4FRMA

Crystal structure of bbbb+udp+gal at ph 7.0 with mpd as the cryoprotectant
Total Genus 81
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
81
sequence length
275
structure length
264
Chain Sequence
YPQPKVLTPCRKDVLVVTPWLAPIVWEGTFNIDILNEQFRLQNTTIGLTVFAIKKYVAFLKLFLETAEKHFMVGHRVHYYVFTDQPAAVPRVTLGTGRQLSVLEVGRRMEMISGCERRFLSEVDYLVCVDVDMEFRDHVGVEILTPLFGTLHPSFYGSSREAFTYERRPQSQAYIPKDEGDFYYMGAFFGGSVQEVQRLTRACHQAMMVDQANGIEAVWHDESHLNKYLLRHKPTKVLSPEYLWDQQLLGWPAVLRKLRFTAVP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Histo-blood group ABO system transferase
publication title pH-induced conformational changes in human ABO(H) blood group glycosyltransferases confirm the importance of electrostatic interactions in the formation of the semi-closed state.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 81
structure length 264
sequence length 275
ec nomenclature ec 2.4.1.37: Fucosylgalactoside 3-alpha-galactosyltransferase.
pdb deposition date 2012-06-26
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.550.10 Alpha Beta Alpha-Beta Complex Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A 4frmA00
3ZLKA 4KRVA 1ZDFA 2BO7A 5EJ1A 4KPZA 5BXCA 4Y63A 2PA4A 4EEMA 4KQLA 1INJA 2JCOA 1NMMB 2VXLA 4Y7GA 4HO8A 3V90A 1LZ7A 1ON6A 4E1KA 1H4CA 3DUVA 2I5EA 1ZHJA 3BCVA 3N9WA 5EJZA 4FRBA 1VZXA 4P00A 3F1YA 2AECA 3JUJA 2V0HA 4AYLA 4B5BA 3TZTA 4BMAA 1WT1A 1G23A 1LVWA 2W0WA 3R2WA 3V91A 1O7QA 1XZ6A 5CMHA 3HL3A 1H5RB 1GQ9A 2RIZA 5J49A 2YCMA 4CJCA 3GUEA 3CKJA 3U0XA 2VSIA 5EIYA 4ARWA 3OH0A 2V0IA 3SX5A 1ZJ1A 2WEEA 5C47A 4B2XA 1R7VA 3IOHA 1GQCA 2PGYA 2ZU9A 3V0OA 4IRQA 1WVCA 4DECA 1NHEB 5C4CA 5FUHA 2VFZA 1LL2A 2XMHA 3JUKA 3U2WA 1S4NA 2V0KA 3SXCA 5IDTA 1IIMA 2XWNA 1O23B 2YQHA 5CQLX 3SX8A 1GWVA 2E8BA 1KWSA 1ZJPA 2VS5A 1ZCYA 2NXVA 4BQHA 4HO9A 4P02A 5C4FA 4Y7TA 3U2UA 4KC4A 2I5KA 3Q80A 3I0GA 2AE7A 4EE3A 5CMJA 1VZTA 1Z90A 5C1GA 5FV9A 2FFUA 2FYDB 3SXEA 3I0CA 1G97A 5AJPA 3NGWA 1H5TA 3E25A 1LL3A 4D48A 3POLA 4IRPA 1ZDGA 1H7TA 4ECMA 4KC2A 3ZF8A 1FR8A 3V0PA 4Y9XA 3CU0A 4ZDQA 2RJ7A 1ZI1A 2FFVA 1TW1A 2Y7AA 3SXBA 1HM9A 2FYAA 1YP2A 1TVYA 4M2AA 5DDVA 1MC3A 4UEGA 4Y7FA 4ASJA 4XWIA 1HJJA 2D7RA 4CJ8A 2A8UA 2RJ5A 3U2VA 1E5KA 1JVGA 4B4MA 3O3PA 1S4PA 2UX8A 4FREA 4B3UA 3OH3A 2RJ0A 4C2SA 2D7IA 5C3AA 2QKXA 1QGSA 2Y4MA 1NWGB 1MP4A 1S4OA 1VM8A 1WSZA 4LW3A 2X5ZA 1INIA 1FXOA 5C48A 1FR9A 1SS9A 4FRMA 3U0YA 1G93A 4FRQA 4D11C 2RJ8A 5C4EA 2YQSA 4FCUA 4M4KA 3USQA 4FRAA 1H5SA 4B2WA 1MP3A 1YP3A 2GGQA 3T7NA 4FQWA 3SPTA 4CJBA 2ICYA 1G8OA 3DJ4A 1FZWA 3SXDA 4FRDA 2RIXA 1FGXA 2FYCB 2WE9A 2AESA 2W0VA 4HO5A 5FTVA 1QGQA 2RIYA 2VXMA 2ZU7A 2V0LA 2WVMA 2DPWA 5C1HA 1O7OA 4D0TA 4HO3A 4R7PA 1O0RA 1FO9A 1V83A 1H7EA 1GA8A 1NQIB 3K8DA 3IOIA 4KXOA 3I0HA 1R7XA 3PKQA 1HM8A 3Q7UA 3OKRA 3V0NA 2CU2A 2RJ1A 4EE4A 3FOQA 3ZGFA 1FXJA 2O1GA 4FROA 4Y7VA 4CVHA 5C4BA 3ZGGA 5CQPA 4HOCA 1ZCVA 4B4GA 1LZJA 3PNNA 1ZIZA 3USRA 1EZIA 4KNXA 5L6VA 2PX7A 4EVWA 3IOJA 5FU0A 2RJ9A 4B42A 2AM3A 1XHBA 1R7UA 3T7OA 1H5RA 4KNRA 1GX4A 3T7MA 4LW6A 1GX0A 2Z86A 3EE5A 5I1FA 1H7FA 3CKVA 1VGWA 2OEFA 4KPXA 1H7HA 5FU8A 2OI5A 2YESA 5C38A 2Y4LA 4G3QA 2YC3A 1LZ0A 5FYEA 3RMWA 2AM4A 4J18A 1VZUA 4MNDA 1H7GA 3R3IA 1G95A 1YROB 2P6WA 4HO6A 2PGVA 3OH4A 1VGZA 4G87A 1IINA 1HJLA 5IFYA 3SX3A 3I0EA 3I0JA 2GGOA 1G0RA 1ZI5A 1H7LA 5C8RA 2D0JA 5CQOA 4K6RA 5HS2A 2OI7A 3CGXA 5CMGX 1ZCTA 2WVLA 2ZU8A 5C36A 3I0FA 2MZBA 2JCJA 3OH1A 2XWMA 3I0DA 2P72A 4AC3A 5L6SA 2Q4JA 2YQJA 2VSHA 2RITA 2YQCA 1FWYA 2X5SA 2JCKA 2YC5A 4D11A 5CMIA 4Y62A 1FG5N 2V0JA 1OMZA 1TZFA 1VPAA 2WVKA 1K4VA 1JV1A 3RSBA 3I0KA 1HM0A 1ZJ2A 1ZCUA 3DK5A 4GBPA 1QG8A 1FOAA 2O1FA 2XMEA 1FO8A 2OI6A 4DE7A 2WAWA 1ZJ0A 4KT7A 1R81A 4M2BA 3OAMA 4Y6UA 1VH3A 2FYBA 2VS3A 1ZI4A 3QVBA 4ASYA 3U2XA 2RJ6A 3CKQA 3PKPA 3V8YA 2O1HA 4B4BA 3ST8A 2Y4JA 2APCA 1JYLA 2ICXA 5C1LA 5CQNX 1FRWA 4YS8A 2I7BA 4G3SA 5C3DA 3RMVA 4HO4A 2Z87A 3V8ZA 4HO0A 1W55A 3Q4SA 1JV3A 1H5SD 1WT2A 1V84A 2X60A 1G2VA 2AGDA 4M28A 4EEGA 1H5SC 4NAIA 4DDZA 1VGUA 3D98A 5JQQA 4D0ZA 1WT3A 1JYKA 1PZYB 1R80A 1ZI3A 1VH1A 4FRPA 2AH9A 2A8WA 4AAWA 2BO4A 3CKOA 1LZIA 1LL0A 4FCEA 2OEGA 2XWLA 4L41C 3ZLLA 5CQMX 1V82A 5AJOA 4Y6NA 1TW5A 3KIAA 3U2TA 1H3MA 1W77A 1R7TA 1H5TB 1I52A 2X65A 1PZTA 2WGZA 3E26A 1OQMB 5C4DA 4FRHA 4Y64A 1ZJOA 3OGZA 1MP5A 2Y6PA 4HO2A 5C49A 1NF5B 4AYJA 3JTJA 1VGTA 4JISA 4NAKA 2VD4A 1QWJA 1W57A 4EEAA 1EYRA 1G9RA 4JD0A 1YP4A 2E3DA 2P73A 1G3LA 1NKHB 4EE5A 3BRKX 3SX7A 3OH2A 2QH5A 1HV9A 3CKNA 3I0IX 3SXGA 5DDTA 1OMXA 2Y4KA 5IDSA 3SXAA 4HG6A 2FY7A 1ZJ3A 1GWWA 3D8VA 5FTSA 3V0LA 5AJNA 3F1CA 1H4DA 1H4EA 3LW6A 1R7YA 2BO8A 1WT0A 2QGIA 4MYBA 3FWWA 4Y7UA 5C3BA 2JCLA 1ON8A 1R82A 3V0QA 1G1LA 3I0LA 1H5SB 2BO6A 2RJ4A 4KC1A 3V0MA 4NALA 4G3PA 5CMFX 3K8EA 4NANA 4HCQA 2AM5A 2VS4A 4FRLA 3TQDA 4EEOA 3D5NA 3OC9A 1H7QA 1JVDA 1FGGA 1VICA
chains in the Genus database with same CATH superfamily
3ZLKA 4KRVA 1ZDFA 2BO7A 5EJ1A 4KPZA 2J0BA 5BXCA 4Y63A 2PA4A 4EEMA 4KQLA 1INJA 2JCOA 1NMMB 2VXLA 4Y7GA 4HO8A 3V90A 1LZ7A 1ON6A 4E1KA 1H4CA 3DUVA 2I5EA 1ZHJA 3BCVA 3N9WA 5EJZA 4FRBA 1VZXA 4P00A 3F1YA 2AECA 3JUJA 2V0HA 4AYLA 4B5BA 3TZTA 4BMAA 1WT1A 1G23A 1LVWA 2W0WA 3R2WA 3V91A 1O7QA 1XZ6A 5CMHA 3HL3A 1H5RB 1GQ9A 2RIZA 5J49A 2YCMA 4CJCA 3GUEA 3CKJA 3U0XA 2VSIA 5EIYA 4ARWA 3OH0A 2V0IA 3SX5A 4O6NA 1ZJ1A 2WEEA 5C47A 4B2XA 1R7VA 3IOHA 1GQCA 2PGYA 2ZU9A 3V0OA 4IRQA 1WVCA 4DECA 1NHEB 5C4CA 5FUHA 2VFZA 1LL2A 2XMHA 3JUKA 3U2WA 1S4NA 2V0KA 3SXCA 5IDTA 1IIMA 2XWNA 1O23B 2YQHA 5CQLX 3SX8A 1GWVA 2E8BA 1KWSA 1ZJPA 2VS5A 1ZCYA 2NXVA 4BQHA 4HO9A 4P02A 5C4FA 4Y7TA 3U2UA 4KC4A 2I5KA 3Q80A 3I0GA 2AE7A 4EE3A 5CMJA 1VZTA 1Z90A 5C1GA 5FV9A 2FFUA 2FYDB 3SXEA 3I0CA 1G97A 5AJPA 3NGWA 1H5TA 3E25A 2J0AA 1LL3A 4D48A 3POLA 4IRPA 1ZDGA 1H7TA 4ECMA 4KC2A 3ZF8A 1FR8A 3V0PA 4Y9XA 3CU0A 4ZDQA 2RJ7A 1ZI1A 2FFVA 1TW1A 2Y7AA 4Q7CA 3SXBA 5D91A 1HM9A 2FYAA 1YP2A 1TVYA 4M2AA 5DDVA 1MC3A 4UEGA 4Y7FA 4ASJA 4XWIA 1HJJA 2D7RA 4CJ8A 2A8UA 2RJ5A 3U2VA 1E5KA 1JVGA 4B4MA 3O3PA 1S4PA 2UX8A 4FREA 4B3UA 3OH3A 2RJ0A 4C2SA 2D7IA 5C3AA 2QKXA 1QGSA 2Y4MA 1NWGB 1MP4A 1S4OA 1VM8A 1WSZA 4LW3A 2X5ZA 1INIA 1FXOA 5C48A 1FR9A 1SS9A 4FRMA 3U0YA 1G93A 4FRQA 4D11C 2RJ8A 5C4EA 2YQSA 4FCUA 4M4KA 3USQA 4FRAA 1H5SA 4B2WA 1MP3A 1YP3A 2GGQA 3T7NA 4FQWA 3SPTA 4CJBA 2ICYA 1G8OA 3DJ4A 1FZWA 3SXDA 4FRDA 2RIXA 1FGXA 2FYCB 2WE9A 2AESA 2W0VA 4HO5A 5FTVA 1QGQA 2RIYA 2VXMA 2ZU7A 2V0LA 2WVMA 2DPWA 5C1HA 1O7OA 4D0TA 4HO3A 4R7PA 1O0RA 1FO9A 1V83A 1H7EA 1GA8A 1NQIB 3K8DA 3IOIA 4KXOA 3I0HA 1R7XA 3PKQA 1HM8A 3Q7UA 3OKRA 3V0NA 2CU2A 2RJ1A 4EE4A 3FOQA 3ZGFA 1FXJA 2O1GA 4FROA 4Y7VA 4CVHA 5C4BA 3ZGGA 5CQPA 4HOCA 1ZCVA 4B4GA 1LZJA 3PNNA 1ZIZA 3USRA 1EZIA 4KNXA 5L6VA 2PX7A 4EVWA 3IOJA 5FU0A 2RJ9A 4B42A 2AM3A 1XHBA 1R7UA 3T7OA 1H5RA 4KNRA 1GX4A 3T7MA 4LW6A 1GX0A 2Z86A 3EE5A 5I1FA 1H7FA 3CKVA 1VGWA 2OEFA 4KPXA 1H7HA 5FU8A 2OI5A 2YESA 5C38A 2Y4LA 4G3QA 2YC3A 1LZ0A 5FYEA 3RMWA 2AM4A 4J18A 1VZUA 4MNDA 1H7GA 3R3IA 1G95A 1YROB 2P6WA 4HO6A 2PGVA 3OH4A 1VGZA 4G87A 1IINA 1HJLA 5IFYA 3SX3A 3I0EA 3I0JA 2GGOA 1G0RA 1ZI5A 1H7LA 5C8RA 2D0JA 5CQOA 4K6RA 5HS2A 2OI7A 3CGXA 4O6MA 5CMGX 1ZCTA 2WVLA 2ZU8A 5C36A 3I0FA 2MZBA 2JCJA 3OH1A 2XWMA 3I0DA 2P72A 4AC3A 5L6SA 2Q4JA 2YQJA 2VSHA 2RITA 2YQCA 1FWYA 2X5SA 2JCKA 2YC5A 4D11A 5CMIA 4Y62A 1FG5N 2V0JA 1OMZA 1TZFA 1VPAA 2WVKA 1K4VA 1JV1A 3RSBA 3I0KA 1HM0A 1ZJ2A 1ZCUA 4FIYA 3DK5A 4GBPA 1QG8A 1FOAA 2O1FA 2XMEA 1FO8A 2OI6A 4DE7A 2WAWA 1ZJ0A 4KT7A 1R81A 4M2BA 3OAMA 4Y6UA 1VH3A 2FYBA 2VS3A 1ZI4A 3QVBA 4ASYA 3U2XA 2RJ6A 3CKQA 3PKPA 3V8YA 2O1HA 4B4BA 3ST8A 2Y4JA 2APCA 1JYLA 2ICXA 5C1LA 5CQNX 1FRWA 4YS8A 2I7BA 4G3SA 5C3DA 3RMVA 4HO4A 2Z87A 3V8ZA 4HO0A 1W55A 3Q4SA 1JV3A 1H5SD 1WT2A 1V84A 2X60A 1G2VA 2AGDA 4M28A 4EEGA 1H5SC 4NAIA 4DDZA 1VGUA 3D98A 5JQQA 4D0ZA 1WT3A 1JYKA 1PZYB 1R80A 1ZI3A 1VH1A 4FRPA 2AH9A 2A8WA 4AAWA 2BO4A 3CKOA 1LZIA 1LL0A 4FCEA 2OEGA 2XWLA 4L41C 3ZLLA 5CQMX 1V82A 5AJOA 4Y6NA 1TW5A 3KIAA 3U2TA 1H3MA 1W77A 1R7TA 1H5TB 1I52A 2X65A 1PZTA 2WGZA 3E26A 1OQMB 5C4DA 4FRHA 4Y64A 1ZJOA 3OGZA 1MP5A 2Y6PA 4HO2A 5C49A 1NF5B 4AYJA 3JTJA 1VGTA 4JISA 4NAKA 2VD4A 1QWJA 1W57A 4EEAA 1EYRA 1G9RA 4JD0A 1YP4A 2E3DA 5D92A 2P73A 1G3LA 1NKHB 4EE5A 3BRKX 3SX7A 3OH2A 4FIXA 2QH5A 1HV9A 3CKNA 4MIXA 3I0IX 3SXGA 5DDTA 1OMXA 2Y4KA 5IDSA 3SXAA 4HG6A 2FY7A 1ZJ3A 2C0NA 1GWWA 3D8VA 5FTSA 3V0LA 2VK9A 5AJNA 3F1CA 1H4DA 1H4EA 3LW6A 1R7YA 2BO8A 1WT0A 2QGIA 4MYBA 3FWWA 4Y7UA 5C3BA 2JCLA 1ON8A 1R82A 3V0QA 1G1LA 3I0LA 1H5SB 2BO6A 2RJ4A 4KC1A 3V0MA 4NALA 4G3PA 5CMFX 3K8EA 4NANA 4HCQA 2AM5A 2VS4A 4FRLA 3TQDA 4EEOA 3D5NA 3OC9A 1H7QA 1JVDA 1FGGA 1VICA
chains in the Genus database with same CATH topology
3ZLKA 4KRVA 1ZDFA 2BO7A 5EJ1A 4KPZA 2J0BA 5BXCA 4Y63A 2PA4A 4EEMA 4KQLA 1INJA 2JCOA 1NMMB 2VXLA 4Y7GA 4HO8A 3V90A 1LZ7A 1ON6A 4E1KA 1H4CA 3DUVA 2I5EA 1ZHJA 3BCVA 3N9WA 5EJZA 4FRBA 1VZXA 4P00A 3F1YA 2AECA 3JUJA 2V0HA 4AYLA 4B5BA 3TZTA 4BMAA 1WT1A 1G23A 1LVWA 2W0WA 3R2WA 3V91A 1O7QA 1XZ6A 5CMHA 3HL3A 1H5RB 1GQ9A 2RIZA 5J49A 2YCMA 4CJCA 3GUEA 3CKJA 3U0XA 2VSIA 5EIYA 4ARWA 3OH0A 2V0IA 3SX5A 4O6NA 1ZJ1A 2WEEA 5C47A 4B2XA 1R7VA 3IOHA 1GQCA 2PGYA 2ZU9A 3V0OA 4IRQA 1WVCA 4DECA 1NHEB 5C4CA 5FUHA 2VFZA 1LL2A 2XMHA 3JUKA 3U2WA 1S4NA 2V0KA 3SXCA 5IDTA 1IIMA 2XWNA 1O23B 2YQHA 5CQLX 3SX8A 1GWVA 2E8BA 1KWSA 1ZJPA 2VS5A 1ZCYA 2NXVA 4BQHA 4HO9A 4P02A 5C4FA 4Y7TA 3U2UA 4KC4A 2I5KA 3Q80A 3I0GA 2AE7A 4EE3A 5CMJA 1VZTA 1Z90A 5C1GA 5FV9A 2FFUA 2FYDB 3SXEA 3I0CA 1G97A 5AJPA 3NGWA 1H5TA 3E25A 2J0AA 1LL3A 4D48A 3POLA 4IRPA 1ZDGA 1H7TA 4ECMA 4KC2A 3ZF8A 1FR8A 3V0PA 4Y9XA 3CU0A 4ZDQA 2RJ7A 1ZI1A 2FFVA 1TW1A 2Y7AA 4Q7CA 3SXBA 5D91A 1HM9A 2FYAA 1YP2A 1TVYA 4M2AA 5DDVA 1MC3A 4UEGA 4Y7FA 4ASJA 4XWIA 1HJJA 2D7RA 4CJ8A 2A8UA 2RJ5A 3U2VA 1E5KA 1JVGA 4B4MA 3O3PA 1S4PA 2UX8A 4FREA 4B3UA 3OH3A 2RJ0A 4C2SA 2D7IA 5C3AA 2QKXA 1QGSA 2Y4MA 1NWGB 1MP4A 1S4OA 1VM8A 1WSZA 4LW3A 2X5ZA 1INIA 1FXOA 5C48A 1FR9A 1SS9A 4FRMA 3U0YA 1G93A 4FRQA 4D11C 2RJ8A 5C4EA 2YQSA 4FCUA 4M4KA 3USQA 4FRAA 1H5SA 4B2WA 1MP3A 1YP3A 2GGQA 3T7NA 4FQWA 3SPTA 4CJBA 2ICYA 1G8OA 3DJ4A 1FZWA 3SXDA 4FRDA 2RIXA 1FGXA 2FYCB 2WE9A 2AESA 2W0VA 4HO5A 5FTVA 1QGQA 2RIYA 2VXMA 2ZU7A 2V0LA 2WVMA 2DPWA 5C1HA 1O7OA 4D0TA 4HO3A 4R7PA 1O0RA 1FO9A 1V83A 1H7EA 1GA8A 1NQIB 3K8DA 3IOIA 4KXOA 3I0HA 1R7XA 3PKQA 1HM8A 3Q7UA 3OKRA 3V0NA 2CU2A 2RJ1A 4EE4A 3FOQA 3ZGFA 1FXJA 2O1GA 4FROA 4Y7VA 4CVHA 5C4BA 3ZGGA 5CQPA 4HOCA 1ZCVA 4B4GA 1LZJA 3PNNA 1ZIZA 3USRA 1EZIA 4KNXA 5L6VA 2PX7A 4EVWA 3IOJA 5FU0A 2RJ9A 4B42A 2AM3A 1XHBA 1R7UA 3T7OA 1H5RA 4KNRA 1GX4A 3T7MA 4LW6A 1GX0A 2Z86A 3EE5A 5I1FA 1H7FA 3CKVA 1VGWA 2OEFA 4KPXA 1H7HA 5FU8A 2OI5A 2YESA 5C38A 2Y4LA 4G3QA 2YC3A 1LZ0A 5FYEA 3RMWA 2AM4A 4J18A 1VZUA 4MNDA 1H7GA 3R3IA 1G95A 1YROB 2P6WA 4HO6A 2PGVA 3OH4A 1VGZA 4G87A 1IINA 1HJLA 5IFYA 3SX3A 3I0EA 3I0JA 2GGOA 1G0RA 1ZI5A 1H7LA 5C8RA 2D0JA 5CQOA 4K6RA 5HS2A 2OI7A 3CGXA 4O6MA 5CMGX 1ZCTA 2WVLA 2ZU8A 5C36A 3I0FA 2MZBA 2JCJA 3OH1A 2XWMA 3I0DA 2P72A 4AC3A 5L6SA 2Q4JA 2YQJA 2VSHA 2RITA 2YQCA 1FWYA 2X5SA 2JCKA 2YC5A 4D11A 5CMIA 4Y62A 1FG5N 2V0JA 1OMZA 1TZFA 1VPAA 2WVKA 1K4VA 1JV1A 3RSBA 3I0KA 1HM0A 1ZJ2A 1ZCUA 4FIYA 3DK5A 4GBPA 1QG8A 1FOAA 2O1FA 2XMEA 1FO8A 2OI6A 4DE7A 2WAWA 1ZJ0A 4KT7A 1R81A 4M2BA 3OAMA 4Y6UA 1VH3A 2FYBA 2VS3A 1ZI4A 3QVBA 4ASYA 3U2XA 2RJ6A 3CKQA 3PKPA 3V8YA 2O1HA 4B4BA 3ST8A 2Y4JA 2APCA 1JYLA 2ICXA 5C1LA 5CQNX 1FRWA 4YS8A 2I7BA 4G3SA 5C3DA 3RMVA 4HO4A 2Z87A 3V8ZA 4HO0A 1W55A 3Q4SA 1JV3A 1H5SD 1WT2A 1V84A 2X60A 1G2VA 2AGDA 4M28A 4EEGA 1H5SC 4NAIA 4DDZA 1VGUA 3D98A 5JQQA 4D0ZA 1WT3A 1JYKA 1PZYB 1R80A 1ZI3A 1VH1A 4FRPA 2AH9A 2A8WA 4AAWA 2BO4A 3CKOA 1LZIA 1LL0A 4FCEA 2OEGA 2XWLA 4L41C 3ZLLA 5CQMX 1V82A 5AJOA 4Y6NA 1TW5A 3KIAA 3U2TA 1H3MA 1W77A 1R7TA 1H5TB 1I52A 2X65A 1PZTA 2WGZA 3E26A 1OQMB 5C4DA 4FRHA 4Y64A 1ZJOA 3OGZA 1MP5A 2Y6PA 4HO2A 5C49A 1NF5B 4AYJA 3JTJA 1VGTA 4JISA 4NAKA 2VD4A 1QWJA 1W57A 4EEAA 1EYRA 1G9RA 4JD0A 1YP4A 2E3DA 5D92A 2P73A 1G3LA 1NKHB 4EE5A 3BRKX 3SX7A 3OH2A 4FIXA 2QH5A 1HV9A 3CKNA 4MIXA 3I0IX 3SXGA 5DDTA 1OMXA 2Y4KA 5IDSA 3SXAA 4HG6A 2FY7A 1ZJ3A 2C0NA 1GWWA 3D8VA 5FTSA 3V0LA 2VK9A 5AJNA 3F1CA 1H4DA 1H4EA 3LW6A 1R7YA 2BO8A 1WT0A 2QGIA 4MYBA 3FWWA 4Y7UA 5C3BA 2JCLA 1ON8A 1R82A 3V0QA 1G1LA 3I0LA 1H5SB 2BO6A 2RJ4A 4KC1A 3V0MA 4NALA 4G3PA 5CMFX 3K8EA 4NANA 4HCQA 2AM5A 2VS4A 4FRLA 3TQDA 4EEOA 3D5NA 3OC9A 1H7QA 1JVDA 1FGGA 1VICA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3ZLK A;  4KRV A;  1ZDF A;  2BO7 A;  5EJ1 A;  4KPZ A;  5BXC A;  4Y63 A;  2PA4 A;  4EEM A;  4KQL A;  1INJ A;  2JCO A;  1NMM B;  2VXL A;  4Y7G A;  4HO8 A;  3V90 A;  1LZ7 A;  1ON6 A;  4E1K A;  1H4C A;  3DUV A;  2I5E A;  1ZHJ A;  3BCV A;  3N9W A;  5EJZ A;  4FRB A;  1VZX A;  4P00 A;  3F1Y A;  2AEC A;  3JUJ A;  2V0H A;  4AYL A;  4B5B A;  3TZT A;  4BMA A;  1WT1 A;  1G23 A;  1LVW A;  2W0W A;  3R2W A;  3V91 A;  1O7Q A;  1XZ6 A;  5CMH A;  3HL3 A;  1H5R B;  1GQ9 A;  2RIZ A;  5J49 A;  2YCM A;  4CJC A;  3GUE A;  3CKJ A;  3U0X A;  2VSI A;  5EIY A;  4ARW A;  3OH0 A;  2V0I A;  3SX5 A;  1ZJ1 A;  2WEE A;  5C47 A;  4B2X A;  1R7V A;  3IOH A;  1GQC A;  2PGY A;  2ZU9 A;  3V0O A;  4IRQ A;  1WVC A;  4DEC A;  1NHE B;  5C4C A;  5FUH A;  2VFZ A;  1LL2 A;  2XMH A;  3JUK A;  3U2W A;  1S4N A;  2V0K A;  3SXC A;  5IDT A;  1IIM A;  2XWN A;  1O23 B;  2YQH A;  5CQL X;  3SX8 A;  1GWV A;  2E8B A;  1KWS A;  1ZJP A;  2VS5 A;  1ZCY A;  2NXV A;  4BQH A;  4HO9 A;  4P02 A;  5C4F A;  4Y7T A;  3U2U A;  4KC4 A;  2I5K A;  3Q80 A;  3I0G A;  2AE7 A;  4EE3 A;  5CMJ A;  1VZT A;  1Z90 A;  5C1G A;  5FV9 A;  2FFU A;  2FYD B;  3SXE A;  3I0C A;  1G97 A;  5AJP A;  3NGW A;  1H5T A;  3E25 A;  1LL3 A;  4D48 A;  3POL A;  4IRP A;  1ZDG A;  1H7T A;  4ECM A;  4KC2 A;  3ZF8 A;  1FR8 A;  3V0P A;  4Y9X A;  3CU0 A;  4ZDQ A;  2RJ7 A;  1ZI1 A;  2FFV A;  1TW1 A;  2Y7A A;  3SXB A;  1HM9 A;  2FYA A;  1YP2 A;  1TVY A;  4M2A A;  5DDV A;  1MC3 A;  4UEG A;  4Y7F A;  4ASJ A;  4XWI A;  1HJJ A;  2D7R A;  4CJ8 A;  2A8U A;  2RJ5 A;  3U2V A;  1E5K A;  1JVG A;  4B4M A;  3O3P A;  1S4P A;  2UX8 A;  4FRE A;  4B3U A;  3OH3 A;  2RJ0 A;  4C2S A;  2D7I A;  5C3A A;  2QKX A;  1QGS A;  2Y4M A;  1NWG B;  1MP4 A;  1S4O A;  1VM8 A;  1WSZ A;  4LW3 A;  2X5Z A;  1INI A;  1FXO A;  5C48 A;  1FR9 A;  1SS9 A;  4FRM A;  3U0Y A;  1G93 A;  4FRQ A;  4D11 C;  2RJ8 A;  5C4E A;  2YQS A;  4FCU A;  4M4K A;  3USQ A;  4FRA A;  1H5S A;  4B2W A;  1MP3 A;  1YP3 A;  2GGQ A;  3T7N A;  4FQW A;  3SPT A;  4CJB A;  2ICY A;  1G8O A;  3DJ4 A;  1FZW A;  3SXD A;  4FRD A;  2RIX A;  1FGX A;  2FYC B;  2WE9 A;  2AES A;  2W0V A;  4HO5 A;  5FTV A;  1QGQ A;  2RIY A;  2VXM A;  2ZU7 A;  2V0L A;  2WVM A;  2DPW A;  5C1H A;  1O7O A;  4D0T A;  4HO3 A;  4R7P A;  1O0R A;  1FO9 A;  1V83 A;  1H7E A;  1GA8 A;  1NQI B;  3K8D A;  3IOI A;  4KXO A;  3I0H A;  1R7X A;  3PKQ A;  1HM8 A;  3Q7U A;  3OKR A;  3V0N A;  2CU2 A;  2RJ1 A;  4EE4 A;  3FOQ A;  3ZGF A;  1FXJ A;  2O1G A;  4FRO A;  4Y7V A;  4CVH A;  5C4B A;  3ZGG A;  5CQP A;  4HOC A;  1ZCV A;  4B4G A;  1LZJ A;  3PNN A;  1ZIZ A;  3USR A;  1EZI A;  4KNX A;  5L6V A;  2PX7 A;  4EVW A;  3IOJ A;  5FU0 A;  2RJ9 A;  4B42 A;  2AM3 A;  1XHB A;  1R7U A;  3T7O A;  1H5R A;  4KNR A;  1GX4 A;  3T7M A;  4LW6 A;  1GX0 A;  2Z86 A;  3EE5 A;  5I1F A;  1H7F A;  3CKV A;  1VGW A;  2OEF A;  4KPX A;  1H7H A;  5FU8 A;  2OI5 A;  2YES A;  5C38 A;  2Y4L A;  4G3Q A;  2YC3 A;  1LZ0 A;  5FYE A;  3RMW A;  2AM4 A;  4J18 A;  1VZU A;  4MND A;  1H7G A;  3R3I A;  1G95 A;  1YRO B;  2P6W A;  4HO6 A;  2PGV A;  3OH4 A;  1VGZ A;  4G87 A;  1IIN A;  1HJL A;  5IFY A;  3SX3 A;  3I0E A;  3I0J A;  2GGO A;  1G0R A;  1ZI5 A;  1H7L A;  5C8R A;  2D0J A;  5CQO A;  4K6R A;  5HS2 A;  2OI7 A;  3CGX A;  5CMG X;  1ZCT A;  2WVL A;  2ZU8 A;  5C36 A;  3I0F A;  2MZB A;  2JCJ A;  3OH1 A;  2XWM A;  3I0D A;  2P72 A;  4AC3 A;  5L6S A;  2Q4J A;  2YQJ A;  2VSH A;  2RIT A;  2YQC A;  1FWY A;  2X5S A;  2JCK A;  2YC5 A;  4D11 A;  5CMI A;  4Y62 A;  1FG5 N;  2V0J A;  1OMZ A;  1TZF A;  1VPA A;  2WVK A;  1K4V A;  1JV1 A;  3RSB A;  3I0K A;  1HM0 A;  1ZJ2 A;  1ZCU A;  3DK5 A;  4GBP A;  1QG8 A;  1FOA A;  2O1F A;  2XME A;  1FO8 A;  2OI6 A;  4DE7 A;  2WAW A;  1ZJ0 A;  4KT7 A;  1R81 A;  4M2B A;  3OAM A;  4Y6U A;  1VH3 A;  2FYB A;  2VS3 A;  1ZI4 A;  3QVB A;  4ASY A;  3U2X A;  2RJ6 A;  3CKQ A;  3PKP A;  3V8Y A;  2O1H A;  4B4B A;  3ST8 A;  2Y4J A;  2APC A;  1JYL A;  2ICX A;  5C1L A;  5CQN X;  1FRW A;  4YS8 A;  2I7B A;  4G3S A;  5C3D A;  3RMV A;  4HO4 A;  2Z87 A;  3V8Z A;  4HO0 A;  1W55 A;  3Q4S A;  1JV3 A;  1H5S D;  1WT2 A;  1V84 A;  2X60 A;  1G2V A;  2AGD A;  4M28 A;  4EEG A;  1H5S C;  4NAI A;  4DDZ A;  1VGU A;  3D98 A;  5JQQ A;  4D0Z A;  1WT3 A;  1JYK A;  1PZY B;  1R80 A;  1ZI3 A;  1VH1 A;  4FRP A;  2AH9 A;  2A8W A;  4AAW A;  2BO4 A;  3CKO A;  1LZI A;  1LL0 A;  4FCE A;  2OEG A;  2XWL A;  4L41 C;  3ZLL A;  5CQM X;  1V82 A;  5AJO A;  4Y6N A;  1TW5 A;  3KIA A;  3U2T A;  1H3M A;  1W77 A;  1R7T A;  1H5T B;  1I52 A;  2X65 A;  1PZT A;  2WGZ A;  3E26 A;  1OQM B;  5C4D A;  4FRH A;  4Y64 A;  1ZJO A;  3OGZ A;  1MP5 A;  2Y6P A;  4HO2 A;  5C49 A;  1NF5 B;  4AYJ A;  3JTJ A;  1VGT A;  4JIS A;  4NAK A;  2VD4 A;  1QWJ A;  1W57 A;  4EEA A;  1EYR A;  1G9R A;  4JD0 A;  1YP4 A;  2E3D A;  2P73 A;  1G3L A;  1NKH B;  4EE5 A;  3BRK X;  3SX7 A;  3OH2 A;  2QH5 A;  1HV9 A;  3CKN A;  3I0I X;  3SXG A;  5DDT A;  1OMX A;  2Y4K A;  5IDS A;  3SXA A;  4HG6 A;  2FY7 A;  1ZJ3 A;  1GWW A;  3D8V A;  5FTS A;  3V0L A;  5AJN A;  3F1C A;  1H4D A;  1H4E A;  3LW6 A;  1R7Y A;  2BO8 A;  1WT0 A;  2QGI A;  4MYB A;  3FWW A;  4Y7U A;  5C3B A;  2JCL A;  1ON8 A;  1R82 A;  3V0Q A;  1G1L A;  3I0L A;  1H5S B;  2BO6 A;  2RJ4 A;  4KC1 A;  3V0M A;  4NAL A;  4G3P A;  5CMF X;  3K8E A;  4NAN A;  4HCQ A;  2AM5 A;  2VS4 A;  4FRL A;  3TQD A;  4EEO A;  3D5N A;  3OC9 A;  1H7Q A;  1JVD A;  1FGG A;  1VIC A; 
#chains in the Genus database with same CATH topology
 3ZLK A;  4KRV A;  1ZDF A;  2BO7 A;  5EJ1 A;  4KPZ A;  2J0B A;  5BXC A;  4Y63 A;  2PA4 A;  4EEM A;  4KQL A;  1INJ A;  2JCO A;  1NMM B;  2VXL A;  4Y7G A;  4HO8 A;  3V90 A;  1LZ7 A;  1ON6 A;  4E1K A;  1H4C A;  3DUV A;  2I5E A;  1ZHJ A;  3BCV A;  3N9W A;  5EJZ A;  4FRB A;  1VZX A;  4P00 A;  3F1Y A;  2AEC A;  3JUJ A;  2V0H A;  4AYL A;  4B5B A;  3TZT A;  4BMA A;  1WT1 A;  1G23 A;  1LVW A;  2W0W A;  3R2W A;  3V91 A;  1O7Q A;  1XZ6 A;  5CMH A;  3HL3 A;  1H5R B;  1GQ9 A;  2RIZ A;  5J49 A;  2YCM A;  4CJC A;  3GUE A;  3CKJ A;  3U0X A;  2VSI A;  5EIY A;  4ARW A;  3OH0 A;  2V0I A;  3SX5 A;  4O6N A;  1ZJ1 A;  2WEE A;  5C47 A;  4B2X A;  1R7V A;  3IOH A;  1GQC A;  2PGY A;  2ZU9 A;  3V0O A;  4IRQ A;  1WVC A;  4DEC A;  1NHE B;  5C4C A;  5FUH A;  2VFZ A;  1LL2 A;  2XMH A;  3JUK A;  3U2W A;  1S4N A;  2V0K A;  3SXC A;  5IDT A;  1IIM A;  2XWN A;  1O23 B;  2YQH A;  5CQL X;  3SX8 A;  1GWV A;  2E8B A;  1KWS A;  1ZJP A;  2VS5 A;  1ZCY A;  2NXV A;  4BQH A;  4HO9 A;  4P02 A;  5C4F A;  4Y7T A;  3U2U A;  4KC4 A;  2I5K A;  3Q80 A;  3I0G A;  2AE7 A;  4EE3 A;  5CMJ A;  1VZT A;  1Z90 A;  5C1G A;  5FV9 A;  2FFU A;  2FYD B;  3SXE A;  3I0C A;  1G97 A;  5AJP A;  3NGW A;  1H5T A;  3E25 A;  2J0A A;  1LL3 A;  4D48 A;  3POL A;  4IRP A;  1ZDG A;  1H7T A;  4ECM A;  4KC2 A;  3ZF8 A;  1FR8 A;  3V0P A;  4Y9X A;  3CU0 A;  4ZDQ A;  2RJ7 A;  1ZI1 A;  2FFV A;  1TW1 A;  2Y7A A;  4Q7C A;  3SXB A;  5D91 A;  1HM9 A;  2FYA A;  1YP2 A;  1TVY A;  4M2A A;  5DDV A;  1MC3 A;  4UEG A;  4Y7F A;  4ASJ A;  4XWI A;  1HJJ A;  2D7R A;  4CJ8 A;  2A8U A;  2RJ5 A;  3U2V A;  1E5K A;  1JVG A;  4B4M A;  3O3P A;  1S4P A;  2UX8 A;  4FRE A;  4B3U A;  3OH3 A;  2RJ0 A;  4C2S A;  2D7I A;  5C3A A;  2QKX A;  1QGS A;  2Y4M A;  1NWG B;  1MP4 A;  1S4O A;  1VM8 A;  1WSZ A;  4LW3 A;  2X5Z A;  1INI A;  1FXO A;  5C48 A;  1FR9 A;  1SS9 A;  4FRM A;  3U0Y A;  1G93 A;  4FRQ A;  4D11 C;  2RJ8 A;  5C4E A;  2YQS A;  4FCU A;  4M4K A;  3USQ A;  4FRA A;  1H5S A;  4B2W A;  1MP3 A;  1YP3 A;  2GGQ A;  3T7N A;  4FQW A;  3SPT A;  4CJB A;  2ICY A;  1G8O A;  3DJ4 A;  1FZW A;  3SXD A;  4FRD A;  2RIX A;  1FGX A;  2FYC B;  2WE9 A;  2AES A;  2W0V A;  4HO5 A;  5FTV A;  1QGQ A;  2RIY A;  2VXM A;  2ZU7 A;  2V0L A;  2WVM A;  2DPW A;  5C1H A;  1O7O A;  4D0T A;  4HO3 A;  4R7P A;  1O0R A;  1FO9 A;  1V83 A;  1H7E A;  1GA8 A;  1NQI B;  3K8D A;  3IOI A;  4KXO A;  3I0H A;  1R7X A;  3PKQ A;  1HM8 A;  3Q7U A;  3OKR A;  3V0N A;  2CU2 A;  2RJ1 A;  4EE4 A;  3FOQ A;  3ZGF A;  1FXJ A;  2O1G A;  4FRO A;  4Y7V A;  4CVH A;  5C4B A;  3ZGG A;  5CQP A;  4HOC A;  1ZCV A;  4B4G A;  1LZJ A;  3PNN A;  1ZIZ A;  3USR A;  1EZI A;  4KNX A;  5L6V A;  2PX7 A;  4EVW A;  3IOJ A;  5FU0 A;  2RJ9 A;  4B42 A;  2AM3 A;  1XHB A;  1R7U A;  3T7O A;  1H5R A;  4KNR A;  1GX4 A;  3T7M A;  4LW6 A;  1GX0 A;  2Z86 A;  3EE5 A;  5I1F A;  1H7F A;  3CKV A;  1VGW A;  2OEF A;  4KPX A;  1H7H A;  5FU8 A;  2OI5 A;  2YES A;  5C38 A;  2Y4L A;  4G3Q A;  2YC3 A;  1LZ0 A;  5FYE A;  3RMW A;  2AM4 A;  4J18 A;  1VZU A;  4MND A;  1H7G A;  3R3I A;  1G95 A;  1YRO B;  2P6W A;  4HO6 A;  2PGV A;  3OH4 A;  1VGZ A;  4G87 A;  1IIN A;  1HJL A;  5IFY A;  3SX3 A;  3I0E A;  3I0J A;  2GGO A;  1G0R A;  1ZI5 A;  1H7L A;  5C8R A;  2D0J A;  5CQO A;  4K6R A;  5HS2 A;  2OI7 A;  3CGX A;  4O6M A;  5CMG X;  1ZCT A;  2WVL A;  2ZU8 A;  5C36 A;  3I0F A;  2MZB A;  2JCJ A;  3OH1 A;  2XWM A;  3I0D A;  2P72 A;  4AC3 A;  5L6S A;  2Q4J A;  2YQJ A;  2VSH A;  2RIT A;  2YQC A;  1FWY A;  2X5S A;  2JCK A;  2YC5 A;  4D11 A;  5CMI A;  4Y62 A;  1FG5 N;  2V0J A;  1OMZ A;  1TZF A;  1VPA A;  2WVK A;  1K4V A;  1JV1 A;  3RSB A;  3I0K A;  1HM0 A;  1ZJ2 A;  1ZCU A;  4FIY A;  3DK5 A;  4GBP A;  1QG8 A;  1FOA A;  2O1F A;  2XME A;  1FO8 A;  2OI6 A;  4DE7 A;  2WAW A;  1ZJ0 A;  4KT7 A;  1R81 A;  4M2B A;  3OAM A;  4Y6U A;  1VH3 A;  2FYB A;  2VS3 A;  1ZI4 A;  3QVB A;  4ASY A;  3U2X A;  2RJ6 A;  3CKQ A;  3PKP A;  3V8Y A;  2O1H A;  4B4B A;  3ST8 A;  2Y4J A;  2APC A;  1JYL A;  2ICX A;  5C1L A;  5CQN X;  1FRW A;  4YS8 A;  2I7B A;  4G3S A;  5C3D A;  3RMV A;  4HO4 A;  2Z87 A;  3V8Z A;  4HO0 A;  1W55 A;  3Q4S A;  1JV3 A;  1H5S D;  1WT2 A;  1V84 A;  2X60 A;  1G2V A;  2AGD A;  4M28 A;  4EEG A;  1H5S C;  4NAI A;  4DDZ A;  1VGU A;  3D98 A;  5JQQ A;  4D0Z A;  1WT3 A;  1JYK A;  1PZY B;  1R80 A;  1ZI3 A;  1VH1 A;  4FRP A;  2AH9 A;  2A8W A;  4AAW A;  2BO4 A;  3CKO A;  1LZI A;  1LL0 A;  4FCE A;  2OEG A;  2XWL A;  4L41 C;  3ZLL A;  5CQM X;  1V82 A;  5AJO A;  4Y6N A;  1TW5 A;  3KIA A;  3U2T A;  1H3M A;  1W77 A;  1R7T A;  1H5T B;  1I52 A;  2X65 A;  1PZT A;  2WGZ A;  3E26 A;  1OQM B;  5C4D A;  4FRH A;  4Y64 A;  1ZJO A;  3OGZ A;  1MP5 A;  2Y6P A;  4HO2 A;  5C49 A;  1NF5 B;  4AYJ A;  3JTJ A;  1VGT A;  4JIS A;  4NAK A;  2VD4 A;  1QWJ A;  1W57 A;  4EEA A;  1EYR A;  1G9R A;  4JD0 A;  1YP4 A;  2E3D A;  5D92 A;  2P73 A;  1G3L A;  1NKH B;  4EE5 A;  3BRK X;  3SX7 A;  3OH2 A;  4FIX A;  2QH5 A;  1HV9 A;  3CKN A;  4MIX A;  3I0I X;  3SXG A;  5DDT A;  1OMX A;  2Y4K A;  5IDS A;  3SXA A;  4HG6 A;  2FY7 A;  1ZJ3 A;  2C0N A;  1GWW A;  3D8V A;  5FTS A;  3V0L A;  2VK9 A;  5AJN A;  3F1C A;  1H4D A;  1H4E A;  3LW6 A;  1R7Y A;  2BO8 A;  1WT0 A;  2QGI A;  4MYB A;  3FWW A;  4Y7U A;  5C3B A;  2JCL A;  1ON8 A;  1R82 A;  3V0Q A;  1G1L A;  3I0L A;  1H5S B;  2BO6 A;  2RJ4 A;  4KC1 A;  3V0M A;  4NAL A;  4G3P A;  5CMF X;  3K8E A;  4NAN A;  4HCQ A;  2AM5 A;  2VS4 A;  4FRL A;  3TQD A;  4EEO A;  3D5N A;  3OC9 A;  1H7Q A;  1JVD A;  1FGG A;  1VIC A; 
#chains in the Genus database with same CATH homology
 3ZLK A;  4KRV A;  1ZDF A;  2BO7 A;  5EJ1 A;  4KPZ A;  2J0B A;  5BXC A;  4Y63 A;  2PA4 A;  4EEM A;  4KQL A;  1INJ A;  2JCO A;  1NMM B;  2VXL A;  4Y7G A;  4HO8 A;  3V90 A;  1LZ7 A;  1ON6 A;  4E1K A;  1H4C A;  3DUV A;  2I5E A;  1ZHJ A;  3BCV A;  3N9W A;  5EJZ A;  4FRB A;  1VZX A;  4P00 A;  3F1Y A;  2AEC A;  3JUJ A;  2V0H A;  4AYL A;  4B5B A;  3TZT A;  4BMA A;  1WT1 A;  1G23 A;  1LVW A;  2W0W A;  3R2W A;  3V91 A;  1O7Q A;  1XZ6 A;  5CMH A;  3HL3 A;  1H5R B;  1GQ9 A;  2RIZ A;  5J49 A;  2YCM A;  4CJC A;  3GUE A;  3CKJ A;  3U0X A;  2VSI A;  5EIY A;  4ARW A;  3OH0 A;  2V0I A;  3SX5 A;  4O6N A;  1ZJ1 A;  2WEE A;  5C47 A;  4B2X A;  1R7V A;  3IOH A;  1GQC A;  2PGY A;  2ZU9 A;  3V0O A;  4IRQ A;  1WVC A;  4DEC A;  1NHE B;  5C4C A;  5FUH A;  2VFZ A;  1LL2 A;  2XMH A;  3JUK A;  3U2W A;  1S4N A;  2V0K A;  3SXC A;  5IDT A;  1IIM A;  2XWN A;  1O23 B;  2YQH A;  5CQL X;  3SX8 A;  1GWV A;  2E8B A;  1KWS A;  1ZJP A;  2VS5 A;  1ZCY A;  2NXV A;  4BQH A;  4HO9 A;  4P02 A;  5C4F A;  4Y7T A;  3U2U A;  4KC4 A;  2I5K A;  3Q80 A;  3I0G A;  2AE7 A;  4EE3 A;  5CMJ A;  1VZT A;  1Z90 A;  5C1G A;  5FV9 A;  2FFU A;  2FYD B;  3SXE A;  3I0C A;  1G97 A;  5AJP A;  3NGW A;  1H5T A;  3E25 A;  2J0A A;  1LL3 A;  4D48 A;  3POL A;  4IRP A;  1ZDG A;  1H7T A;  4ECM A;  4KC2 A;  3ZF8 A;  1FR8 A;  3V0P A;  4Y9X A;  3CU0 A;  4ZDQ A;  2RJ7 A;  1ZI1 A;  2FFV A;  1TW1 A;  2Y7A A;  4Q7C A;  3SXB A;  5D91 A;  1HM9 A;  2FYA A;  1YP2 A;  1TVY A;  4M2A A;  5DDV A;  1MC3 A;  4UEG A;  4Y7F A;  4ASJ A;  4XWI A;  1HJJ A;  2D7R A;  4CJ8 A;  2A8U A;  2RJ5 A;  3U2V A;  1E5K A;  1JVG A;  4B4M A;  3O3P A;  1S4P A;  2UX8 A;  4FRE A;  4B3U A;  3OH3 A;  2RJ0 A;  4C2S A;  2D7I A;  5C3A A;  2QKX A;  1QGS A;  2Y4M A;  1NWG B;  1MP4 A;  1S4O A;  1VM8 A;  1WSZ A;  4LW3 A;  2X5Z A;  1INI A;  1FXO A;  5C48 A;  1FR9 A;  1SS9 A;  4FRM A;  3U0Y A;  1G93 A;  4FRQ A;  4D11 C;  2RJ8 A;  5C4E A;  2YQS A;  4FCU A;  4M4K A;  3USQ A;  4FRA A;  1H5S A;  4B2W A;  1MP3 A;  1YP3 A;  2GGQ A;  3T7N A;  4FQW A;  3SPT A;  4CJB A;  2ICY A;  1G8O A;  3DJ4 A;  1FZW A;  3SXD A;  4FRD A;  2RIX A;  1FGX A;  2FYC B;  2WE9 A;  2AES A;  2W0V A;  4HO5 A;  5FTV A;  1QGQ A;  2RIY A;  2VXM A;  2ZU7 A;  2V0L A;  2WVM A;  2DPW A;  5C1H A;  1O7O A;  4D0T A;  4HO3 A;  4R7P A;  1O0R A;  1FO9 A;  1V83 A;  1H7E A;  1GA8 A;  1NQI B;  3K8D A;  3IOI A;  4KXO A;  3I0H A;  1R7X A;  3PKQ A;  1HM8 A;  3Q7U A;  3OKR A;  3V0N A;  2CU2 A;  2RJ1 A;  4EE4 A;  3FOQ A;  3ZGF A;  1FXJ A;  2O1G A;  4FRO A;  4Y7V A;  4CVH A;  5C4B A;  3ZGG A;  5CQP A;  4HOC A;  1ZCV A;  4B4G A;  1LZJ A;  3PNN A;  1ZIZ A;  3USR A;  1EZI A;  4KNX A;  5L6V A;  2PX7 A;  4EVW A;  3IOJ A;  5FU0 A;  2RJ9 A;  4B42 A;  2AM3 A;  1XHB A;  1R7U A;  3T7O A;  1H5R A;  4KNR A;  1GX4 A;  3T7M A;  4LW6 A;  1GX0 A;  2Z86 A;  3EE5 A;  5I1F A;  1H7F A;  3CKV A;  1VGW A;  2OEF A;  4KPX A;  1H7H A;  5FU8 A;  2OI5 A;  2YES A;  5C38 A;  2Y4L A;  4G3Q A;  2YC3 A;  1LZ0 A;  5FYE A;  3RMW A;  2AM4 A;  4J18 A;  1VZU A;  4MND A;  1H7G A;  3R3I A;  1G95 A;  1YRO B;  2P6W A;  4HO6 A;  2PGV A;  3OH4 A;  1VGZ A;  4G87 A;  1IIN A;  1HJL A;  5IFY A;  3SX3 A;  3I0E A;  3I0J A;  2GGO A;  1G0R A;  1ZI5 A;  1H7L A;  5C8R A;  2D0J A;  5CQO A;  4K6R A;  5HS2 A;  2OI7 A;  3CGX A;  4O6M A;  5CMG X;  1ZCT A;  2WVL A;  2ZU8 A;  5C36 A;  3I0F A;  2MZB A;  2JCJ A;  3OH1 A;  2XWM A;  3I0D A;  2P72 A;  4AC3 A;  5L6S A;  2Q4J A;  2YQJ A;  2VSH A;  2RIT A;  2YQC A;  1FWY A;  2X5S A;  2JCK A;  2YC5 A;  4D11 A;  5CMI A;  4Y62 A;  1FG5 N;  2V0J A;  1OMZ A;  1TZF A;  1VPA A;  2WVK A;  1K4V A;  1JV1 A;  3RSB A;  3I0K A;  1HM0 A;  1ZJ2 A;  1ZCU A;  4FIY A;  3DK5 A;  4GBP A;  1QG8 A;  1FOA A;  2O1F A;  2XME A;  1FO8 A;  2OI6 A;  4DE7 A;  2WAW A;  1ZJ0 A;  4KT7 A;  1R81 A;  4M2B A;  3OAM A;  4Y6U A;  1VH3 A;  2FYB A;  2VS3 A;  1ZI4 A;  3QVB A;  4ASY A;  3U2X A;  2RJ6 A;  3CKQ A;  3PKP A;  3V8Y A;  2O1H A;  4B4B A;  3ST8 A;  2Y4J A;  2APC A;  1JYL A;  2ICX A;  5C1L A;  5CQN X;  1FRW A;  4YS8 A;  2I7B A;  4G3S A;  5C3D A;  3RMV A;  4HO4 A;  2Z87 A;  3V8Z A;  4HO0 A;  1W55 A;  3Q4S A;  1JV3 A;  1H5S D;  1WT2 A;  1V84 A;  2X60 A;  1G2V A;  2AGD A;  4M28 A;  4EEG A;  1H5S C;  4NAI A;  4DDZ A;  1VGU A;  3D98 A;  5JQQ A;  4D0Z A;  1WT3 A;  1JYK A;  1PZY B;  1R80 A;  1ZI3 A;  1VH1 A;  4FRP A;  2AH9 A;  2A8W A;  4AAW A;  2BO4 A;  3CKO A;  1LZI A;  1LL0 A;  4FCE A;  2OEG A;  2XWL A;  4L41 C;  3ZLL A;  5CQM X;  1V82 A;  5AJO A;  4Y6N A;  1TW5 A;  3KIA A;  3U2T A;  1H3M A;  1W77 A;  1R7T A;  1H5T B;  1I52 A;  2X65 A;  1PZT A;  2WGZ A;  3E26 A;  1OQM B;  5C4D A;  4FRH A;  4Y64 A;  1ZJO A;  3OGZ A;  1MP5 A;  2Y6P A;  4HO2 A;  5C49 A;  1NF5 B;  4AYJ A;  3JTJ A;  1VGT A;  4JIS A;  4NAK A;  2VD4 A;  1QWJ A;  1W57 A;  4EEA A;  1EYR A;  1G9R A;  4JD0 A;  1YP4 A;  2E3D A;  5D92 A;  2P73 A;  1G3L A;  1NKH B;  4EE5 A;  3BRK X;  3SX7 A;  3OH2 A;  4FIX A;  2QH5 A;  1HV9 A;  3CKN A;  4MIX A;  3I0I X;  3SXG A;  5DDT A;  1OMX A;  2Y4K A;  5IDS A;  3SXA A;  4HG6 A;  2FY7 A;  1ZJ3 A;  2C0N A;  1GWW A;  3D8V A;  5FTS A;  3V0L A;  2VK9 A;  5AJN A;  3F1C A;  1H4D A;  1H4E A;  3LW6 A;  1R7Y A;  2BO8 A;  1WT0 A;  2QGI A;  4MYB A;  3FWW A;  4Y7U A;  5C3B A;  2JCL A;  1ON8 A;  1R82 A;  3V0Q A;  1G1L A;  3I0L A;  1H5S B;  2BO6 A;  2RJ4 A;  4KC1 A;  3V0M A;  4NAL A;  4G3P A;  5CMF X;  3K8E A;  4NAN A;  4HCQ A;  2AM5 A;  2VS4 A;  4FRL A;  3TQD A;  4EEO A;  3D5N A;  3OC9 A;  1H7Q A;  1JVD A;  1FGG A;  1VIC A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...