A;  4FCE A;  3SXA A;  3R3I A;  1ZCU A;  3POL A;  3OH4 A;  4FRQ A;  4EEM A;  4AAW A;  3CKV A;  2NXV A;  3OH1 A;  1I52 A;  2O1G A;  4ZDQ A;  5FTV A;  1OMX A;  2RIX A;  3SPT A;  3V0Q A;  1LL2 A;  1FXO A;  1H5S D;  1HV9 A;  4HOC A;  4ECM A;  4B2X A;  5HS2 A;  4FRP A;  2YCM A;  2AEC A;  3IOH A;  5CQO A;  5EJ1 A;  5L6S A;  1JVD A;  4Y63 A;  1FZW A;  2JCO A;  2V0I A;  5I1F A;  3SXC A;  1YRO B;  4M2A A;  4FCU A;  4Y64 A;  3PKP A;  1ZI3 A;  1LZ0 A;  2WE9 A;  2XWM A;  2PX7 A;  3V0O A;  4HO3 A;  3I0G A;  1HM0 A;  5DDV A;  4HO9 A;  2AM4 A;  2APC A;  2UX8 A;  1JV1 A;  1LL0 A;  1MP5 A;  2AGD A;  2QGI A;  2JCL A;  4G3P A;  1WT2 A;  1ZJP A;  4KT7 A;  4Y9X A;  4HG6 A;  4AYJ A;  2QKX A;  1G3L A;  5EIY A;  1FR9 A;  3JTJ A;  1FGG A;  1R7X A;  1FRW A;  3CKQ A;  3I0K A;  3T7O A;  1TW1 A;  1XZ6 A;  4KPZ A;  2V0L A;  3V90 A;  4B4B A;  5C3B A;  5CMH A;  2BO6 A;  1R7Y A;  4CJC A;  1FR8 A;  1NQI B;  2Y4J A;  3K8D A;  4HO4 A;  1NMM B;  2WVK A;  2O1H A;  2W0V A;  1E5K A;  1R80 A;  5IFY A;  1HM8 A;  1H3M A;  4LW6 A;  2Y6P A;  5C48 A;  2FYC B;  5FU0 A;  4EEO A;  4CVH A;  2WEE A;  1ON8 A;  3D98 A;  4KC1 A;  2ZU7 A;  4B4G A;  2WAW A;  2V0J A;  1ZI4 A;  4D0Z A;  3RSB A;  3ZGG A;  1O23 B;  1LZJ A;  4UEG A;  5C38 A;  5FTS A;  3DK5 A;  4GBP A;  4FRB A;  3ST8 A;  3E26 A;  4JD0 A;  4EVW A;  2JCJ A;  3ZGF A;  3Q80 A;  1ZJ3 A;  1OMZ A;  5AJN A;  4NAL A;  4MYB A;  3USR A;  2XMH A;  3BCV A;  2ZU8 A;  1MC3 A;  4AC3 A;  4FRM A;  3SX3 A;  4FRE A;  5FUH A;  4EE5 A;  2D0J A;  4HO8 A;  1QGS A;  2OI7 A;  1NKH B;  1WSZ A;  4G3S A;  2VFZ A;  3JUK A;  1NF5 B;  2W0W A;  5C4B A;  1HJL A;  5CMJ A;  2AM3 A;  4J18 A;  4Y62 A;  2P72 A;  2A8W A;  1ZI1 A;  1ON6 A;  2I5K A;  1FXJ A;  4R7P A;  4D0T A;  1KWS A;  1G1L A;  2CU2 A;  2FYB A;  1LVW A;  1PZY B;  1IIN A;  1GA8 A;  4M4K A;  3I0H A;  2O1F A;  1ZCY A;  2E3D A;  2Y4M A;  4Y7F A;  3I0E A;  3SXG A;  4D11 A;  5IDT A;  1QWJ A;  3Q7U A;  2RIZ A;  1H7F A;  3I0C A;  1JYK A;  3TQD A;  4B4M A;  3I0D A;  1GWW A;  3HL3 A;  4M2B A;  1ZJ2 A;  1VM8 A;  2Y4L A;  3U2W A;  1VGT A;  2DPW A;  2OI6 A;  2X65 A;  3SX5 A;  1VH1 A;  1VGW A;  1ZJ1 A;  4NAI A;  2RJ7 A;  4BMA A;  4FRA A;  5C1H A;  1VGU A;  4AYL A;  3I0J A;  4EEG A;  1H4D A;  1H5R A;  1NHE B;  1H4C A;  2RJ0 A;  2RJ4 A;  1VPA A;  4KNR A;  4EEA A;  1H5S A;  1Z90 A;  4EE4 A;  4DDZ A;  2AE7 A;  2VXM A;  1R7V A;  2VD4 A;  2XWL A;  2MZB A;  5C3D A;  2Y4K A;  5C47 A;  2YQH A;  1QGQ A;  2Z87 A;  2RJ6 A;  5CQM X;  1FOA A;  3V0N A;  1XHB A;  3CGX A;  2FYA A;  3I0L A;  3ZF8 A;  1H5T A;  3SX7 A;  2FYD B;  4D48 A;  4XWI A;  5CQL X;  4ASY A;  1YP2 A;  4NAK A;  4LW3 A;  3TZT A;  1FWY A;  4FRD A;  3GUE A;  3ZLK A;  3U2U A;  4YS8 A;  2RIT A;  1G23 A;  2WVM A;  3U0X A;  2AES A;  1O7O A;  1H7T A;  1FG5 N;  2VS5 A;  4ARW A;  1LZI A;  4BQH A;  3R2W A;  3PKQ A;  1G0R A;  1V83 A;  2D7R A;  3DJ4 A;  3I0I X;  5J49 A;  2YQS A;  3OH3 A;  3NGW A;  5IDS A;  3EE5 A;  2VSH A;  4CJB A;  4KXO A;  5C4E A;  3F1Y A;  3KIA A;  1GX4 A;  3QVB A;  1NWG B;  4D11 C;  5C4D A;  2FY7 A;  4FRL A;  3I0F A;  3CU0 A;  1INI A;  3O3P A;  1GWV A;  1ZJ0 A;  2E8B A;  4Y7G A;  1LZ7 A;  1G2V A;  1R82 A;  5AJP A;  4IRQ A;  2BO8 A;  2VSI A;  1H7G A;  5CQN X;  4HO6 A;  5C1L A;  1H7H A;  3SXB A;  2YQC A;  3ZLL A;  4M28 A;  2RJ8 A;  5C8R A;  1LL3 A;  3IOJ A;  1MP3 A;  4P00 A;  5FU8 A;  2VS4 A;  5CMG X;  2V0H A;  5L6V A;  1YP4 A;  4Y7T A;  2BO4 A;  1W57 A;  2Z86 A;  1VZT A;  2OEG A;  1G8O A;  3USQ A;  1EZI A;  5FYE A;  1IIM A;  5EJZ A;  2YC3 A;  2YES A;  1H5S C;  2VXL A;  1S4O A;  3V91 A;  4HO0 A;  1ZIZ A;  2OI5 A; 
#chains in the Genus database with same CATH topology
 2YC5 A;  2X5S A;  3T7N A;  1FO8 A;  1H7E A;  1FO9 A;  2JCK A;  1GQ9 A;  2AM5 A;  4MND A;  1WT1 A;  3FWW A;  4K6R A;  1ZCT A;  3T7M A;  1VZU A;  4L41 C;  2D7I A;  5C1G A;  2QH5 A;  1H7L A;  2I7B A;  4B2W A;  2PGV A;  1O7Q A;  2Y7A A;  1WVC A;  3SX8 A;  1SS9 A;  1FGX A;  5C3A A;  3U0Y A;  4C2S A;  2FFU A;  1S4P A;  2ICX A;  3U2T A;  4ASJ A;  3U2X A;  4G87 A;  1TVY A;  3V8Z A;  3F1C A;  1VZX A;  2AH9 A;  2RIY A;  2WVL A;  2C0N A;  5C4F A;  3CKO A;  1HM9 A;  3CKN A;  4FQW A;  4P02 A;  1VGZ A;  4IRP A;  3CKJ A;  3FOQ A;  4JIS A;  3SXD A;  2GGQ A;  2RJ9 A;  3OC9 A;  1ZDG A;  3D5N A;  1S4N A;  5AJO A;  1OQM B;  4Y7V A;  4KRV A;  3OH2 A;  4B5B A;  1VIC A;  1R81 A;  4G3Q A;  1V82 A;  1JVG A;  3IOI A;  1PZT A;  2OEF A;  2PGY A;  4B3U A;  2VK9 A;  5FV9 A;  3DUV A;  4HCQ A;  4CJ8 A;  1ZDF A;  3U2V A;  2Q4J A;  3RMV A;  2V0K A;  2ICY A;  2J0B A;  5CMF X;  1JYL A;  3N9W A;  4O6N A;  2WGZ A;  3JUJ A;  4DEC A;  4E1K A;  2P6W A;  1G93 A;  1VH3 A;  3V0M A;  1H4E A;  1INJ A;  3PNN A;  1V84 A;  4HO5 A;  5DDT A;  4KC4 A;  1G9R A;  1HJJ A;  4KQL A;  1EYR A;  1GQC A;  1ZI5 A;  1TW5 A;  1WT0 A;  2VS3 A;  1H5R B;  5CMI A;  3OH0 A;  1G97 A;  1H5S B;  1JV3 A;  4FRO A;  1R7U A;  3V0P A;  2XWN A;  5C36 A;  1MP4 A;  2RJ5 A;  3V0L A;  2PA4 A;  1GX0 A;  3LW6 A;  5BXC A;  3K8E A;  1R7T A;  3RMW A;  2ZU9 A;  4KC2 A;  3OAM A;  1YP3 A;  5CQP A;  1ZHJ A;  2FFV A;  2GGO A;  2XME A;  3E25 A;  3BRK X;  1H5T B;  2X60 A;  3D8V A;  4Y6U A;  1QG8 A;  4DE7 A;  1ZCV A;  4KNX A;  1H7Q A;  5JQQ A;  2P73 A;  3SXE A;  1W77 A;  3V8Y A;  2YQJ A;  1W55 A;  1K4V A;  4Y6N A;  2A8U A;  3Q4S A;  1WT3 A;  2BO7 A;  3OKR A;  3OGZ A;  4FRH A;  4Y7U A;  5C49 A;  2RJ1 A;  1G95 A;  2X5Z A;  2I5E A;  1TZF A;  1O0R A;  5C4C A;  4KPX A;  4B42 A;  1ZJO A;  4NAN A;  4HO2 A;  4EE3 A;  4FCE A;  3SXA A;  3R3I A;  1ZCU A;  3POL A;  3OH4 A;  4FRQ A;  4EEM A;  4AAW A;  3CKV A;  2NXV A;  3OH1 A;  1I52 A;  2O1G A;  4ZDQ A;  5FTV A;  1OMX A;  2RIX A;  3SPT A;  3V0Q A;  1LL2 A;  1FXO A;  1H5S D;  1HV9 A;  4HOC A;  4ECM A;  4B2X A;  5HS2 A;  4FRP A;  2YCM A;  2AEC A;  3IOH A;  5CQO A;  5EJ1 A;  5L6S A;  1JVD A;  4Y63 A;  1FZW A;  2JCO A;  2V0I A;  5I1F A;  3SXC A;  1YRO B;  4M2A A;  4FCU A;  4Y64 A;  3PKP A;  1ZI3 A;  1LZ0 A;  2WE9 A;  2XWM A;  2PX7 A;  3V0O A;  4HO3 A;  3I0G A;  1HM0 A;  5DDV A;  4HO9 A;  2AM4 A;  2APC A;  2UX8 A;  1JV1 A;  1LL0 A;  1MP5 A;  2AGD A;  2QGI A;  2JCL A;  4G3P A;  1WT2 A;  1ZJP A;  4KT7 A;  4Y9X A;  4HG6 A;  4AYJ A;  2QKX A;  1G3L A;  5EIY A;  1FR9 A;  3JTJ A;  1FGG A;  1R7X A;  1FRW A;  3CKQ A;  3I0K A;  3T7O A;  1TW1 A;  1XZ6 A;  4KPZ A;  2V0L A;  3V90 A;  4B4B A;  5C3B A;  5CMH A;  2BO6 A;  1R7Y A;  4CJC A;  1FR8 A;  1NQI B;  2Y4J A;  3K8D A;  4HO4 A;  1NMM B;  2WVK A;  2O1H A;  2W0V A;  1E5K A;  1R80 A;  5IFY A;  1HM8 A;  1H3M A;  4LW6 A;  2Y6P A;  5C48 A;  2FYC B;  5FU0 A;  4MIX A;  4EEO A;  4CVH A;  2WEE A;  1ON8 A;  4O6M A;  3D98 A;  4KC1 A;  2ZU7 A;  4B4G A;  2WAW A;  2V0J A;  1ZI4 A;  4D0Z A;  3RSB A;  3ZGG A;  1O23 B;  2J0A A;  1LZJ A;  4UEG A;  5C38 A;  5FTS A;  3DK5 A;  4GBP A;  4FRB A;  3ST8 A;  3E26 A;  4JD0 A;  4EVW A;  2JCJ A;  3ZGF A;  3Q80 A;  1ZJ3 A;  1OMZ A;  5AJN A;  4NAL A;  4MYB A;  3USR A;  2XMH A;  3BCV A;  2ZU8 A;  1MC3 A;  4AC3 A;  4FRM A;  3SX3 A;  4FRE A;  5FUH A;  4EE5 A;  2D0J A;  4HO8 A;  1QGS A;  2OI7 A;  1NKH B;  1WSZ A;  4G3S A;  2VFZ A;  3JUK A;  1NF5 B;  2W0W A;  5C4B A;  1HJL A;  5CMJ A;  2AM3 A;  4J18 A;  4Y62 A;  2P72 A;  2A8W A;  1ZI1 A;  1ON6 A;  2I5K A;  1FXJ A;  4R7P A;  4D0T A;  1KWS A;  1G1L A;  2CU2 A;  2FYB A;  1LVW A;  1PZY B;  1IIN A;  1GA8 A;  4M4K A;  3I0H A;  2O1F A;  1ZCY A;  2E3D A;  2Y4M A;  4Y7F A;  3I0E A;  3SXG A;  4D11 A;  5IDT A;  1QWJ A;  3Q7U A;  2RIZ A;  1H7F A;  3I0C A;  1JYK A;  3TQD A;  4B4M A;  3I0D A;  1GWW A;  3HL3 A;  4M2B A;  1ZJ2 A;  1VM8 A;  2Y4L A;  3U2W A;  1VGT A;  2DPW A;  2OI6 A;  2X65 A;  3SX5 A;  1VH1 A;  1VGW A;  1ZJ1 A;  4NAI A;  2RJ7 A;  4BMA A;  4FRA A;  4FIY A;  5C1H A;  1VGU A;  4AYL A;  3I0J A;  4EEG A;  1H4D A;  1H5R A;  1NHE B;  1H4C A;  2RJ0 A;  2RJ4 A;  1VPA A;  4KNR A;  4EEA A;  1H5S A;  1Z90 A;  4EE4 A;  4DDZ A;  2AE7 A;  2VXM A;  1R7V A;  2VD4 A;  2XWL A;  2MZB A;  5C3D A;  2Y4K A;  5C47 A;  2YQH A;  1QGQ A;  2Z87 A;  2RJ6 A;  5CQM X;  1FOA A;  3V0N A;  1XHB A;  3CGX A;  2FYA A;  3I0L A;  3ZF8 A;  1H5T A;  3SX7 A;  2FYD B;  4D48 A;  4XWI A;  5CQL X;  4ASY A;  1YP2 A;  4NAK A;  4LW3 A;  3TZT A;  1FWY A;  4FRD A;  3GUE A;  3ZLK A;  3U2U A;  4YS8 A;  2RIT A;  1G23 A;  2WVM A;  3U0X A;  2AES A;  4FIX A;  1O7O A;  1H7T A;  1FG5 N;  2VS5 A;  5D92 A;  4ARW A;  1LZI A;  4BQH A;  3R2W A;  3PKQ A;  1G0R A;  1V83 A;  2D7R A;  3DJ4 A;  3I0I X;  5J49 A;  2YQS A;  3OH3 A;  3NGW A;  5IDS A;  3EE5 A;  2VSH A;  4CJB A;  4KXO A;  5C4E A;  3F1Y A;  3KIA A;  1GX4 A;  3QVB A;  1NWG B;  4D11 C;  5C4D A;  2FY7 A;  4FRL A;  3I0F A;  3CU0 A;  1INI A;  3O3P A;  1GWV A;  1ZJ0 A;  2E8B A;  4Y7G A;  1LZ7 A;  1G2V A;  1R82 A;  5AJP A;  4IRQ A;  2BO8 A;  2VSI A;  1H7G A;  5CQN X;  4HO6 A;  5C1L A;  1H7H A;  3SXB A;  2YQC A;  3ZLL A;  4M28 A;  2RJ8 A;  5C8R A;  1LL3 A;  3IOJ A;  1MP3 A;  4P00 A;  5FU8 A;  2VS4 A;  5CMG X;  5D91 A;  2V0H A;  5L6V A;  1YP4 A;  4Y7T A;  2BO4 A;  1W57 A;  2Z86 A;  1VZT A;  2OEG A;  1G8O A;  3USQ A;  1EZI A;  5FYE A;  1IIM A;  5EJZ A;  2YC3 A;  2YES A;  1H5S C;  2VXL A;  1S4O A;  4Q7C A;  3V91 A;  4HO0 A;  1ZIZ A;  2OI5 A; 
#chains in the Genus database with same CATH homology
 2YC5 A;  2X5S A;  3T7N A;  1FO8 A;  1H7E A;  1FO9 A;  2JCK A;  1GQ9 A;  2AM5 A;  4MND A;  1WT1 A;  3FWW A;  4K6R A;  1ZCT A;  3T7M A;  1VZU A;  4L41 C;  2D7I A;  5C1G A;  2QH5 A;  1H7L A;  2I7B A;  4B2W A;  2PGV A;  1O7Q A;  2Y7A A;  1WVC A;  3SX8 A;  1SS9 A;  1FGX A;  5C3A A;  3U0Y A;  4C2S A;  2FFU A;  1S4P A;  2ICX A;  3U2T A;  4ASJ A;  3U2X A;  4G87 A;  1TVY A;  3V8Z A;  3F1C A;  1VZX A;  2AH9 A;  2RIY A;  2WVL A;  2C0N A;  5C4F A;  3CKO A;  1HM9 A;  3CKN A;  4FQW A;  4P02 A;  1VGZ A;  4IRP A;  3CKJ A;  3FOQ A;  4JIS A;  3SXD A;  2GGQ A;  2RJ9 A;  3OC9 A;  1ZDG A;  3D5N A;  1S4N A;  5AJO A;  1OQM B;  4Y7V A;  4KRV A;  3OH2 A;  4B5B A;  1VIC A;  1R81 A;  4G3Q A;  1V82 A;  1JVG A;  3IOI A;  1PZT A;  2OEF A;  2PGY A;  4B3U A;  2VK9 A;  5FV9 A;  3DUV A;  4HCQ A;  4CJ8 A;  1ZDF A;  3U2V A;  2Q4J A;  3RMV A;  2V0K A;  2ICY A;  2J0B A;  5CMF X;  1JYL A;  3N9W A;  4O6N A;  2WGZ A;  3JUJ A;  4DEC A;  4E1K A;  2P6W A;  1G93 A;  1VH3 A;  3V0M A;  1H4E A;  1INJ A;  3PNN A;  1V84 A;  4HO5 A;  5DDT A;  4KC4 A;  1G9R A;  1HJJ A;  4KQL A;  1EYR A;  1GQC A;  1ZI5 A;  1TW5 A;  1WT0 A;  2VS3 A;  1H5R B;  5CMI A;  3OH0 A;  1G97 A;  1H5S B;  1JV3 A;  4FRO A;  1R7U A;  3V0P A;  2XWN A;  5C36 A;  1MP4 A;  2RJ5 A;  3V0L A;  2PA4 A;  1GX0 A;  3LW6 A;  5BXC A;  3K8E A;  1R7T A;  3RMW A;  2ZU9 A;  4KC2 A;  3OAM A;  1YP3 A;  5CQP A;  1ZHJ A;  2FFV A;  2GGO A;  2XME A;  3E25 A;  3BRK X;  1H5T B;  2X60 A;  3D8V A;  4Y6U A;  1QG8 A;  4DE7 A;  1ZCV A;  4KNX A;  1H7Q A;  5JQQ A;  2P73 A;  3SXE A;  1W77 A;  3V8Y A;  2YQJ A;  1W55 A;  1K4V A;  4Y6N A;  2A8U A;  3Q4S A;  1WT3 A;  2BO7 A;  3OKR A;  3OGZ A;  4FRH A;  4Y7U A;  5C49 A;  2RJ1 A;  1G95 A;  2X5Z A;  2I5E A;  1TZF A;  1O0R A;  5C4C A;  4KPX A;  4B42 A;  1ZJO A;  4NAN A;  4HO2 A;  4EE3 A;  4FCE A;  3SXA A;  3R3I A;  1ZCU A;  3POL A;  3OH4 A;  4FRQ A;  4EEM A;  4AAW A;  3CKV A;  2NXV A;  3OH1 A;  1I52 A;  2O1G A;  4ZDQ A;  5FTV A;  1OMX A;  2RIX A;  3SPT A;  3V0Q A;  1LL2 A;  1FXO A;  1H5S D;  1HV9 A;  4HOC A;  4ECM A;  4B2X A;  5HS2 A;  4FRP A;  2YCM A;  2AEC A;  3IOH A;  5CQO A;  5EJ1 A;  5L6S A;  1JVD A;  4Y63 A;  1FZW A;  2JCO A;  2V0I A;  5I1F A;  3SXC A;  1YRO B;  4M2A A;  4FCU A;  4Y64 A;  3PKP A;  1ZI3 A;  1LZ0 A;  2WE9 A;  2XWM A;  2PX7 A;  3V0O A;  4HO3 A;  3I0G A;  1HM0 A;  5DDV A;  4HO9 A;  2AM4 A;  2APC A;  2UX8 A;  1JV1 A;  1LL0 A;  1MP5 A;  2AGD A;  2QGI A;  2JCL A;  4G3P A;  1WT2 A;  1ZJP A;  4KT7 A;  4Y9X A;  4HG6 A;  4AYJ A;  2QKX A;  1G3L A;  5EIY A;  1FR9 A;  3JTJ A;  1FGG A;  1R7X A;  1FRW A;  3CKQ A;  3I0K A;  3T7O A;  1TW1 A;  1XZ6 A;  4KPZ A;  2V0L A;  3V90 A;  4B4B A;  5C3B A;  5CMH A;  2BO6 A;  1R7Y A;  4CJC A;  1FR8 A;  1NQI B;  2Y4J A;  3K8D A;  4HO4 A;  1NMM B;  2WVK A;  2O1H A;  2W0V A;  1E5K A;  1R80 A;  5IFY A;  1HM8 A;  1H3M A;  4LW6 A;  2Y6P A;  5C48 A;  2FYC B;  5FU0 A;  4MIX A;  4EEO A;  4CVH A;  2WEE A;  1ON8 A;  4O6M A;  3D98 A;  4KC1 A;  2ZU7 A;  4B4G A;  2WAW A;  2V0J A;  1ZI4 A;  4D0Z A;  3RSB A;  3ZGG A;  1O23 B;  2J0A A;  1LZJ A;  4UEG A;  5C38 A;  5FTS A;  3DK5 A;  4GBP A;  4FRB A;  3ST8 A;  3E26 A;  4JD0 A;  4EVW A;  2JCJ A;  3ZGF A;  3Q80 A;  1ZJ3 A;  1OMZ A;  5AJN A;  4NAL A;  4MYB A;  3USR A;  2XMH A;  3BCV A;  2ZU8 A;  1MC3 A;  4AC3 A;  4FRM A;  3SX3 A;  4FRE A;  5FUH A;  4EE5 A;  2D0J A;  4HO8 A;  1QGS A;  2OI7 A;  1NKH B;  1WSZ A;  4G3S A;  2VFZ A;  3JUK A;  1NF5 B;  2W0W A;  5C4B A;  1HJL A;  5CMJ A;  2AM3 A;  4J18 A;  4Y62 A;  2P72 A;  2A8W A;  1ZI1 A;  1ON6 A;  2I5K A;  1FXJ A;  4R7P A;  4D0T A;  1KWS A;  1G1L A;  2CU2 A;  2FYB A;  1LVW A;  1PZY B;  1IIN A;  1GA8 A;  4M4K A;  3I0H A;  2O1F A;  1ZCY A;  2E3D A;  2Y4M A;  4Y7F A;  3I0E A;  3SXG A;  4D11 A;  5IDT A;  1QWJ A;  3Q7U A;  2RIZ A;  1H7F A;  3I0C A;  1JYK A;  3TQD A;  4B4M A;  3I0D A;  1GWW A;  3HL3 A;  4M2B A;  1ZJ2 A;  1VM8 A;  2Y4L A;  3U2W A;  1VGT A;  2DPW A;  2OI6 A;  2X65 A;  3SX5 A;  1VH1 A;  1VGW A;  1ZJ1 A;  4NAI A;  2RJ7 A;  4BMA A;  4FRA A;  4FIY A;  5C1H A;  1VGU A;  4AYL A;  3I0J A;  4EEG A;  1H4D A;  1H5R A;  1NHE B;  1H4C A;  2RJ0 A;  2RJ4 A;  1VPA A;  4KNR A;  4EEA A;  1H5S A;  1Z90 A;  4EE4 A;  4DDZ A;  2AE7 A;  2VXM A;  1R7V A;  2VD4 A;  2XWL A;  2MZB A;  5C3D A;  2Y4K A;  5C47 A;  2YQH A;  1QGQ A;  2Z87 A;  2RJ6 A;  5CQM X;  1FOA A;  3V0N A;  1XHB A;  3CGX A;  2FYA A;  3I0L A;  3ZF8 A;  1H5T A;  3SX7 A;  2FYD B;  4D48 A;  4XWI A;  5CQL X;  4ASY A;  1YP2 A;  4NAK A;  4LW3 A;  3TZT A;  1FWY A;  4FRD A;  3GUE A;  3ZLK A;  3U2U A;  4YS8 A;  2RIT A;  1G23 A;  2WVM A;  3U0X A;  2AES A;  4FIX A;  1O7O A;  1H7T A;  1FG5 N;  2VS5 A;  5D92 A;  4ARW A;  1LZI A;  4BQH A;  3R2W A;  3PKQ A;  1G0R A;  1V83 A;  2D7R A;  3DJ4 A;  3I0I X;  5J49 A;  2YQS A;  3OH3 A;  3NGW A;  5IDS A;  3EE5 A;  2VSH A;  4CJB A;  4KXO A;  5C4E A;  3F1Y A;  3KIA A;  1GX4 A;  3QVB A;  1NWG B;  4D11 C;  5C4D A;  2FY7 A;  4FRL A;  3I0F A;  3CU0 A;  1INI A;  3O3P A;  1GWV A;  1ZJ0 A;  2E8B A;  4Y7G A;  1LZ7 A;  1G2V A;  1R82 A;  5AJP A;  4IRQ A;  2BO8 A;  2VSI A;  1H7G A;  5CQN X;  4HO6 A;  5C1L A;  1H7H A;  3SXB A;  2YQC A;  3ZLL A;  4M28 A;  2RJ8 A;  5C8R A;  1LL3 A;  3IOJ A;  1MP3 A;  4P00 A;  5FU8 A;  2VS4 A;  5CMG X;  5D91 A;  2V0H A;  5L6V A;  1YP4 A;  4Y7T A;  2BO4 A;  1W57 A;  2Z86 A;  1VZT A;  2OEG A;  1G8O A;  3USQ A;  1EZI A;  5FYE A;  1IIM A;  5EJZ A;  2YC3 A;  2YES A;  1H5S C;  2VXL A;  1S4O A;  4Q7C A;  3V91 A;  4HO0 A;  1ZIZ A;  2OI5 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...