2O1FA

Natural occuring mutation of human abo(h) galactosyltransferase: gtb/m214r
Total Genus 81
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
81
sequence length
284
structure length
264
Chain Sequence
FMVSLPRMVYPQPKVLTPCRKDVLVVTPWLAPIVWEGTFNIDILNEQFRLQNTTIGLTVFAIKKYVAFLKLFLETAEKHFMVGHRVHYYVFTDQPAAVPRVTLGTGRQLSVLEVCERRFLSEVDYLVCVDVDREFRDHVGVEILTPLFGTLHPSFYGSSREAFTYERRPQSQAYIPKDEGDFYYMGAFFGGSVQEVQRLTRACHQAMMVDQANGIEAVWHDESHLNKYLLRHKPTKVLSPEYLWDQQLLGWPAVLRKLRFTAVP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords ABO glycosyltransferase
publication title Structural effects of naturally occurring human blood group B galactosyltransferase mutations adjacent to the DXD motif.
pubmed doi rcsb
source organism Homo sapiens
total genus 81
structure length 264
sequence length 284
ec nomenclature ec 2.4.1.37: Fucosylgalactoside 3-alpha-galactosyltransferase.
pdb deposition date 2006-11-28
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.550.10 Alpha Beta Alpha-Beta Complex Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A 2o1fA00
5FV9A 2YQSA 4KXOA 4NAKA 1ZCVA 4G87A 3V90A 5CMJA 3SX3A 5I1FA 1H4DA 2V0KA 1S4NA 2OI5A 4ECMA 4L41C 1VGZA 5C1GA 3USQA 3D98A 1INIA 5FU0A 2VD4A 5CMGX 2QH5A 2FYDB 4NALA 4HO5A 5CMIA 2DPWA 3E25A 4KNRA 5FU8A 2UX8A 1ZDFA 2WAWA 3POLA 4MYBA 3CU0A 3OC9A 2RJ5A 5CQLX 5C3BA 1FXOA 1JV3A 1ZJ2A 3I0JA 1HV9A 3E26A 2RJ9A 1ZDGA 3JUJA 4HCQA 1VZXA 2OI7A 1EZIA 2RJ6A 2A8UA 5J49A 1NQIB 2Y6PA 1TVYA 3ZLLA 5AJNA 2D7IA 2OEFA 1WT3A 1QG8A 3F1CA 2AESA 4FCEA 1NHEB 5C1LA 1G8OA 1QGSA 3JUKA 1EYRA 4D0TA 4KC4A 3U0XA 3N9WA 2PGYA 2Y4MA 1H5TA 1H7TA 3V0OA 1R7VA 2RIZA 3V0MA 2ZU9A 1ZI4A 4EEAA 4Y64A 3ZLKA 3CKNA 3IOIA 5C3AA 4ZDQA 4D0ZA 4HO8A 1NMMB 4GBPA 5AJOA 1V83A 2GGOA 2RJ8A 3V8ZA 1LZIA 3IOJA 2Z87A 1YP2A 2YQCA 4KQLA 3RMVA 4HO2A 2I7BA 2FFVA 1ZJ1A 1H5RB 2X5SA 3ZF8A 4G3SA 1H7HA 4Y7TA 2JCLA 4CVHA 4B2XA 2VS4A 2YQHA 3D5NA 3V0QA 5JQQA 2X5ZA 2RIYA 3U2XA 5HS2A 1IINA 4M2BA 4IRQA 3V8YA 5CQPA 3T7NA 5DDVA 1GX0A 2APCA 1JV1A 4IRPA 2XWNA 1VICA 2FYCB 5FTVA 5BXCA 1FO9A 2VSHA 1O23B 5FUHA 1WVCA 2VXLA 5C48A 1KWSA 1S4OA 1WT1A 1TZFA 4FRPA 4HO9A 4P02A 5IFYA 1W57A 4J18A 4EE3A 4HO4A 2BO8A 1I52A 1LVWA 3SXEA 4G3PA 1FGXA 3LW6A 4CJ8A 1GQ9A 1VGTA 2I5KA 3V0NA 4AYLA 1H7EA 1W55A 2E8BA 4B4MA 3SPTA 4E1KA 1QWJA 2FY7A 2NXVA 2AH9A 2YQJA 1H4CA 3I0KA 3SX7A 5EIYA 2BO7A 2V0LA 3OH0A 2VXMA 2YC3A 1G23A 2X65A 1YROB 3PKPA 5C36A 5EJ1A 2AM3A 4K6RA 2VS3A 1O7QA 4FRAA 2CU2A 4HOCA 2P73A 3I0CA 2WE9A 2FYBA 5C38A 2XMEA 2Y7AA 1VH1A 1WSZA 1ON8A 1IIMA 1YP3A 3CKOA 1R80A 3OH3A 2RJ1A 5FTSA 3BRKX 2FYAA 2XWMA 3SXAA 1GX4A 5C3DA 4CJBA 1PZTA 3ZGFA 4C2SA 1ZJ0A 2RJ0A 4KNXA 3SXCA 1H5TB 4JD0A 2P72A 4ASYA 3QVBA 2I5EA 2PGVA 3DUVA 1FWYA 3K8EA 3I0HA 4LW3A 3U0YA 5CQNX 4Y7VA 3RSBA 3I0FA 4Y7FA 4KPZA 1FGGA 5DDTA 3K8DA 1MP4A 1YP4A 3T7OA 5CQMX 2O1HA 1ZCYA 5IDTA 3ST8A 2WGZA 1W77A 2D0JA 3I0LA 1TW1A 3CKQA 2WEEA 1FG5N 4B2WA 3HL3A 4KT7A 1HJJA 5C49A 1NF5B 1H4EA 4AAWA 2P6WA 4JISA 4D48A 1FO8A 1VH3A 2YESA 4P00A 2VS5A 2ICYA 4KC2A 4AC3A 2PX7A 4FCUA 2MZBA 3CKJA 1FR9A 3FWWA 3I0EA 1VZUA 5C4BA 1FOAA 1INJA 4EEOA 1OQMB 3D8VA 4M4KA 2XMHA 2V0JA 1H5SC 1HM8A 3R2WA 2GGQA 1G9RA 3SXDA 1G1LA 3V0PA 1ZIZA 4ASJA 1LL0A 3V0LA 1GWVA 2Y4JA 3NGWA 2O1FA 3BCVA 1K4VA 1H3MA 1G93A 3U2VA 5AJPA 2AM4A 2ICXA 3U2WA 5C4DA 1R7TA 3U2UA 1GA8A 4B5BA 4MNDA 1V84A 1ON6A 2OI6A 3PNNA 1Z90A 1H5SA 1VPAA 1HJLA 5C1HA 3IOHA 1NWGB 4HG6A 2V0IA 3I0IX 5C4EA 3OH2A 2PA4A 3I0GA 2X60A 5FYEA 2JCJA 2XWLA 3CGXA 2A8WA 2V0HA 3EE5A 5C8RA 2WVLA 1JVGA 1MP3A 5CMHA 3TQDA 3O3PA 1LL3A 2RJ7A 4FRLA 1S4PA 4DDZA 4EVWA 5L6VA 2WVKA 1WT2A 3SX8A 3V91A 4Y63A 2AECA 2QKXA 3FOQA 4EEGA 1QGQA 4NANA 2AE7A 4B4BA 1E5KA 4FRQA 5C4CA 1MP5A 1JYKA 2VSIA 3USRA 5CQOA 3ZGGA 4HO6A 1ZI3A 2Z86A 1ZCTA 3JTJA 4KC1A 2BO6A 2RIXA 3TZTA 4KPXA 1G0RA 2RITA 1VGUA 4HO3A 4B3UA 2O1GA 4ARWA 2YCMA 4EE5A 1R7UA 3CKVA 4UEGA 2AM5A 4XWIA 3OKRA 1H7LA 3F1YA 1R7XA 4KRVA 1O7OA 1SS9A 1TW5A 4FREA 4FQWA 4YS8A 5IDSA 4EE4A 1FXJA 1FR8A 1H5SD 3R3IA 1R82A 3DJ4A 3RMWA 1HM0A 3Q4SA 2BO4A 1NKHB 2ZU7A 2Y4LA 1LL2A 4HO0A 1FRWA 2JCKA 3GUEA 4G3QA 1LZ0A 4M28A 2RJ4A 1ZJPA 1OMXA 2JCOA 4AYJA 3SX5A 1VGWA 1LZJA 2QGIA 3OGZA 3OH1A 4EEMA 1GQCA 5L6SA 2Y4KA 4FROA 5CMFX 4FRMA 4FRHA 1VM8A 3Q7UA 3SXGA 2W0VA 3OAMA 3Q80A 3T7MA 1H5SB 4NAIA 1ZCUA 1G3LA 4D11C 4Y7UA 5EJZA 3SXBA 2VFZA 4DECA 4Y6NA 1MC3A 1OMZA 1G95A 1VZTA 4Y62A 4Y7GA 2YC5A 1ZI5A 1FZWA 4DE7A 2Q4JA 1R81A 4FRDA 4R7PA 3U2TA 1ZJ3A 1O0RA 3KIAA 4FRBA 1XZ6A 1ZHJA 1HM9A 1LZ7A 2OEGA 2AGDA 4LW6A 1H7FA 1ZJOA 4CJCA 1PZYB 1XHBA 2D7RA 2W0WA 1H5RA 1JYLA 3PKQA 5C4FA 1G2VA 1GWWA 1V82A 4D11A 4BMAA 4B4GA 1WT0A 4Y6UA 2ZU8A 3I0DA 1H7GA 1G97A 5C47A 1JVDA 4BQHA 3OH4A 3DK5A 1ZI1A 2E3DA 4Y9XA 1R7YA 2WVMA 1H7QA 4B42A 4M2AA 2FFUA
chains in the Genus database with same CATH superfamily
5FV9A 2YQSA 4KXOA 4NAKA 1ZCVA 4G87A 3V90A 5CMJA 3SX3A 5I1FA 1H4DA 2V0KA 1S4NA 2OI5A 4ECMA 4L41C 1VGZA 5C1GA 3USQA 3D98A 1INIA 5FU0A 2VD4A 5CMGX 2QH5A 2FYDB 4NALA 4HO5A 5CMIA 2DPWA 3E25A 4KNRA 5FU8A 2UX8A 4O6NA 1ZDFA 2WAWA 3POLA 4MYBA 3CU0A 3OC9A 2RJ5A 5CQLX 5C3BA 1FXOA 1JV3A 1ZJ2A 3I0JA 1HV9A 3E26A 2RJ9A 1ZDGA 3JUJA 4HCQA 1VZXA 2OI7A 1EZIA 2RJ6A 2A8UA 5J49A 1NQIB 2Y6PA 1TVYA 3ZLLA 5AJNA 2D7IA 2OEFA 1WT3A 1QG8A 3F1CA 2AESA 4FCEA 1NHEB 5C1LA 1G8OA 1QGSA 3JUKA 1EYRA 4D0TA 4KC4A 3U0XA 3N9WA 2PGYA 2Y4MA 1H5TA 1H7TA 3V0OA 2J0AA 1R7VA 2RIZA 3V0MA 2ZU9A 1ZI4A 4EEAA 4Y64A 3ZLKA 3CKNA 3IOIA 5C3AA 4ZDQA 4D0ZA 4HO8A 1NMMB 4GBPA 5AJOA 1V83A 2GGOA 2RJ8A 3V8ZA 1LZIA 3IOJA 2Z87A 2J0BA 1YP2A 2YQCA 4KQLA 3RMVA 4HO2A 2I7BA 2FFVA 1ZJ1A 1H5RB 2X5SA 3ZF8A 4G3SA 1H7HA 4Y7TA 2JCLA 4CVHA 4B2XA 2VS4A 2YQHA 3D5NA 3V0QA 5JQQA 2X5ZA 2RIYA 3U2XA 4FIYA 5HS2A 1IINA 4M2BA 4IRQA 3V8YA 5CQPA 3T7NA 5DDVA 1GX0A 2APCA 1JV1A 4IRPA 2XWNA 1VICA 2FYCB 5FTVA 5BXCA 1FO9A 2VSHA 1O23B 5FUHA 1WVCA 2VXLA 5C48A 1KWSA 1S4OA 1WT1A 1TZFA 4FRPA 4HO9A 4P02A 5IFYA 1W57A 4J18A 4EE3A 4HO4A 2BO8A 1I52A 1LVWA 3SXEA 4G3PA 1FGXA 3LW6A 4CJ8A 1GQ9A 1VGTA 2I5KA 3V0NA 4AYLA 1H7EA 1W55A 2E8BA 4B4MA 3SPTA 4E1KA 1QWJA 2FY7A 2NXVA 2AH9A 2YQJA 1H4CA 3I0KA 3SX7A 5EIYA 2BO7A 2V0LA 3OH0A 2VXMA 2YC3A 1G23A 2X65A 1YROB 3PKPA 5C36A 5EJ1A 2AM3A 4K6RA 2VS3A 1O7QA 4FRAA 2CU2A 4HOCA 2P73A 3I0CA 2WE9A 2FYBA 5D91A 5C38A 2XMEA 2Y7AA 1VH1A 1WSZA 1ON8A 1IIMA 1YP3A 3CKOA 1R80A 3OH3A 2RJ1A 5FTSA 3BRKX 2FYAA 2XWMA 3SXAA 1GX4A 5C3DA 4CJBA 1PZTA 3ZGFA 4C2SA 1ZJ0A 2RJ0A 4KNXA 3SXCA 1H5TB 4JD0A 2P72A 4ASYA 3QVBA 2I5EA 2PGVA 3DUVA 1FWYA 3K8EA 3I0HA 4LW3A 3U0YA 5CQNX 4Y7VA 3RSBA 3I0FA 4Y7FA 4KPZA 1FGGA 5DDTA 3K8DA 1MP4A 1YP4A 3T7OA 5CQMX 2O1HA 1ZCYA 5IDTA 3ST8A 2WGZA 1W77A 2D0JA 3I0LA 1TW1A 3CKQA 2WEEA 1FG5N 4MIXA 4B2WA 3HL3A 4KT7A 1HJJA 5C49A 1NF5B 1H4EA 4AAWA 2P6WA 4JISA 4D48A 1FO8A 1VH3A 2YESA 4P00A 2VS5A 2ICYA 4KC2A 4AC3A 2PX7A 4FCUA 2MZBA 3CKJA 1FR9A 3FWWA 3I0EA 1VZUA 5C4BA 1FOAA 1INJA 4EEOA 5D92A 1OQMB 3D8VA 4M4KA 2XMHA 2V0JA 1H5SC 1HM8A 3R2WA 2GGQA 1G9RA 3SXDA 1G1LA 3V0PA 1ZIZA 4ASJA 1LL0A 3V0LA 1GWVA 2Y4JA 3NGWA 2O1FA 3BCVA 1K4VA 1H3MA 1G93A 3U2VA 5AJPA 2AM4A 2ICXA 3U2WA 5C4DA 1R7TA 3U2UA 1GA8A 4B5BA 4MNDA 1V84A 1ON6A 2OI6A 3PNNA 1Z90A 1H5SA 1VPAA 1HJLA 5C1HA 3IOHA 1NWGB 4HG6A 2V0IA 3I0IX 5C4EA 3OH2A 2PA4A 3I0GA 2X60A 5FYEA 2JCJA 3CGXA 2XWLA 2A8WA 2V0HA 3EE5A 5C8RA 2WVLA 1JVGA 1MP3A 5CMHA 3TQDA 3O3PA 1LL3A 2RJ7A 4O6MA 4FRLA 1S4PA 4DDZA 4EVWA 5L6VA 2WVKA 1WT2A 3SX8A 3V91A 4Y63A 2AECA 2QKXA 3FOQA 4EEGA 1QGQA 4NANA 2AE7A 4B4BA 1E5KA 4FRQA 5C4CA 1MP5A 1JYKA 2VSIA 3USRA 5CQOA 3ZGGA 4HO6A 1ZI3A 2Z86A 1ZCTA 3JTJA 4KC1A 2BO6A 2RIXA 3TZTA 4KPXA 1G0RA 2RITA 1VGUA 4HO3A 4B3UA 2O1GA 2C0NA 4ARWA 2YCMA 4EE5A 1R7UA 3CKVA 4UEGA 2AM5A 4XWIA 3OKRA 1H7LA 3F1YA 1R7XA 4KRVA 1O7OA 1SS9A 1TW5A 4FREA 4FQWA 4YS8A 4Q7CA 4FIXA 5IDSA 4EE4A 1FXJA 1FR8A 1H5SD 2VK9A 3R3IA 1R82A 3DJ4A 3RMWA 1HM0A 3Q4SA 2BO4A 1NKHB 2ZU7A 2Y4LA 1LL2A 4HO0A 1FRWA 2JCKA 3GUEA 4G3QA 1LZ0A 4M28A 2RJ4A 1ZJPA 1OMXA 2JCOA 4AYJA 3SX5A 1VGWA 1LZJA 2QGIA 3OGZA 3OH1A 4EEMA 1GQCA 5L6SA 2Y4KA 4FROA 5CMFX 4FRMA 4FRHA 1VM8A 3Q7UA 3SXGA 2W0VA 3OAMA 3Q80A 3T7MA 1H5SB 4NAIA 1ZCUA 1G3LA 4D11C 4Y7UA 5EJZA 3SXBA 2VFZA 4DECA 4Y6NA 1MC3A 1OMZA 1G95A 1VZTA 4Y62A 4Y7GA 2YC5A 1ZI5A 1FZWA 4DE7A 2Q4JA 1R81A 4FRDA 4R7PA 3U2TA 1ZJ3A 1O0RA 3KIAA 4FRBA 1XZ6A 1ZHJA 1HM9A 1LZ7A 2OEGA 2AGDA 4LW6A 1H7FA 1ZJOA 4CJCA 1PZYB 1XHBA 2D7RA 2W0WA 1H5RA 1JYLA 3PKQA 5C4FA 1G2VA 1GWWA 1V82A 4D11A 4BMAA 4B4GA 1WT0A 4Y6UA 2ZU8A 3I0DA 1H7GA 1G97A 5C47A 1JVDA 4BQHA 3OH4A 3DK5A 1ZI1A 2E3DA 4Y9XA 1R7YA 2WVMA 1H7QA 4B42A 4M2AA 2FFUA
chains in the Genus database with same CATH topology
5FV9A 2YQSA 4KXOA 4NAKA 1ZCVA 4G87A 3V90A 5CMJA 3SX3A 5I1FA 1H4DA 2V0KA 1S4NA 2OI5A 4ECMA 4L41C 1VGZA 5C1GA 3USQA 3D98A 1INIA 5FU0A 2VD4A 5CMGX 2QH5A 2FYDB 4NALA 4HO5A 5CMIA 2DPWA 3E25A 4KNRA 5FU8A 2UX8A 4O6NA 1ZDFA 2WAWA 3POLA 4MYBA 3CU0A 3OC9A 2RJ5A 5CQLX 5C3BA 1FXOA 1JV3A 1ZJ2A 3I0JA 1HV9A 3E26A 2RJ9A 1ZDGA 3JUJA 4HCQA 1VZXA 2OI7A 1EZIA 2RJ6A 2A8UA 5J49A 1NQIB 2Y6PA 1TVYA 3ZLLA 5AJNA 2D7IA 2OEFA 1WT3A 1QG8A 3F1CA 2AESA 4FCEA 1NHEB 5C1LA 1G8OA 1QGSA 3JUKA 1EYRA 4D0TA 4KC4A 3U0XA 3N9WA 2PGYA 2Y4MA 1H5TA 1H7TA 3V0OA 2J0AA 1R7VA 2RIZA 3V0MA 2ZU9A 1ZI4A 4EEAA 4Y64A 3ZLKA 3CKNA 3IOIA 5C3AA 4ZDQA 4D0ZA 4HO8A 1NMMB 4GBPA 5AJOA 1V83A 2GGOA 2RJ8A 3V8ZA 1LZIA 3IOJA 2Z87A 2J0BA 1YP2A 2YQCA 4KQLA 3RMVA 4HO2A 2I7BA 2FFVA 1ZJ1A 1H5RB 2X5SA 3ZF8A 4G3SA 1H7HA 4Y7TA 2JCLA 4CVHA 4B2XA 2VS4A 2YQHA 3D5NA 3V0QA 5JQQA 2X5ZA 2RIYA 3U2XA 4FIYA 5HS2A 1IINA 4M2BA 4IRQA 3V8YA 5CQPA 3T7NA 5DDVA 1GX0A 2APCA 1JV1A 4IRPA 2XWNA 1VICA 2FYCB 5FTVA 5BXCA 1FO9A 2VSHA 1O23B 5FUHA 1WVCA 2VXLA 5C48A 1KWSA 1S4OA 1WT1A 1TZFA 4FRPA 4HO9A 4P02A 5IFYA 1W57A 4J18A 4EE3A 4HO4A 2BO8A 1I52A 1LVWA 3SXEA 4G3PA 1FGXA 3LW6A 4CJ8A 1GQ9A 1VGTA 2I5KA 3V0NA 4AYLA 1H7EA 1W55A 2E8BA 4B4MA 3SPTA 4E1KA 1QWJA 2FY7A 2NXVA 2AH9A 2YQJA 1H4CA 3I0KA 3SX7A 5EIYA 2BO7A 2V0LA 3OH0A 2VXMA 2YC3A 1G23A 2X65A 1YROB 3PKPA 5C36A 5EJ1A 2AM3A 4K6RA 2VS3A 1O7QA 4FRAA 2CU2A 4HOCA 2P73A 3I0CA 2WE9A 2FYBA 5D91A 5C38A 2XMEA 2Y7AA 1VH1A 1WSZA 1ON8A 1IIMA 1YP3A 3CKOA 1R80A 3OH3A 2RJ1A 5FTSA 3BRKX 2FYAA 2XWMA 3SXAA 1GX4A 5C3DA 4CJBA 1PZTA 3ZGFA 4C2SA 1ZJ0A 2RJ0A 4KNXA 3SXCA 1H5TB 4JD0A 2P72A 4ASYA 3QVBA 2I5EA 2PGVA 3DUVA 1FWYA 3K8EA 3I0HA 4LW3A 3U0YA 5CQNX 4Y7VA 3RSBA 3I0FA 4Y7FA 4KPZA 1FGGA 5DDTA 3K8DA 1MP4A 1YP4A 3T7OA 5CQMX 2O1HA 1ZCYA 5IDTA 3ST8A 2WGZA 1W77A 2D0JA 3I0LA 1TW1A 3CKQA 2WEEA 1FG5N 4MIXA 4B2WA 3HL3A 4KT7A 1HJJA 5C49A 1NF5B 1H4EA 4AAWA 2P6WA 4JISA 4D48A 1FO8A 1VH3A 2YESA 4P00A 2VS5A 2ICYA 4KC2A 4AC3A 2PX7A 4FCUA 2MZBA 3CKJA 1FR9A 3FWWA 3I0EA 1VZUA 5C4BA 1FOAA 1INJA 4EEOA 5D92A 1OQMB 3D8VA 4M4KA 2XMHA 2V0JA 1H5SC 1HM8A 3R2WA 2GGQA 1G9RA 3SXDA 1G1LA 3V0PA 1ZIZA 4ASJA 1LL0A 3V0LA 1GWVA 2Y4JA 3NGWA 2O1FA 3BCVA 1K4VA 1H3MA 1G93A 3U2VA 5AJPA 2AM4A 2ICXA 3U2WA 5C4DA 1R7TA 3U2UA 1GA8A 4B5BA 4MNDA 1V84A 1ON6A 2OI6A 3PNNA 1Z90A 1H5SA 1VPAA 1HJLA 5C1HA 3IOHA 1NWGB 4HG6A 2V0IA 3I0IX 5C4EA 3OH2A 2PA4A 3I0GA 2X60A 5FYEA 2JCJA 3CGXA 2XWLA 2A8WA 2V0HA 3EE5A 5C8RA 2WVLA 1JVGA 1MP3A 5CMHA 3TQDA 3O3PA 1LL3A 2RJ7A 4O6MA 4FRLA 1S4PA 4DDZA 4EVWA 5L6VA 2WVKA 1WT2A 3SX8A 3V91A 4Y63A 2AECA 2QKXA 3FOQA 4EEGA 1QGQA 4NANA 2AE7A 4B4BA 1E5KA 4FRQA 5C4CA 1MP5A 1JYKA 2VSIA 3USRA 5CQOA 3ZGGA 4HO6A 1ZI3A 2Z86A 1ZCTA 3JTJA 4KC1A 2BO6A 2RIXA 3TZTA 4KPXA 1G0RA 2RITA 1VGUA 4HO3A 4B3UA 2O1GA 2C0NA 4ARWA 2YCMA 4EE5A 1R7UA 3CKVA 4UEGA 2AM5A 4XWIA 3OKRA 1H7LA 3F1YA 1R7XA 4KRVA 1O7OA 1SS9A 1TW5A 4FREA 4FQWA 4YS8A 4Q7CA 4FIXA 5IDSA 4EE4A 1FXJA 1FR8A 1H5SD 2VK9A 3R3IA 1R82A 3DJ4A 3RMWA 1HM0A 3Q4SA 2BO4A 1NKHB 2ZU7A 2Y4LA 1LL2A 4HO0A 1FRWA 2JCKA 3GUEA 4G3QA 1LZ0A 4M28A 2RJ4A 1ZJPA 1OMXA 2JCOA 4AYJA 3SX5A 1VGWA 1LZJA 2QGIA 3OGZA 3OH1A 4EEMA 1GQCA 5L6SA 2Y4KA 4FROA 5CMFX 4FRMA 4FRHA 1VM8A 3Q7UA 3SXGA 2W0VA 3OAMA 3Q80A 3T7MA 1H5SB 4NAIA 1ZCUA 1G3LA 4D11C 4Y7UA 5EJZA 3SXBA 2VFZA 4DECA 4Y6NA 1MC3A 1OMZA 1G95A 1VZTA 4Y62A 4Y7GA 2YC5A 1ZI5A 1FZWA 4DE7A 2Q4JA 1R81A 4FRDA 4R7PA 3U2TA 1ZJ3A 1O0RA 3KIAA 4FRBA 1XZ6A 1ZHJA 1HM9A 1LZ7A 2OEGA 2AGDA 4LW6A 1H7FA 1ZJOA 4CJCA 1PZYB 1XHBA 2D7RA 2W0WA 1H5RA 1JYLA 3PKQA 5C4FA 1G2VA 1GWWA 1V82A 4D11A 4BMAA 4B4GA 1WT0A 4Y6UA 2ZU8A 3I0DA 1H7GA 1G97A 5C47A 1JVDA 4BQHA 3OH4A 3DK5A 1ZI1A 2E3DA 4Y9XA 1R7YA 2WVMA 1H7QA 4B42A 4M2AA 2FFUA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5FV9 A;  2YQS A;  4KXO A;  4NAK A;  1ZCV A;  4G87 A;  3V90 A;  5CMJ A;  3SX3 A;  5I1F A;  1H4D A;  2V0K A;  1S4N A;  2OI5 A;  4ECM A;  4L41 C;  1VGZ A;  5C1G A;  3USQ A;  3D98 A;  1INI A;  5FU0 A;  2VD4 A;  5CMG X;  2QH5 A;  2FYD B;  4NAL A;  4HO5 A;  5CMI A;  2DPW A;  3E25 A;  4KNR A;  5FU8 A;  2UX8 A;  1ZDF A;  2WAW A;  3POL A;  4MYB A;  3CU0 A;  3OC9 A;  2RJ5 A;  5CQL X;  5C3B A;  1FXO A;  1JV3 A;  1ZJ2 A;  3I0J A;  1HV9 A;  3E26 A;  2RJ9 A;  1ZDG A;  3JUJ A;  4HCQ A;  1VZX A;  2OI7 A;  1EZI A;  2RJ6 A;  2A8U A;  5J49 A;  1NQI B;  2Y6P A;  1TVY A;  3ZLL A;  5AJN A;  2D7I A;  2OEF A;  1WT3 A;  1QG8 A;  3F1C A;  2AES A;  4FCE A;  1NHE B;  5C1L A;  1G8O A;  1QGS A;  3JUK A;  1EYR A;  4D0T A;  4KC4 A;  3U0X A;  3N9W A;  2PGY A;  2Y4M A;  1H5T A;  1H7T A;  3V0O A;  1R7V A;  2RIZ A;  3V0M A;  2ZU9 A;  1ZI4 A;  4EEA A;  4Y64 A;  3ZLK A;  3CKN A;  3IOI A;  5C3A A;  4ZDQ A;  4D0Z A;  4HO8 A;  1NMM B;  4GBP A;  5AJO A;  1V83 A;  2GGO A;  2RJ8 A;  3V8Z A;  1LZI A;  3IOJ A;  2Z87 A;  1YP2 A;  2YQC A;  4KQL A;  3RMV A;  4HO2 A;  2I7B A;  2FFV A;  1ZJ1 A;  1H5R B;  2X5S A;  3ZF8 A;  4G3S A;  1H7H A;  4Y7T A;  2JCL A;  4CVH A;  4B2X A;  2VS4 A;  2YQH A;  3D5N A;  3V0Q A;  5JQQ A;  2X5Z A;  2RIY A;  3U2X A;  5HS2 A;  1IIN A;  4M2B A;  4IRQ A;  3V8Y A;  5CQP A;  3T7N A;  5DDV A;  1GX0 A;  2APC A;  1JV1 A;  4IRP A;  2XWN A;  1VIC A;  2FYC B;  5FTV A;  5BXC A;  1FO9 A;  2VSH A;  1O23 B;  5FUH A;  1WVC A;  2VXL A;  5C48 A;  1KWS A;  1S4O A;  1WT1 A;  1TZF A;  4FRP A;  4HO9 A;  4P02 A;  5IFY A;  1W57 A;  4J18 A;  4EE3 A;  4HO4 A;  2BO8 A;  1I52 A;  1LVW A;  3SXE A;  4G3P A;  1FGX A;  3LW6 A;  4CJ8 A;  1GQ9 A;  1VGT A;  2I5K A;  3V0N A;  4AYL A;  1H7E A;  1W55 A;  2E8B A;  4B4M A;  3SPT A;  4E1K A;  1QWJ A;  2FY7 A;  2NXV A;  2AH9 A;  2YQJ A;  1H4C A;  3I0K A;  3SX7 A;  5EIY A;  2BO7 A;  2V0L A;  3OH0 A;  2VXM A;  2YC3 A;  1G23 A;  2X65 A;  1YRO B;  3PKP A;  5C36 A;  5EJ1 A;  2AM3 A;  4K6R A;  2VS3 A;  1O7Q A;  4FRA A;  2CU2 A;  4HOC A;  2P73 A;  3I0C A;  2WE9 A;  2FYB A;  5C38 A;  2XME A;  2Y7A A;  1VH1 A;  1WSZ A;  1ON8 A;  1IIM A;  1YP3 A;  3CKO A;  1R80 A;  3OH3 A;  2RJ1 A;  5FTS A;  3BRK X;  2FYA A;  2XWM A;  3SXA A;  1GX4 A;  5C3D A;  4CJB A;  1PZT A;  3ZGF A;  4C2S A;  1ZJ0 A;  2RJ0 A;  4KNX A;  3SXC A;  1H5T B;  4JD0 A;  2P72 A;  4ASY A;  3QVB A;  2I5E A;  2PGV A;  3DUV A;  1FWY A;  3K8E A;  3I0H A;  4LW3 A;  3U0Y A;  5CQN X;  4Y7V A;  3RSB A;  3I0F A;  4Y7F A;  4KPZ A;  1FGG A;  5DDT A;  3K8D A;  1MP4 A;  1YP4 A;  3T7O A;  5CQM X;  2O1H A;  1ZCY A;  5IDT A;  3ST8 A;  2WGZ A;  1W77 A;  2D0J A;  3I0L A;  1TW1 A;  3CKQ A;  2WEE A;  1FG5 N;  4B2W A;  3HL3 A;  4KT7 A;  1HJJ A;  5C49 A;  1NF5 B;  1H4E A;  4AAW A;  2P6W A;  4JIS A;  4D48 A;  1FO8 A;  1VH3 A;  2YES A;  4P00 A;  2VS5 A;  2ICY A;  4KC2 A;  4AC3 A;  2PX7 A;  4FCU A;  2MZB A;  3CKJ A;  1FR9 A;  3FWW A;  3I0E A;  1VZU A;  5C4B A;  1FOA A;  1INJ A;  4EEO A;  1OQM B;  3D8V A;  4M4K A;  2XMH A;  2V0J A;  1H5S C;  1HM8 A;  3R2W A;  2GGQ A;  1G9R A;  3SXD A;  1G1L A;  3V0P A;  1ZIZ A;  4ASJ A;  1LL0 A;  3V0L A;  1GWV A;  2Y4J A;  3NGW A;  2O1F A;  3BCV A;  1K4V A;  1H3M A;  1G93 A;  3U2V A;  5AJP A;  2AM4 A;  2ICX A;  3U2W A;  5C4D A;  1R7T A;  3U2U A;  1GA8 A;  4B5B A;  4MND A;  1V84 A;  1ON6 A;  2OI6 A;  3PNN A;  1Z90 A;  1H5S A;  1VPA A;  1HJL A;  5C1H A;  3IOH A;  1NWG B;  4HG6 A;  2V0I A;  3I0I X;  5C4E A;  3OH2 A;  2PA4 A;  3I0G A;  2X60 A;  5FYE A;  2JCJ A;  2XWL A;  3CGX A;  2A8W A;  2V0H A;  3EE5 A;  5C8R A;  2WVL A;  1JVG A;  1MP3 A;  5CMH A;  3TQD A;  3O3P A;  1LL3 A;  2RJ7 A;  4FRL A;  1S4P A;  4DDZ A;  4EVW A;  5L6V A;  2WVK A;  1WT2 A;  3SX8 A;  3V91 A;  4Y63 A;  2AEC A;  2QKX A;  3FOQ A;  4EEG A;  1QGQ A;  4NAN A;  2AE7 A;  4B4B A;  1E5K A;  4FRQ A;  5C4C A;  1MP5 A;  1JYK A;  2VSI A;  3USR A;  5CQO A;  3ZGG A;  4HO6 A;  1ZI3 A;  2Z86 A;  1ZCT A;  3JTJ A;  4KC1 A;  2BO6 A;  2RIX A;  3TZT A;  4KPX A;  1G0R A;  2RIT A;  1VGU A;  4HO3 A;  4B3U A;  2O1G A;  4ARW A;  2YCM A;  4EE5 A;  1R7U A;  3CKV A;  4UEG A;  2AM5 A;  4XWI A;  3OKR A;  1H7L A;  3F1Y A;  1R7X A;  4KRV A;  1O7O A;  1SS9 A;  1TW5 A;  4FRE A;  4FQW A;  4YS8 A;  5IDS A;  4EE4 A;  1FXJ A;  1FR8 A;  1H5S D;  3R3I A;  1R82 A;  3DJ4 A;  3RMW A;  1HM0 A;  3Q4S A;  2BO4 A;  1NKH B;  2ZU7 A;  2Y4L A;  1LL2 A;  4HO0 A;  1FRW A;  2JCK A;  3GUE A;  4G3Q A;  1LZ0 A;  4M28 A;  2RJ4 A;  1ZJP A;  1OMX A;  2JCO A;  4AYJ A;  3SX5 A;  1VGW A;  1LZJ A;  2QGI A;  3OGZ A;  3OH1 A;  4EEM A;  1GQC A;  5L6S A;  2Y4K A;  4FRO A;  5CMF X;  4FRM A;  4FRH A;  1VM8 A;  3Q7U A;  3SXG A;  2W0V A;  3OAM A;  3Q80 A;  3T7M A;  1H5S B;  4NAI A;  1ZCU A;  1G3L A;  4D11 C;  4Y7U A;  5EJZ A;  3SXB A;  2VFZ A;  4DEC A;  4Y6N A;  1MC3 A;  1OMZ A;  1G95 A;  1VZT A;  4Y62 A;  4Y7G A;  2YC5 A;  1ZI5 A;  1FZW A;  4DE7 A;  2Q4J A;  1R81 A;  4FRD A;  4R7P A;  3U2T A;  1ZJ3 A;  1O0R A;  3KIA A;  4FRB A;  1XZ6 A;  1ZHJ A;  1HM9 A;  1LZ7 A;  2OEG A;  2AGD A;  4LW6 A;  1H7F A;  1ZJO A;  4CJC A;  1PZY B;  1XHB A;  2D7R A;  2W0W A;  1H5R A;  1JYL A;  3PKQ A;  5C4F A;  1G2V A;  1GWW A;  1V82 A;  4D11 A;  4BMA A;  4B4G A;  1WT0 A;  4Y6U A;  2ZU8 A;  3I0D A;  1H7G A;  1G97 A;  5C47 A;  1JVD A;  4BQH A;  3OH4 A;  3DK5 A;  1ZI1 A;  2E3D A;  4Y9X A;  1R7Y A;  2WVM A;  1H7Q A;  4B42 A;  4M2A A;  2FFU A; 
#chains in the Genus database with same CATH topology
 5FV9 A;  2YQS A;  4KXO A;  4NAK A;  1ZCV A;  4G87 A;  3V90 A;  5CMJ A;  3SX3 A;  5I1F A;  1H4D A;  2V0K A;  1S4N A;  2OI5 A;  4ECM A;  4L41 C;  1VGZ A;  5C1G A;  3USQ A;  3D98 A;  1INI A;  5FU0 A;  2VD4 A;  5CMG X;  2QH5 A;  2FYD B;  4NAL A;  4HO5 A;  5CMI A;  2DPW A;  3E25 A;  4KNR A;  5FU8 A;  2UX8 A;  4O6N A;  1ZDF A;  2WAW A;  3POL A;  4MYB A;  3CU0 A;  3OC9 A;  2RJ5 A;  5CQL X;  5C3B A;  1FXO A;  1JV3 A;  1ZJ2 A;  3I0J A;  1HV9 A;  3E26 A;  2RJ9 A;  1ZDG A;  3JUJ A;  4HCQ A;  1VZX A;  2OI7 A;  1EZI A;  2RJ6 A;  2A8U A;  5J49 A;  1NQI B;  2Y6P A;  1TVY A;  3ZLL A;  5AJN A;  2D7I A;  2OEF A;  1WT3 A;  1QG8 A;  3F1C A;  2AES A;  4FCE A;  1NHE B;  5C1L A;  1G8O A;  1QGS A;  3JUK A;  1EYR A;  4D0T A;  4KC4 A;  3U0X A;  3N9W A;  2PGY A;  2Y4M A;  1H5T A;  1H7T A;  3V0O A;  2J0A A;  1R7V A;  2RIZ A;  3V0M A;  2ZU9 A;  1ZI4 A;  4EEA A;  4Y64 A;  3ZLK A;  3CKN A;  3IOI A;  5C3A A;  4ZDQ A;  4D0Z A;  4HO8 A;  1NMM B;  4GBP A;  5AJO A;  1V83 A;  2GGO A;  2RJ8 A;  3V8Z A;  1LZI A;  3IOJ A;  2Z87 A;  2J0B A;  1YP2 A;  2YQC A;  4KQL A;  3RMV A;  4HO2 A;  2I7B A;  2FFV A;  1ZJ1 A;  1H5R B;  2X5S A;  3ZF8 A;  4G3S A;  1H7H A;  4Y7T A;  2JCL A;  4CVH A;  4B2X A;  2VS4 A;  2YQH A;  3D5N A;  3V0Q A;  5JQQ A;  2X5Z A;  2RIY A;  3U2X A;  4FIY A;  5HS2 A;  1IIN A;  4M2B A;  4IRQ A;  3V8Y A;  5CQP A;  3T7N A;  5DDV A;  1GX0 A;  2APC A;  1JV1 A;  4IRP A;  2XWN A;  1VIC A;  2FYC B;  5FTV A;  5BXC A;  1FO9 A;  2VSH A;  1O23 B;  5FUH A;  1WVC A;  2VXL A;  5C48 A;  1KWS A;  1S4O A;  1WT1 A;  1TZF A;  4FRP A;  4HO9 A;  4P02 A;  5IFY A;  1W57 A;  4J18 A;  4EE3 A;  4HO4 A;  2BO8 A;  1I52 A;  1LVW A;  3SXE A;  4G3P A;  1FGX A;  3LW6 A;  4CJ8 A;  1GQ9 A;  1VGT A;  2I5K A;  3V0N A;  4AYL A;  1H7E A;  1W55 A;  2E8B A;  4B4M A;  3SPT A;  4E1K A;  1QWJ A;  2FY7 A;  2NXV A;  2AH9 A;  2YQJ A;  1H4C A;  3I0K A;  3SX7 A;  5EIY A;  2BO7 A;  2V0L A;  3OH0 A;  2VXM A;  2YC3 A;  1G23 A;  2X65 A;  1YRO B;  3PKP A;  5C36 A;  5EJ1 A;  2AM3 A;  4K6R A;  2VS3 A;  1O7Q A;  4FRA A;  2CU2 A;  4HOC A;  2P73 A;  3I0C A;  2WE9 A;  2FYB A;  5D91 A;  5C38 A;  2XME A;  2Y7A A;  1VH1 A;  1WSZ A;  1ON8 A;  1IIM A;  1YP3 A;  3CKO A;  1R80 A;  3OH3 A;  2RJ1 A;  5FTS A;  3BRK X;  2FYA A;  2XWM A;  3SXA A;  1GX4 A;  5C3D A;  4CJB A;  1PZT A;  3ZGF A;  4C2S A;  1ZJ0 A;  2RJ0 A;  4KNX A;  3SXC A;  1H5T B;  4JD0 A;  2P72 A;  4ASY A;  3QVB A;  2I5E A;  2PGV A;  3DUV A;  1FWY A;  3K8E A;  3I0H A;  4LW3 A;  3U0Y A;  5CQN X;  4Y7V A;  3RSB A;  3I0F A;  4Y7F A;  4KPZ A;  1FGG A;  5DDT A;  3K8D A;  1MP4 A;  1YP4 A;  3T7O A;  5CQM X;  2O1H A;  1ZCY A;  5IDT A;  3ST8 A;  2WGZ A;  1W77 A;  2D0J A;  3I0L A;  1TW1 A;  3CKQ A;  2WEE A;  1FG5 N;  4MIX A;  4B2W A;  3HL3 A;  4KT7 A;  1HJJ A;  5C49 A;  1NF5 B;  1H4E A;  4AAW A;  2P6W A;  4JIS A;  4D48 A;  1FO8 A;  1VH3 A;  2YES A;  4P00 A;  2VS5 A;  2ICY A;  4KC2 A;  4AC3 A;  2PX7 A;  4FCU A;  2MZB A;  3CKJ A;  1FR9 A;  3FWW A;  3I0E A;  1VZU A;  5C4B A;  1FOA A;  1INJ A;  4EEO A;  5D92 A;  1OQM B;  3D8V A;  4M4K A;  2XMH A;  2V0J A;  1H5S C;  1HM8 A;  3R2W A;  2GGQ A;  1G9R A;  3SXD A;  1G1L A;  3V0P A;  1ZIZ A;  4ASJ A;  1LL0 A;  3V0L A;  1GWV A;  2Y4J A;  3NGW A;  2O1F A;  3BCV A;  1K4V A;  1H3M A;  1G93 A;  3U2V A;  5AJP A;  2AM4 A;  2ICX A;  3U2W A;  5C4D A;  1R7T A;  3U2U A;  1GA8 A;  4B5B A;  4MND A;  1V84 A;  1ON6 A;  2OI6 A;  3PNN A;  1Z90 A;  1H5S A;  1VPA A;  1HJL A;  5C1H A;  3IOH A;  1NWG B;  4HG6 A;  2V0I A;  3I0I X;  5C4E A;  3OH2 A;  2PA4 A;  3I0G A;  2X60 A;  5FYE A;  2JCJ A;  3CGX A;  2XWL A;  2A8W A;  2V0H A;  3EE5 A;  5C8R A;  2WVL A;  1JVG A;  1MP3 A;  5CMH A;  3TQD A;  3O3P A;  1LL3 A;  2RJ7 A;  4O6M A;  4FRL A;  1S4P A;  4DDZ A;  4EVW A;  5L6V A;  2WVK A;  1WT2 A;  3SX8 A;  3V91 A;  4Y63 A;  2AEC A;  2QKX A;  3FOQ A;  4EEG A;  1QGQ A;  4NAN A;  2AE7 A;  4B4B A;  1E5K A;  4FRQ A;  5C4C A;  1MP5 A;  1JYK A;  2VSI A;  3USR A;  5CQO A;  3ZGG A;  4HO6 A;  1ZI3 A;  2Z86 A;  1ZCT A;  3JTJ A;  4KC1 A;  2BO6 A;  2RIX A;  3TZT A;  4KPX A;  1G0R A;  2RIT A;  1VGU A;  4HO3 A;  4B3U A;  2O1G A;  2C0N A;  4ARW A;  2YCM A;  4EE5 A;  1R7U A;  3CKV A;  4UEG A;  2AM5 A;  4XWI A;  3OKR A;  1H7L A;  3F1Y A;  1R7X A;  4KRV A;  1O7O A;  1SS9 A;  1TW5 A;  4FRE A;  4FQW A;  4YS8 A;  4Q7C A;  4FIX A;  5IDS A;  4EE4 A;  1FXJ A;  1FR8 A;  1H5S D;  2VK9 A;  3R3I A;  1R82 A;  3DJ4 A;  3RMW A;  1HM0 A;  3Q4S A;  2BO4 A;  1NKH B;  2ZU7 A;  2Y4L A;  1LL2 A;  4HO0 A;  1FRW A;  2JCK A;  3GUE A;  4G3Q A;  1LZ0 A;  4M28 A;  2RJ4 A;  1ZJP A;  1OMX A;  2JCO A;  4AYJ A;  3SX5 A;  1VGW A;  1LZJ A;  2QGI A;  3OGZ A;  3OH1 A;  4EEM A;  1GQC A;  5L6S A;  2Y4K A;  4FRO A;  5CMF X;  4FRM A;  4FRH A;  1VM8 A;  3Q7U A;  3SXG A;  2W0V A;  3OAM A;  3Q80 A;  3T7M A;  1H5S B;  4NAI A;  1ZCU A;  1G3L A;  4D11 C;  4Y7U A;  5EJZ A;  3SXB A;  2VFZ A;  4DEC A;  4Y6N A;  1MC3 A;  1OMZ A;  1G95 A;  1VZT A;  4Y62 A;  4Y7G A;  2YC5 A;  1ZI5 A;  1FZW A;  4DE7 A;  2Q4J A;  1R81 A;  4FRD A;  4R7P A;  3U2T A;  1ZJ3 A;  1O0R A;  3KIA A;  4FRB A;  1XZ6 A;  1ZHJ A;  1HM9 A;  1LZ7 A;  2OEG A;  2AGD A;  4LW6 A;  1H7F A;  1ZJO A;  4CJC A;  1PZY B;  1XHB A;  2D7R A;  2W0W A;  1H5R A;  1JYL A;  3PKQ A;  5C4F A;  1G2V A;  1GWW A;  1V82 A;  4D11 A;  4BMA A;  4B4G A;  1WT0 A;  4Y6U A;  2ZU8 A;  3I0D A;  1H7G A;  1G97 A;  5C47 A;  1JVD A;  4BQH A;  3OH4 A;  3DK5 A;  1ZI1 A;  2E3D A;  4Y9X A;  1R7Y A;  2WVM A;  1H7Q A;  4B42 A;  4M2A A;  2FFU A; 
#chains in the Genus database with same CATH homology
 5FV9 A;  2YQS A;  4KXO A;  4NAK A;  1ZCV A;  4G87 A;  3V90 A;  5CMJ A;  3SX3 A;  5I1F A;  1H4D A;  2V0K A;  1S4N A;  2OI5 A;  4ECM A;  4L41 C;  1VGZ A;  5C1G A;  3USQ A;  3D98 A;  1INI A;  5FU0 A;  2VD4 A;  5CMG X;  2QH5 A;  2FYD B;  4NAL A;  4HO5 A;  5CMI A;  2DPW A;  3E25 A;  4KNR A;  5FU8 A;  2UX8 A;  4O6N A;  1ZDF A;  2WAW A;  3POL A;  4MYB A;  3CU0 A;  3OC9 A;  2RJ5 A;  5CQL X;  5C3B A;  1FXO A;  1JV3 A;  1ZJ2 A;  3I0J A;  1HV9 A;  3E26 A;  2RJ9 A;  1ZDG A;  3JUJ A;  4HCQ A;  1VZX A;  2OI7 A;  1EZI A;  2RJ6 A;  2A8U A;  5J49 A;  1NQI B;  2Y6P A;  1TVY A;  3ZLL A;  5AJN A;  2D7I A;  2OEF A;  1WT3 A;  1QG8 A;  3F1C A;  2AES A;  4FCE A;  1NHE B;  5C1L A;  1G8O A;  1QGS A;  3JUK A;  1EYR A;  4D0T A;  4KC4 A;  3U0X A;  3N9W A;  2PGY A;  2Y4M A;  1H5T A;  1H7T A;  3V0O A;  2J0A A;  1R7V A;  2RIZ A;  3V0M A;  2ZU9 A;  1ZI4 A;  4EEA A;  4Y64 A;  3ZLK A;  3CKN A;  3IOI A;  5C3A A;  4ZDQ A;  4D0Z A;  4HO8 A;  1NMM B;  4GBP A;  5AJO A;  1V83 A;  2GGO A;  2RJ8 A;  3V8Z A;  1LZI A;  3IOJ A;  2Z87 A;  2J0B A;  1YP2 A;  2YQC A;  4KQL A;  3RMV A;  4HO2 A;  2I7B A;  2FFV A;  1ZJ1 A;  1H5R B;  2X5S A;  3ZF8 A;  4G3S A;  1H7H A;  4Y7T A;  2JCL A;  4CVH A;  4B2X A;  2VS4 A;  2YQH A;  3D5N A;  3V0Q A;  5JQQ A;  2X5Z A;  2RIY A;  3U2X A;  4FIY A;  5HS2 A;  1IIN A;  4M2B A;  4IRQ A;  3V8Y A;  5CQP A;  3T7N A;  5DDV A;  1GX0 A;  2APC A;  1JV1 A;  4IRP A;  2XWN A;  1VIC A;  2FYC B;  5FTV A;  5BXC A;  1FO9 A;  2VSH A;  1O23 B;  5FUH A;  1WVC A;  2VXL A;  5C48 A;  1KWS A;  1S4O A;  1WT1 A;  1TZF A;  4FRP A;  4HO9 A;  4P02 A;  5IFY A;  1W57 A;  4J18 A;  4EE3 A;  4HO4 A;  2BO8 A;  1I52 A;  1LVW A;  3SXE A;  4G3P A;  1FGX A;  3LW6 A;  4CJ8 A;  1GQ9 A;  1VGT A;  2I5K A;  3V0N A;  4AYL A;  1H7E A;  1W55 A;  2E8B A;  4B4M A;  3SPT A;  4E1K A;  1QWJ A;  2FY7 A;  2NXV A;  2AH9 A;  2YQJ A;  1H4C A;  3I0K A;  3SX7 A;  5EIY A;  2BO7 A;  2V0L A;  3OH0 A;  2VXM A;  2YC3 A;  1G23 A;  2X65 A;  1YRO B;  3PKP A;  5C36 A;  5EJ1 A;  2AM3 A;  4K6R A;  2VS3 A;  1O7Q A;  4FRA A;  2CU2 A;  4HOC A;  2P73 A;  3I0C A;  2WE9 A;  2FYB A;  5D91 A;  5C38 A;  2XME A;  2Y7A A;  1VH1 A;  1WSZ A;  1ON8 A;  1IIM A;  1YP3 A;  3CKO A;  1R80 A;  3OH3 A;  2RJ1 A;  5FTS A;  3BRK X;  2FYA A;  2XWM A;  3SXA A;  1GX4 A;  5C3D A;  4CJB A;  1PZT A;  3ZGF A;  4C2S A;  1ZJ0 A;  2RJ0 A;  4KNX A;  3SXC A;  1H5T B;  4JD0 A;  2P72 A;  4ASY A;  3QVB A;  2I5E A;  2PGV A;  3DUV A;  1FWY A;  3K8E A;  3I0H A;  4LW3 A;  3U0Y A;  5CQN X;  4Y7V A;  3RSB A;  3I0F A;  4Y7F A;  4KPZ A;  1FGG A;  5DDT A;  3K8D A;  1MP4 A;  1YP4 A;  3T7O A;  5CQM X;  2O1H A;  1ZCY A;  5IDT A;  3ST8 A;  2WGZ A;  1W77 A;  2D0J A;  3I0L A;  1TW1 A;  3CKQ A;  2WEE A;  1FG5 N;  4MIX A;  4B2W A;  3HL3 A;  4KT7 A;  1HJJ A;  5C49 A;  1NF5 B;  1H4E A;  4AAW A;  2P6W A;  4JIS A;  4D48 A;  1FO8 A;  1VH3 A;  2YES A;  4P00 A;  2VS5 A;  2ICY A;  4KC2 A;  4AC3 A;  2PX7 A;  4FCU A;  2MZB A;  3CKJ A;  1FR9 A;  3FWW A;  3I0E A;  1VZU A;  5C4B A;  1FOA A;  1INJ A;  4EEO A;  5D92 A;  1OQM B;  3D8V A;  4M4K A;  2XMH A;  2V0J A;  1H5S C;  1HM8 A;  3R2W A;  2GGQ A;  1G9R A;  3SXD A;  1G1L A;  3V0P A;  1ZIZ A;  4ASJ A;  1LL0 A;  3V0L A;  1GWV A;  2Y4J A;  3NGW A;  2O1F A;  3BCV A;  1K4V A;  1H3M A;  1G93 A;  3U2V A;  5AJP A;  2AM4 A;  2ICX A;  3U2W A;  5C4D A;  1R7T A;  3U2U A;  1GA8 A;  4B5B A;  4MND A;  1V84 A;  1ON6 A;  2OI6 A;  3PNN A;  1Z90 A;  1H5S A;  1VPA A;  1HJL A;  5C1H A;  3IOH A;  1NWG B;  4HG6 A;  2V0I A;  3I0I X;  5C4E A;  3OH2 A;  2PA4 A;  3I0G A;  2X60 A;  5FYE A;  2JCJ A;  3CGX A;  2XWL A;  2A8W A;  2V0H A;  3EE5 A;  5C8R A;  2WVL A;  1JVG A;  1MP3 A;  5CMH A;  3TQD A;  3O3P A;  1LL3 A;  2RJ7 A;  4O6M A;  4FRL A;  1S4P A;  4DDZ A;  4EVW A;  5L6V A;  2WVK A;  1WT2 A;  3SX8 A;  3V91 A;  4Y63 A;  2AEC A;  2QKX A;  3FOQ A;  4EEG A;  1QGQ A;  4NAN A;  2AE7 A;  4B4B A;  1E5K A;  4FRQ A;  5C4C A;  1MP5 A;  1JYK A;  2VSI A;  3USR A;  5CQO A;  3ZGG A;  4HO6 A;  1ZI3 A;  2Z86 A;  1ZCT A;  3JTJ A;  4KC1 A;  2BO6 A;  2RIX A;  3TZT A;  4KPX A;  1G0R A;  2RIT A;  1VGU A;  4HO3 A;  4B3U A;  2O1G A;  2C0N A;  4ARW A;  2YCM A;  4EE5 A;  1R7U A;  3CKV A;  4UEG A;  2AM5 A;  4XWI A;  3OKR A;  1H7L A;  3F1Y A;  1R7X A;  4KRV A;  1O7O A;  1SS9 A;  1TW5 A;  4FRE A;  4FQW A;  4YS8 A;  4Q7C A;  4FIX A;  5IDS A;  4EE4 A;  1FXJ A;  1FR8 A;  1H5S D;  2VK9 A;  3R3I A;  1R82 A;  3DJ4 A;  3RMW A;  1HM0 A;  3Q4S A;  2BO4 A;  1NKH B;  2ZU7 A;  2Y4L A;  1LL2 A;  4HO0 A;  1FRW A;  2JCK A;  3GUE A;  4G3Q A;  1LZ0 A;  4M28 A;  2RJ4 A;  1ZJP A;  1OMX A;  2JCO A;  4AYJ A;  3SX5 A;  1VGW A;  1LZJ A;  2QGI A;  3OGZ A;  3OH1 A;  4EEM A;  1GQC A;  5L6S A;  2Y4K A;  4FRO A;  5CMF X;  4FRM A;  4FRH A;  1VM8 A;  3Q7U A;  3SXG A;  2W0V A;  3OAM A;  3Q80 A;  3T7M A;  1H5S B;  4NAI A;  1ZCU A;  1G3L A;  4D11 C;  4Y7U A;  5EJZ A;  3SXB A;  2VFZ A;  4DEC A;  4Y6N A;  1MC3 A;  1OMZ A;  1G95 A;  1VZT A;  4Y62 A;  4Y7G A;  2YC5 A;  1ZI5 A;  1FZW A;  4DE7 A;  2Q4J A;  1R81 A;  4FRD A;  4R7P A;  3U2T A;  1ZJ3 A;  1O0R A;  3KIA A;  4FRB A;  1XZ6 A;  1ZHJ A;  1HM9 A;  1LZ7 A;  2OEG A;  2AGD A;  4LW6 A;  1H7F A;  1ZJO A;  4CJC A;  1PZY B;  1XHB A;  2D7R A;  2W0W A;  1H5R A;  1JYL A;  3PKQ A;  5C4F A;  1G2V A;  1GWW A;  1V82 A;  4D11 A;  4BMA A;  4B4G A;  1WT0 A;  4Y6U A;  2ZU8 A;  3I0D A;  1H7G A;  1G97 A;  5C47 A;  1JVD A;  4BQH A;  3OH4 A;  3DK5 A;  1ZI1 A;  2E3D A;  4Y9X A;  1R7Y A;  2WVM A;  1H7Q A;  4B42 A;  4M2A A;  2FFU A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...