4FRMA

Crystal structure of bbbb+udp+gal at ph 7.0 with mpd as the cryoprotectant
Total Genus 81
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
81
sequence length
275
structure length
264
Chain Sequence
YPQPKVLTPCRKDVLVVTPWLAPIVWEGTFNIDILNEQFRLQNTTIGLTVFAIKKYVAFLKLFLETAEKHFMVGHRVHYYVFTDQPAAVPRVTLGTGRQLSVLEVGRRMEMISGCERRFLSEVDYLVCVDVDMEFRDHVGVEILTPLFGTLHPSFYGSSREAFTYERRPQSQAYIPKDEGDFYYMGAFFGGSVQEVQRLTRACHQAMMVDQANGIEAVWHDESHLNKYLLRHKPTKVLSPEYLWDQQLLGWPAVLRKLRFTAVP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords Histo-blood group ABO system transferase
publication title pH-induced conformational changes in human ABO(H) blood group glycosyltransferases confirm the importance of electrostatic interactions in the formation of the semi-closed state.
pubmed doi rcsb
source organism Homo sapiens
total genus 81
structure length 264
sequence length 275
ec nomenclature ec 2.4.1.37: Fucosylgalactoside 3-alpha-galactosyltransferase.
pdb deposition date 2012-06-26
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.550.10 Alpha Beta Alpha-Beta Complex Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A 4frmA00
3GUEA 4HO2A 1H7QA 2PGVA 1H7GA 3OH2A 5BXCA 1ZCVA 1FXJA 2AH9A 3U2UA 3I0EA 2A8WA 4CJCA 2V0LA 3U2WA 1GQ9A 1H5TB 3JUKA 1R80A 2FFVA 2P72A 2O1GA 3DK5A 2D7IA 3IOIA 4FRBA 5CMFX 3SXDA 1V84A 4P02A 4HO5A 3BCVA 3Q7UA 4EE5A 5IDTA 5J49A 1ZI1A 1LVWA 3V8ZA 2DPWA 2FYAA 3FOQA 5CMJA 4CJBA 3CKJA 3I0KA 1H7TA 3KIAA 4NAKA 4LW3A 1R82A 4ZDQA 1FGGA 1IINA 2NXVA 2RJ7A 5JQQA 1FOAA 4NANA 1JV3A 2GGQA 2JCOA 1G23A 3D98A 3U2TA 4B3UA 1MP4A 4FREA 3SX7A 1S4PA 5CQLX 1PZTA 1H5RB 1WVCA 2CU2A 2WE9A 5DDVA 5C49A 2P6WA 3EE5A 2OEFA 1H7EA 2VXLA 4KNRA 1TZFA 4C2SA 3TZTA 2OI7A 4HO9A 2X60A 3SX5A 2FYBA 3OC9A 3SPTA 2Y6PA 3OH4A 3V0LA 3PKPA 4AYJA 5EJ1A 3LW6A 1OMZA 1NWGB 2AESA 1JV1A 3IOHA 1PZYB 4UEGA 5C47A 1JYKA 4ECMA 2VSIA 5C3BA 1G93A 2A8UA 3I0IX 1NQIB 1G9RA 1TW5A 2XMEA 4KQLA 3ZGGA 1YP2A 2V0HA 5CMIA 4EEGA 3CKOA 1R7XA 2FY7A 1ON6A 2RJ8A 2YQCA 1ZJOA 1VGTA 1H5TA 4D48A 3ST8A 1QWJA 5C4DA 2GGOA 4Y7FA 1GWVA 2V0KA 4P00A 5FTSA 3U2VA 2MZBA 4D0TA 3HL3A 1Z90A 2VS3A 1H5SC 1G3LA 3I0HA 3V0OA 2YC3A 1ZIZA 1ZHJA 3CGXA 2Y4KA 2YESA 1YP3A 3NGWA 4ASYA 2Y4JA 1HM8A 1ZJ0A 1QG8A 1FZWA 1NF5B 2XWNA 2PX7A 3U0YA 1O23B 3CKQA 2D0JA 3K8DA 2OI6A 5C4EA 1ZI3A 4NALA 3V91A 3OKRA 1TW1A 4G3QA 1NKHB 1H5RA 1ZJ2A 2X5SA 3SX8A 5L6VA 1ZCTA 3Q80A 1FO8A 2ZU9A 3FWWA 1FXOA 2Y4LA 4EEOA 2XMHA 3RMWA 1GWWA 1O7OA 3ZLLA 1LZ7A 2W0WA 1H4EA 4MNDA 1O0RA 5C1HA 2ZU7A 4HG6A 1V83A 1GA8A 4DECA 2O1HA 4EE4A 4HO3A 4B4GA 4B42A 1LL2A 1G8OA 1QGQA 2Y7AA 1NHEB 3N9WA 4FRAA 1HJLA 2I5KA 1W77A 4EEAA 2W0VA 1KWSA 1MC3A 2RJ1A 4GBPA 2RITA 1LZ0A 5C48A 3V0QA 3I0LA 2PGYA 1IIMA 2YQHA 2Z86A 3RSBA 5C8RA 4IRQA 1FR8A 1EZIA 2FYDB 2QKXA 2UX8A 3U0XA 4IRPA 3V0MA 5C38A 1FRWA 1ZJ1A 4Y7VA 5HS2A 2JCLA 3V0PA 4HO6A 4Y7UA 4EEMA 4AAWA 1G0RA 1QGSA 2AECA 4D11C 3O3PA 1H7FA 4G3SA 5C1LA 4B2WA 1VZXA 3OH0A 1WT3A 1WT0A 4KC2A 3IOJA 1VH3A 1H4DA 5DDTA 1VGZA 1VH1A 3SX3A 1H7HA 2AM4A 2X5ZA 1G2VA 1ZCUA 2P73A 4FRQA 4M2BA 4FRHA 1R7VA 3I0FA 5EJZA 2RJ4A 4KT7A 3T7NA 3TQDA 5C4BA 1R7UA 5CQNX 1XHBA 3I0JA 2RIZA 4KPZA 4KPXA 5IFYA 1LL0A 4HCQA 2V0JA 3SXCA 1ZCYA 5C4CA 1G97A 3R3IA 5CMGX 4XWIA 4FRMA 1LZIA 2I5EA 1I52A 2AM5A 4DDZA 1MP5A 3CU0A 1VPAA 5AJPA 4M2AA 3SXEA 4JD0A 4FCUA 1H5SB 5C3DA 4B5BA 1H3MA 4R7PA 4KRVA 3D5NA 3D8VA 5EIYA 3ZLKA 4KNXA 1VM8A 1G95A 3E25A 2FFUA 2X65A 1R81A 3F1YA 1K4VA 1S4NA 1R7YA 2VS4A 1E5KA 1VGUA 3JTJA 4KC4A 3BRKX 1WSZA 2ZU8A 2BO6A 2WVMA 2V0IA 1WT2A 2BO8A 2PA4A 4D0ZA 4ASJA 4YS8A 5FU8A 1V82A 1SS9A 1VICA 5CQMX 4B2XA 4KC1A 1G1LA 2VS5A 2OI5A 4HO0A 2APCA 3SXBA 1EYRA 1GQCA 3DJ4A 3V90A 5C4FA 2YCMA 4AC3A 1H4CA 2AM3A 3ZF8A 4BMAA 5C36A 2E3DA 4G3PA 2I7BA 2E8BA 4FCEA 2ICXA 4J18A 3T7MA 2YQJA 5FV9A 1ZI5A 2WVLA 3U2XA 2BO4A 2WVKA 2AGDA 2FYCB 3V8YA 1ZDFA 3USQA 4B4BA 4DE7A 3SXGA 3V0NA 5IDSA 3OH1A 1JYLA 1WT1A 5CQOA 1O7QA 2JCKA 5CQPA 3JUJA 1H5SA 2VSHA 3I0GA 4NAIA 2D7RA 2Q4JA 4Y7GA 1OMXA 5AJNA 3CKVA 3PKQA 2RIYA 4L41C 2VFZA 4FRLA 1FO9A 1HV9A 5FTVA 4EVWA 2Y4MA 2ICYA 4HOCA 3PNNA 3I0CA 2RIXA 1GX4A 4HO8A 4KXOA 1ZJ3A 2QGIA 1XZ6A 2QH5A 3CKNA 3SXAA 4CJ8A 2YC5A 3POLA 2O1FA 4MYBA 1LZJA 1ZJPA 2AE7A 1MP3A 4EE3A 1JVDA 3RMVA 4FROA 1HJJA 2YQSA 1YP4A 1H5SD 2JCJA 2WGZA 4Y63A 1VGWA 3OGZA 3I0DA 1H7LA 1ZI4A 4HO4A 4M4KA 4Y6NA 5C3AA 5FYEA 1FWYA 3OH3A 3F1CA 2VD4A 4ARWA 2Z87A 2RJ9A 3DUVA 4Y7TA 1S4OA 4AYLA 3E26A 2VXMA 1YROB 3USRA 1INJA 4Y64A 1INIA 1LL3A 4Y6UA 1R7TA 5FUHA 2XWMA 1FG5N 1W55A 2RJ5A 2WEEA 2OEGA 3OAMA 4K6RA 1ON8A 1FGXA 1TVYA 5FU0A 1W57A 4FRPA 1OQMB 4FQWA 4D11A 4E1KA 1HM0A 5L6SA 4M28A 5I1FA 2RJ0A 5AJOA 1GX0A 4JISA 4FRDA 3Q4SA 1VZUA 3QVBA 4BQHA 2XWLA 1FR9A 4B4MA 2WAWA 5C1GA 5CMHA 2RJ6A 3K8EA 4G87A 4Y9XA 4Y62A 1VZTA 4CVHA 3R2WA 1ZDGA 3T7OA 1NMMB 1HM9A 1JVGA 3ZGFA 4LW6A 2BO7A
chains in the Genus database with same CATH superfamily
3GUEA 5D91A 4HO2A 1H7QA 2PGVA 1H7GA 3OH2A 5BXCA 1ZCVA 1FXJA 2AH9A 3U2UA 3I0EA 2A8WA 4CJCA 2V0LA 3U2WA 1GQ9A 1H5TB 3JUKA 1R80A 2FFVA 2P72A 2O1GA 3DK5A 2D7IA 3IOIA 4FRBA 5CMFX 3SXDA 1V84A 4P02A 4HO5A 3BCVA 3Q7UA 4EE5A 5IDTA 5J49A 1ZI1A 1LVWA 3V8ZA 2DPWA 2FYAA 3FOQA 5CMJA 4CJBA 3CKJA 3I0KA 1H7TA 3KIAA 4NAKA 4LW3A 1R82A 4ZDQA 1FGGA 1IINA 2NXVA 2RJ7A 5JQQA 1FOAA 4NANA 1JV3A 2GGQA 2JCOA 1G23A 3D98A 3U2TA 4B3UA 1MP4A 4FREA 3SX7A 1S4PA 5CQLX 1PZTA 1H5RB 1WVCA 2CU2A 2WE9A 5DDVA 5C49A 2P6WA 3EE5A 2OEFA 1H7EA 2VXLA 4KNRA 1TZFA 4C2SA 3TZTA 2OI7A 4HO9A 2X60A 3SX5A 2FYBA 3OC9A 3SPTA 2Y6PA 3OH4A 3V0LA 3PKPA 4AYJA 5EJ1A 3LW6A 1OMZA 1NWGB 2AESA 1JV1A 3IOHA 1PZYB 4UEGA 5C47A 1JYKA 4ECMA 2VSIA 5C3BA 1G93A 2A8UA 3I0IX 1NQIB 1G9RA 1TW5A 2XMEA 4KQLA 3ZGGA 1YP2A 2V0HA 5CMIA 4EEGA 3CKOA 1R7XA 2FY7A 1ON6A 2RJ8A 2YQCA 1ZJOA 1VGTA 1H5TA 4D48A 3ST8A 1QWJA 5C4DA 2GGOA 4Y7FA 1GWVA 2V0KA 4P00A 5FTSA 3U2VA 2MZBA 4D0TA 3HL3A 1Z90A 2VS3A 1H5SC 5D92A 1G3LA 3I0HA 3V0OA 2YC3A 1ZIZA 1ZHJA 3CGXA 2Y4KA 2YESA 1YP3A 3NGWA 4ASYA 2Y4JA 1HM8A 1ZJ0A 1QG8A 1FZWA 1NF5B 2XWNA 2PX7A 3U0YA 1O23B 3CKQA 2D0JA 3K8DA 2OI6A 5C4EA 1ZI3A 4NALA 3V91A 3OKRA 1TW1A 4G3QA 1NKHB 1H5RA 1ZJ2A 2X5SA 3SX8A 5L6VA 1ZCTA 3Q80A 1FO8A 2ZU9A 3FWWA 1FXOA 2Y4LA 4EEOA 2XMHA 3RMWA 1GWWA 1O7OA 3ZLLA 1LZ7A 2W0WA 1H4EA 4MNDA 1O0RA 5C1HA 2ZU7A 4HG6A 1V83A 1GA8A 4DECA 2O1HA 4EE4A 4HO3A 4B4GA 4B42A 1LL2A 1G8OA 1QGQA 2Y7AA 1NHEB 3N9WA 4FRAA 1HJLA 2I5KA 1W77A 4EEAA 2W0VA 1KWSA 1MC3A 2RJ1A 4GBPA 2RITA 1LZ0A 5C48A 2VK9A 3V0QA 3I0LA 2PGYA 1IIMA 2YQHA 2Z86A 3RSBA 5C8RA 4IRQA 1FR8A 1EZIA 2FYDB 2QKXA 2UX8A 3U0XA 4IRPA 3V0MA 5C38A 1FRWA 1ZJ1A 4Y7VA 5HS2A 2JCLA 3V0PA 4HO6A 4Y7UA 4EEMA 4AAWA 1G0RA 1QGSA 2AECA 4D11C 3O3PA 1H7FA 4G3SA 5C1LA 4B2WA 1VZXA 3OH0A 1WT3A 1WT0A 4KC2A 3IOJA 1VH3A 1H4DA 5DDTA 1VGZA 1VH1A 3SX3A 1H7HA 2AM4A 2X5ZA 1G2VA 1ZCUA 2P73A 4FRQA 4M2BA 4FRHA 1R7VA 3I0FA 5EJZA 2RJ4A 4KT7A 3T7NA 3TQDA 5C4BA 1R7UA 5CQNX 1XHBA 3I0JA 2RIZA 4KPZA 4KPXA 5IFYA 1LL0A 4HCQA 2V0JA 3SXCA 1ZCYA 5C4CA 1G97A 3R3IA 5CMGX 4XWIA 4FRMA 1LZIA 2I5EA 1I52A 2AM5A 4DDZA 1MP5A 3CU0A 1VPAA 5AJPA 4M2AA 3SXEA 4JD0A 4FCUA 1H5SB 5C3DA 4B5BA 1H3MA 4R7PA 4KRVA 3D5NA 3D8VA 5EIYA 3ZLKA 4KNXA 1VM8A 1G95A 3E25A 2FFUA 2X65A 1R81A 3F1YA 1K4VA 1S4NA 1R7YA 2VS4A 1E5KA 1VGUA 3JTJA 4KC4A 3BRKX 1WSZA 2ZU8A 2BO6A 2WVMA 2V0IA 1WT2A 2BO8A 2PA4A 4D0ZA 4ASJA 4YS8A 5FU8A 1V82A 1SS9A 1VICA 5CQMX 4B2XA 4KC1A 1G1LA 2VS5A 2OI5A 4HO0A 2APCA 3SXBA 1EYRA 1GQCA 3DJ4A 3V90A 5C4FA 2YCMA 4AC3A 1H4CA 2AM3A 3ZF8A 4BMAA 5C36A 2E3DA 4Q7CA 4G3PA 2I7BA 2E8BA 4FCEA 2ICXA 4FIXA 4J18A 3T7MA 2YQJA 5FV9A 1ZI5A 2WVLA 3U2XA 2BO4A 2WVKA 2AGDA 2FYCB 3V8YA 1ZDFA 3USQA 4B4BA 4DE7A 3SXGA 3V0NA 5IDSA 3OH1A 1JYLA 1WT1A 5CQOA 1O7QA 2JCKA 5CQPA 3JUJA 1H5SA 2VSHA 3I0GA 4NAIA 2D7RA 2Q4JA 4Y7GA 1OMXA 5AJNA 3CKVA 3PKQA 2RIYA 4L41C 2VFZA 2C0NA 4FRLA 1FO9A 1HV9A 5FTVA 4EVWA 2Y4MA 2ICYA 4HOCA 3PNNA 3I0CA 2RIXA 1GX4A 4HO8A 4KXOA 1ZJ3A 2QGIA 1XZ6A 2QH5A 3CKNA 3SXAA 4CJ8A 2YC5A 3POLA 2O1FA 4MYBA 1LZJA 1ZJPA 2AE7A 1MP3A 4EE3A 1JVDA 3RMVA 4FROA 1HJJA 2YQSA 4FIYA 1YP4A 1H5SD 2JCJA 2WGZA 4Y63A 1VGWA 3OGZA 3I0DA 1H7LA 1ZI4A 4HO4A 4M4KA 4Y6NA 5C3AA 5FYEA 1FWYA 3OH3A 3F1CA 2VD4A 4ARWA 2Z87A 2RJ9A 3DUVA 4Y7TA 1S4OA 4AYLA 3E26A 4O6NA 2VXMA 1YROB 3USRA 4O6MA 1INJA 4Y64A 1INIA 1LL3A 4Y6UA 1R7TA 5FUHA 2XWMA 1FG5N 1W55A 2RJ5A 2WEEA 2OEGA 3OAMA 4K6RA 1ON8A 1FGXA 1TVYA 5FU0A 1W57A 2J0AA 4FRPA 1OQMB 4FQWA 4D11A 4E1KA 1HM0A 5L6SA 4M28A 5I1FA 2RJ0A 5AJOA 1GX0A 4JISA 4FRDA 3Q4SA 1VZUA 3QVBA 4MIXA 4BQHA 2XWLA 1FR9A 4B4MA 2WAWA 5C1GA 5CMHA 2RJ6A 3K8EA 4G87A 4Y9XA 4Y62A 1VZTA 4CVHA 3R2WA 1ZDGA 3T7OA 1NMMB 1HM9A 2J0BA 1JVGA 3ZGFA 4LW6A 2BO7A
chains in the Genus database with same CATH topology
3GUEA 5D91A 4HO2A 1H7QA 2PGVA 1H7GA 3OH2A 5BXCA 1ZCVA 1FXJA 2AH9A 3U2UA 3I0EA 2A8WA 4CJCA 2V0LA 3U2WA 1GQ9A 1H5TB 3JUKA 1R80A 2FFVA 2P72A 2O1GA 3DK5A 2D7IA 3IOIA 4FRBA 5CMFX 3SXDA 1V84A 4P02A 4HO5A 3BCVA 3Q7UA 4EE5A 5IDTA 5J49A 1ZI1A 1LVWA 3V8ZA 2DPWA 2FYAA 3FOQA 5CMJA 4CJBA 3CKJA 3I0KA 1H7TA 3KIAA 4NAKA 4LW3A 1R82A 4ZDQA 1FGGA 1IINA 2NXVA 2RJ7A 5JQQA 1FOAA 4NANA 1JV3A 2GGQA 2JCOA 1G23A 3D98A 3U2TA 4B3UA 1MP4A 4FREA 3SX7A 1S4PA 5CQLX 1PZTA 1H5RB 1WVCA 2CU2A 2WE9A 5DDVA 5C49A 2P6WA 3EE5A 2OEFA 1H7EA 2VXLA 4KNRA 1TZFA 4C2SA 3TZTA 2OI7A 4HO9A 2X60A 3SX5A 2FYBA 3OC9A 3SPTA 2Y6PA 3OH4A 3V0LA 3PKPA 4AYJA 5EJ1A 3LW6A 1OMZA 1NWGB 2AESA 1JV1A 3IOHA 1PZYB 4UEGA 5C47A 1JYKA 4ECMA 2VSIA 5C3BA 1G93A 2A8UA 3I0IX 1NQIB 1G9RA 1TW5A 2XMEA 4KQLA 3ZGGA 1YP2A 2V0HA 5CMIA 4EEGA 3CKOA 1R7XA 2FY7A 1ON6A 2RJ8A 2YQCA 1ZJOA 1VGTA 1H5TA 4D48A 3ST8A 1QWJA 5C4DA 2GGOA 4Y7FA 1GWVA 2V0KA 4P00A 5FTSA 3U2VA 2MZBA 4D0TA 3HL3A 1Z90A 2VS3A 1H5SC 5D92A 1G3LA 3I0HA 3V0OA 2YC3A 1ZIZA 1ZHJA 3CGXA 2Y4KA 2YESA 1YP3A 3NGWA 4ASYA 2Y4JA 1HM8A 1ZJ0A 1QG8A 1FZWA 1NF5B 2XWNA 2PX7A 3U0YA 1O23B 3CKQA 2D0JA 3K8DA 2OI6A 5C4EA 1ZI3A 4NALA 3V91A 3OKRA 1TW1A 4G3QA 1NKHB 1H5RA 1ZJ2A 2X5SA 3SX8A 5L6VA 1ZCTA 3Q80A 1FO8A 2ZU9A 3FWWA 1FXOA 2Y4LA 4EEOA 2XMHA 3RMWA 1GWWA 1O7OA 3ZLLA 1LZ7A 2W0WA 1H4EA 4MNDA 1O0RA 5C1HA 2ZU7A 4HG6A 1V83A 1GA8A 4DECA 2O1HA 4EE4A 4HO3A 4B4GA 4B42A 1LL2A 1G8OA 1QGQA 2Y7AA 1NHEB 3N9WA 4FRAA 1HJLA 2I5KA 1W77A 4EEAA 2W0VA 1KWSA 1MC3A 2RJ1A 4GBPA 2RITA 1LZ0A 5C48A 2VK9A 3V0QA 3I0LA 2PGYA 1IIMA 2YQHA 2Z86A 3RSBA 5C8RA 4IRQA 1FR8A 1EZIA 2FYDB 2QKXA 2UX8A 3U0XA 4IRPA 3V0MA 5C38A 1FRWA 1ZJ1A 4Y7VA 5HS2A 2JCLA 3V0PA 4HO6A 4Y7UA 4EEMA 4AAWA 1G0RA 1QGSA 2AECA 4D11C 3O3PA 1H7FA 4G3SA 5C1LA 4B2WA 1VZXA 3OH0A 1WT3A 1WT0A 4KC2A 3IOJA 1VH3A 1H4DA 5DDTA 1VGZA 1VH1A 3SX3A 1H7HA 2AM4A 2X5ZA 1G2VA 1ZCUA 2P73A 4FRQA 4M2BA 4FRHA 1R7VA 3I0FA 5EJZA 2RJ4A 4KT7A 3T7NA 3TQDA 5C4BA 1R7UA 5CQNX 1XHBA 3I0JA 2RIZA 4KPZA 4KPXA 5IFYA 1LL0A 4HCQA 2V0JA 3SXCA 1ZCYA 5C4CA 1G97A 3R3IA 5CMGX 4XWIA 4FRMA 1LZIA 2I5EA 1I52A 2AM5A 4DDZA 1MP5A 3CU0A 1VPAA 5AJPA 4M2AA 3SXEA 4JD0A 4FCUA 1H5SB 5C3DA 4B5BA 1H3MA 4R7PA 4KRVA 3D5NA 3D8VA 5EIYA 3ZLKA 4KNXA 1VM8A 1G95A 3E25A 2FFUA 2X65A 1R81A 3F1YA 1K4VA 1S4NA 1R7YA 2VS4A 1E5KA 1VGUA 3JTJA 4KC4A 3BRKX 1WSZA 2ZU8A 2BO6A 2WVMA 2V0IA 1WT2A 2BO8A 2PA4A 4D0ZA 4ASJA 4YS8A 5FU8A 1V82A 1SS9A 1VICA 5CQMX 4B2XA 4KC1A 1G1LA 2VS5A 2OI5A 4HO0A 2APCA 3SXBA 1EYRA 1GQCA 3DJ4A 3V90A 5C4FA 2YCMA 4AC3A 1H4CA 2AM3A 3ZF8A 4BMAA 5C36A 2E3DA 4Q7CA 4G3PA 2I7BA 2E8BA 4FCEA 2ICXA 4FIXA 4J18A 3T7MA 2YQJA 5FV9A 1ZI5A 2WVLA 3U2XA 2BO4A 2WVKA 2AGDA 2FYCB 3V8YA 1ZDFA 3USQA 4B4BA 4DE7A 3SXGA 3V0NA 5IDSA 3OH1A 1JYLA 1WT1A 5CQOA 1O7QA 2JCKA 5CQPA 3JUJA 1H5SA 2VSHA 3I0GA 4NAIA 2D7RA 2Q4JA 4Y7GA 1OMXA 5AJNA 3CKVA 3PKQA 2RIYA 4L41C 2VFZA 2C0NA 4FRLA 1FO9A 1HV9A 5FTVA 4EVWA 2Y4MA 2ICYA 4HOCA 3PNNA 3I0CA 2RIXA 1GX4A 4HO8A 4KXOA 1ZJ3A 2QGIA 1XZ6A 2QH5A 3CKNA 3SXAA 4CJ8A 2YC5A 3POLA 2O1FA 4MYBA 1LZJA 1ZJPA 2AE7A 1MP3A 4EE3A 1JVDA 3RMVA 4FROA 1HJJA 2YQSA 4FIYA 1YP4A 1H5SD 2JCJA 2WGZA 4Y63A 1VGWA 3OGZA 3I0DA 1H7LA 1ZI4A 4HO4A 4M4KA 4Y6NA 5C3AA 5FYEA 1FWYA 3OH3A 3F1CA 2VD4A 4ARWA 2Z87A 2RJ9A 3DUVA 4Y7TA 1S4OA 4AYLA 3E26A 4O6NA 2VXMA 1YROB 3USRA 4O6MA 1INJA 4Y64A 1INIA 1LL3A 4Y6UA 1R7TA 5FUHA 2XWMA 1FG5N 1W55A 2RJ5A 2WEEA 2OEGA 3OAMA 4K6RA 1ON8A 1FGXA 1TVYA 5FU0A 1W57A 2J0AA 4FRPA 1OQMB 4FQWA 4D11A 4E1KA 1HM0A 5L6SA 4M28A 5I1FA 2RJ0A 5AJOA 1GX0A 4JISA 4FRDA 3Q4SA 1VZUA 3QVBA 4MIXA 4BQHA 2XWLA 1FR9A 4B4MA 2WAWA 5C1GA 5CMHA 2RJ6A 3K8EA 4G87A 4Y9XA 4Y62A 1VZTA 4CVHA 3R2WA 1ZDGA 3T7OA 1NMMB 1HM9A 2J0BA 1JVGA 3ZGFA 4LW6A 2BO7A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3GUE A;  4HO2 A;  1H7Q A;  2PGV A;  1H7G A;  3OH2 A;  5BXC A;  1ZCV A;  1FXJ A;  2AH9 A;  3U2U A;  3I0E A;  2A8W A;  4CJC A;  2V0L A;  3U2W A;  1GQ9 A;  1H5T B;  3JUK A;  1R80 A;  2FFV A;  2P72 A;  2O1G A;  3DK5 A;  2D7I A;  3IOI A;  4FRB A;  5CMF X;  3SXD A;  1V84 A;  4P02 A;  4HO5 A;  3BCV A;  3Q7U A;  4EE5 A;  5IDT A;  5J49 A;  1ZI1 A;  1LVW A;  3V8Z A;  2DPW A;  2FYA A;  3FOQ A;  5CMJ A;  4CJB A;  3CKJ A;  3I0K A;  1H7T A;  3KIA A;  4NAK A;  4LW3 A;  1R82 A;  4ZDQ A;  1FGG A;  1IIN A;  2NXV A;  2RJ7 A;  5JQQ A;  1FOA A;  4NAN A;  1JV3 A;  2GGQ A;  2JCO A;  1G23 A;  3D98 A;  3U2T A;  4B3U A;  1MP4 A;  4FRE A;  3SX7 A;  1S4P A;  5CQL X;  1PZT A;  1H5R B;  1WVC A;  2CU2 A;  2WE9 A;  5DDV A;  5C49 A;  2P6W A;  3EE5 A;  2OEF A;  1H7E A;  2VXL A;  4KNR A;  1TZF A;  4C2S A;  3TZT A;  2OI7 A;  4HO9 A;  2X60 A;  3SX5 A;  2FYB A;  3OC9 A;  3SPT A;  2Y6P A;  3OH4 A;  3V0L A;  3PKP A;  4AYJ A;  5EJ1 A;  3LW6 A;  1OMZ A;  1NWG B;  2AES A;  1JV1 A;  3IOH A;  1PZY B;  4UEG A;  5C47 A;  1JYK A;  4ECM A;  2VSI A;  5C3B A;  1G93 A;  2A8U A;  3I0I X;  1NQI B;  1G9R A;  1TW5 A;  2XME A;  4KQL A;  3ZGG A;  1YP2 A;  2V0H A;  5CMI A;  4EEG A;  3CKO A;  1R7X A;  2FY7 A;  1ON6 A;  2RJ8 A;  2YQC A;  1ZJO A;  1VGT A;  1H5T A;  4D48 A;  3ST8 A;  1QWJ A;  5C4D A;  2GGO A;  4Y7F A;  1GWV A;  2V0K A;  4P00 A;  5FTS A;  3U2V A;  2MZB A;  4D0T A;  3HL3 A;  1Z90 A;  2VS3 A;  1H5S C;  1G3L A;  3I0H A;  3V0O A;  2YC3 A;  1ZIZ A;  1ZHJ A;  3CGX A;  2Y4K A;  2YES A;  1YP3 A;  3NGW A;  4ASY A;  2Y4J A;  1HM8 A;  1ZJ0 A;  1QG8 A;  1FZW A;  1NF5 B;  2XWN A;  2PX7 A;  3U0Y A;  1O23 B;  3CKQ A;  2D0J A;  3K8D A;  2OI6 A;  5C4E A;  1ZI3 A;  4NAL A;  3V91 A;  3OKR A;  1TW1 A;  4G3Q A;  1NKH B;  1H5R A;  1ZJ2 A;  2X5S A;  3SX8 A;  5L6V A;  1ZCT A;  3Q80 A;  1FO8 A;  2ZU9 A;  3FWW A;  1FXO A;  2Y4L A;  4EEO A;  2XMH A;  3RMW A;  1GWW A;  1O7O A;  3ZLL A;  1LZ7 A;  2W0W A;  1H4E A;  4MND A;  1O0R A;  5C1H A;  2ZU7 A;  4HG6 A;  1V83 A;  1GA8 A;  4DEC A;  2O1H A;  4EE4 A;  4HO3 A;  4B4G A;  4B42 A;  1LL2 A;  1G8O A;  1QGQ A;  2Y7A A;  1NHE B;  3N9W A;  4FRA A;  1HJL A;  2I5K A;  1W77 A;  4EEA A;  2W0V A;  1KWS A;  1MC3 A;  2RJ1 A;  4GBP A;  2RIT A;  1LZ0 A;  5C48 A;  3V0Q A;  3I0L A;  2PGY A;  1IIM A;  2YQH A;  2Z86 A;  3RSB A;  5C8R A;  4IRQ A;  1FR8 A;  1EZI A;  2FYD B;  2QKX A;  2UX8 A;  3U0X A;  4IRP A;  3V0M A;  5C38 A;  1FRW A;  1ZJ1 A;  4Y7V A;  5HS2 A;  2JCL A;  3V0P A;  4HO6 A;  4Y7U A;  4EEM A;  4AAW A;  1G0R A;  1QGS A;  2AEC A;  4D11 C;  3O3P A;  1H7F A;  4G3S A;  5C1L A;  4B2W A;  1VZX A;  3OH0 A;  1WT3 A;  1WT0 A;  4KC2 A;  3IOJ A;  1VH3 A;  1H4D A;  5DDT A;  1VGZ A;  1VH1 A;  3SX3 A;  1H7H A;  2AM4 A;  2X5Z A;  1G2V A;  1ZCU A;  2P73 A;  4FRQ A;  4M2B A;  4FRH A;  1R7V A;  3I0F A;  5EJZ A;  2RJ4 A;  4KT7 A;  3T7N A;  3TQD A;  5C4B A;  1R7U A;  5CQN X;  1XHB A;  3I0J A;  2RIZ A;  4KPZ A;  4KPX A;  5IFY A;  1LL0 A;  4HCQ A;  2V0J A;  3SXC A;  1ZCY A;  5C4C A;  1G97 A;  3R3I A;  5CMG X;  4XWI A;  4FRM A;  1LZI A;  2I5E A;  1I52 A;  2AM5 A;  4DDZ A;  1MP5 A;  3CU0 A;  1VPA A;  5AJP A;  4M2A A;  3SXE A;  4JD0 A;  4FCU A;  1H5S B;  5C3D A;  4B5B A;  1H3M A;  4R7P A;  4KRV A;  3D5N A;  3D8V A;  5EIY A;  3ZLK A;  4KNX A;  1VM8 A;  1G95 A;  3E25 A;  2FFU A;  2X65 A;  1R81 A;  3F1Y A;  1K4V A;  1S4N A;  1R7Y A;  2VS4 A;  1E5K A;  1VGU A;  3JTJ A;  4KC4 A;  3BRK X;  1WSZ A;  2ZU8 A;  2BO6 A;  2WVM A;  2V0I A;  1WT2 A;  2BO8 A;  2PA4 A;  4D0Z A;  4ASJ A;  4YS8 A;  5FU8 A;  1V82 A;  1SS9 A;  1VIC A;  5CQM X;  4B2X A;  4KC1 A;  1G1L A;  2VS5 A;  2OI5 A;  4HO0 A;  2APC A;  3SXB A;  1EYR A;  1GQC A;  3DJ4 A;  3V90 A;  5C4F A;  2YCM A;  4AC3 A;  1H4C A;  2AM3 A;  3ZF8 A;  4BMA A;  5C36 A;  2E3D A;  4G3P A;  2I7B A;  2E8B A;  4FCE A;  2ICX A;  4J18 A;  3T7M A;  2YQJ A;  5FV9 A;  1ZI5 A;  2WVL A;  3U2X A;  2BO4 A;  2WVK A;  2AGD A;  2FYC B;  3V8Y A;  1ZDF A;  3USQ A;  4B4B A;  4DE7 A;  3SXG A;  3V0N A;  5IDS A;  3OH1 A;  1JYL A;  1WT1 A;  5CQO A;  1O7Q A;  2JCK A;  5CQP A;  3JUJ A;  1H5S A;  2VSH A;  3I0G A;  4NAI A;  2D7R A;  2Q4J A;  4Y7G A;  1OMX A;  5AJN A;  3CKV A;  3PKQ A;  2RIY A;  4L41 C;  2VFZ A;  4FRL A;  1FO9 A;  1HV9 A;  5FTV A;  4EVW A;  2Y4M A;  2ICY A;  4HOC A;  3PNN A;  3I0C A;  2RIX A;  1GX4 A;  4HO8 A;  4KXO A;  1ZJ3 A;  2QGI A;  1XZ6 A;  2QH5 A;  3CKN A;  3SXA A;  4CJ8 A;  2YC5 A;  3POL A;  2O1F A;  4MYB A;  1LZJ A;  1ZJP A;  2AE7 A;  1MP3 A;  4EE3 A;  1JVD A;  3RMV A;  4FRO A;  1HJJ A;  2YQS A;  1YP4 A;  1H5S D;  2JCJ A;  2WGZ A;  4Y63 A;  1VGW A;  3OGZ A;  3I0D A;  1H7L A;  1ZI4 A;  4HO4 A;  4M4K A;  4Y6N A;  5C3A A;  5FYE A;  1FWY A;  3OH3 A;  3F1C A;  2VD4 A;  4ARW A;  2Z87 A;  2RJ9 A;  3DUV A;  4Y7T A;  1S4O A;  4AYL A;  3E26 A;  2VXM A;  1YRO B;  3USR A;  1INJ A;  4Y64 A;  1INI A;  1LL3 A;  4Y6U A;  1R7T A;  5FUH A;  2XWM A;  1FG5 N;  1W55 A;  2RJ5 A;  2WEE A;  2OEG A;  3OAM A;  4K6R A;  1ON8 A;  1FGX A;  1TVY A;  5FU0 A;  1W57 A;  4FRP A;  1OQM B;  4FQW A;  4D11 A;  4E1K A;  1HM0 A;  5L6S A;  4M28 A;  5I1F A;  2RJ0 A;  5AJO A;  1GX0 A;  4JIS A;  4FRD A;  3Q4S A;  1VZU A;  3QVB A;  4BQH A;  2XWL A;  1FR9 A;  4B4M A;  2WAW A;  5C1G A;  5CMH A;  2RJ6 A;  3K8E A;  4G87 A;  4Y9X A;  4Y62 A;  1VZT A;  4CVH A;  3R2W A;  1ZDG A;  3T7O A;  1NMM B;  1HM9 A;  1JVG A;  3ZGF A;  4LW6 A;  2BO7 A; 
#chains in the Genus database with same CATH topology
 3GUE A;  5D91 A;  4HO2 A;  1H7Q A;  2PGV A;  1H7G A;  3OH2 A;  5BXC A;  1ZCV A;  1FXJ A;  2AH9 A;  3U2U A;  3I0E A;  2A8W A;  4CJC A;  2V0L A;  3U2W A;  1GQ9 A;  1H5T B;  3JUK A;  1R80 A;  2FFV A;  2P72 A;  2O1G A;  3DK5 A;  2D7I A;  3IOI A;  4FRB A;  5CMF X;  3SXD A;  1V84 A;  4P02 A;  4HO5 A;  3BCV A;  3Q7U A;  4EE5 A;  5IDT A;  5J49 A;  1ZI1 A;  1LVW A;  3V8Z A;  2DPW A;  2FYA A;  3FOQ A;  5CMJ A;  4CJB A;  3CKJ A;  3I0K A;  1H7T A;  3KIA A;  4NAK A;  4LW3 A;  1R82 A;  4ZDQ A;  1FGG A;  1IIN A;  2NXV A;  2RJ7 A;  5JQQ A;  1FOA A;  4NAN A;  1JV3 A;  2GGQ A;  2JCO A;  1G23 A;  3D98 A;  3U2T A;  4B3U A;  1MP4 A;  4FRE A;  3SX7 A;  1S4P A;  5CQL X;  1PZT A;  1H5R B;  1WVC A;  2CU2 A;  2WE9 A;  5DDV A;  5C49 A;  2P6W A;  3EE5 A;  2OEF A;  1H7E A;  2VXL A;  4KNR A;  1TZF A;  4C2S A;  3TZT A;  2OI7 A;  4HO9 A;  2X60 A;  3SX5 A;  2FYB A;  3OC9 A;  3SPT A;  2Y6P A;  3OH4 A;  3V0L A;  3PKP A;  4AYJ A;  5EJ1 A;  3LW6 A;  1OMZ A;  1NWG B;  2AES A;  1JV1 A;  3IOH A;  1PZY B;  4UEG A;  5C47 A;  1JYK A;  4ECM A;  2VSI A;  5C3B A;  1G93 A;  2A8U A;  3I0I X;  1NQI B;  1G9R A;  1TW5 A;  2XME A;  4KQL A;  3ZGG A;  1YP2 A;  2V0H A;  5CMI A;  4EEG A;  3CKO A;  1R7X A;  2FY7 A;  1ON6 A;  2RJ8 A;  2YQC A;  1ZJO A;  1VGT A;  1H5T A;  4D48 A;  3ST8 A;  1QWJ A;  5C4D A;  2GGO A;  4Y7F A;  1GWV A;  2V0K A;  4P00 A;  5FTS A;  3U2V A;  2MZB A;  4D0T A;  3HL3 A;  1Z90 A;  2VS3 A;  1H5S C;  5D92 A;  1G3L A;  3I0H A;  3V0O A;  2YC3 A;  1ZIZ A;  1ZHJ A;  3CGX A;  2Y4K A;  2YES A;  1YP3 A;  3NGW A;  4ASY A;  2Y4J A;  1HM8 A;  1ZJ0 A;  1QG8 A;  1FZW A;  1NF5 B;  2XWN A;  2PX7 A;  3U0Y A;  1O23 B;  3CKQ A;  2D0J A;  3K8D A;  2OI6 A;  5C4E A;  1ZI3 A;  4NAL A;  3V91 A;  3OKR A;  1TW1 A;  4G3Q A;  1NKH B;  1H5R A;  1ZJ2 A;  2X5S A;  3SX8 A;  5L6V A;  1ZCT A;  3Q80 A;  1FO8 A;  2ZU9 A;  3FWW A;  1FXO A;  2Y4L A;  4EEO A;  2XMH A;  3RMW A;  1GWW A;  1O7O A;  3ZLL A;  1LZ7 A;  2W0W A;  1H4E A;  4MND A;  1O0R A;  5C1H A;  2ZU7 A;  4HG6 A;  1V83 A;  1GA8 A;  4DEC A;  2O1H A;  4EE4 A;  4HO3 A;  4B4G A;  4B42 A;  1LL2 A;  1G8O A;  1QGQ A;  2Y7A A;  1NHE B;  3N9W A;  4FRA A;  1HJL A;  2I5K A;  1W77 A;  4EEA A;  2W0V A;  1KWS A;  1MC3 A;  2RJ1 A;  4GBP A;  2RIT A;  1LZ0 A;  5C48 A;  2VK9 A;  3V0Q A;  3I0L A;  2PGY A;  1IIM A;  2YQH A;  2Z86 A;  3RSB A;  5C8R A;  4IRQ A;  1FR8 A;  1EZI A;  2FYD B;  2QKX A;  2UX8 A;  3U0X A;  4IRP A;  3V0M A;  5C38 A;  1FRW A;  1ZJ1 A;  4Y7V A;  5HS2 A;  2JCL A;  3V0P A;  4HO6 A;  4Y7U A;  4EEM A;  4AAW A;  1G0R A;  1QGS A;  2AEC A;  4D11 C;  3O3P A;  1H7F A;  4G3S A;  5C1L A;  4B2W A;  1VZX A;  3OH0 A;  1WT3 A;  1WT0 A;  4KC2 A;  3IOJ A;  1VH3 A;  1H4D A;  5DDT A;  1VGZ A;  1VH1 A;  3SX3 A;  1H7H A;  2AM4 A;  2X5Z A;  1G2V A;  1ZCU A;  2P73 A;  4FRQ A;  4M2B A;  4FRH A;  1R7V A;  3I0F A;  5EJZ A;  2RJ4 A;  4KT7 A;  3T7N A;  3TQD A;  5C4B A;  1R7U A;  5CQN X;  1XHB A;  3I0J A;  2RIZ A;  4KPZ A;  4KPX A;  5IFY A;  1LL0 A;  4HCQ A;  2V0J A;  3SXC A;  1ZCY A;  5C4C A;  1G97 A;  3R3I A;  5CMG X;  4XWI A;  4FRM A;  1LZI A;  2I5E A;  1I52 A;  2AM5 A;  4DDZ A;  1MP5 A;  3CU0 A;  1VPA A;  5AJP A;  4M2A A;  3SXE A;  4JD0 A;  4FCU A;  1H5S B;  5C3D A;  4B5B A;  1H3M A;  4R7P A;  4KRV A;  3D5N A;  3D8V A;  5EIY A;  3ZLK A;  4KNX A;  1VM8 A;  1G95 A;  3E25 A;  2FFU A;  2X65 A;  1R81 A;  3F1Y A;  1K4V A;  1S4N A;  1R7Y A;  2VS4 A;  1E5K A;  1VGU A;  3JTJ A;  4KC4 A;  3BRK X;  1WSZ A;  2ZU8 A;  2BO6 A;  2WVM A;  2V0I A;  1WT2 A;  2BO8 A;  2PA4 A;  4D0Z A;  4ASJ A;  4YS8 A;  5FU8 A;  1V82 A;  1SS9 A;  1VIC A;  5CQM X;  4B2X A;  4KC1 A;  1G1L A;  2VS5 A;  2OI5 A;  4HO0 A;  2APC A;  3SXB A;  1EYR A;  1GQC A;  3DJ4 A;  3V90 A;  5C4F A;  2YCM A;  4AC3 A;  1H4C A;  2AM3 A;  3ZF8 A;  4BMA A;  5C36 A;  2E3D A;  4Q7C A;  4G3P A;  2I7B A;  2E8B A;  4FCE A;  2ICX A;  4FIX A;  4J18 A;  3T7M A;  2YQJ A;  5FV9 A;  1ZI5 A;  2WVL A;  3U2X A;  2BO4 A;  2WVK A;  2AGD A;  2FYC B;  3V8Y A;  1ZDF A;  3USQ A;  4B4B A;  4DE7 A;  3SXG A;  3V0N A;  5IDS A;  3OH1 A;  1JYL A;  1WT1 A;  5CQO A;  1O7Q A;  2JCK A;  5CQP A;  3JUJ A;  1H5S A;  2VSH A;  3I0G A;  4NAI A;  2D7R A;  2Q4J A;  4Y7G A;  1OMX A;  5AJN A;  3CKV A;  3PKQ A;  2RIY A;  4L41 C;  2VFZ A;  2C0N A;  4FRL A;  1FO9 A;  1HV9 A;  5FTV A;  4EVW A;  2Y4M A;  2ICY A;  4HOC A;  3PNN A;  3I0C A;  2RIX A;  1GX4 A;  4HO8 A;  4KXO A;  1ZJ3 A;  2QGI A;  1XZ6 A;  2QH5 A;  3CKN A;  3SXA A;  4CJ8 A;  2YC5 A;  3POL A;  2O1F A;  4MYB A;  1LZJ A;  1ZJP A;  2AE7 A;  1MP3 A;  4EE3 A;  1JVD A;  3RMV A;  4FRO A;  1HJJ A;  2YQS A;  4FIY A;  1YP4 A;  1H5S D;  2JCJ A;  2WGZ A;  4Y63 A;  1VGW A;  3OGZ A;  3I0D A;  1H7L A;  1ZI4 A;  4HO4 A;  4M4K A;  4Y6N A;  5C3A A;  5FYE A;  1FWY A;  3OH3 A;  3F1C A;  2VD4 A;  4ARW A;  2Z87 A;  2RJ9 A;  3DUV A;  4Y7T A;  1S4O A;  4AYL A;  3E26 A;  4O6N A;  2VXM A;  1YRO B;  3USR A;  4O6M A;  1INJ A;  4Y64 A;  1INI A;  1LL3 A;  4Y6U A;  1R7T A;  5FUH A;  2XWM A;  1FG5 N;  1W55 A;  2RJ5 A;  2WEE A;  2OEG A;  3OAM A;  4K6R A;  1ON8 A;  1FGX A;  1TVY A;  5FU0 A;  1W57 A;  2J0A A;  4FRP A;  1OQM B;  4FQW A;  4D11 A;  4E1K A;  1HM0 A;  5L6S A;  4M28 A;  5I1F A;  2RJ0 A;  5AJO A;  1GX0 A;  4JIS A;  4FRD A;  3Q4S A;  1VZU A;  3QVB A;  4MIX A;  4BQH A;  2XWL A;  1FR9 A;  4B4M A;  2WAW A;  5C1G A;  5CMH A;  2RJ6 A;  3K8E A;  4G87 A;  4Y9X A;  4Y62 A;  1VZT A;  4CVH A;  3R2W A;  1ZDG A;  3T7O A;  1NMM B;  1HM9 A;  2J0B A;  1JVG A;  3ZGF A;  4LW6 A;  2BO7 A; 
#chains in the Genus database with same CATH homology
 3GUE A;  5D91 A;  4HO2 A;  1H7Q A;  2PGV A;  1H7G A;  3OH2 A;  5BXC A;  1ZCV A;  1FXJ A;  2AH9 A;  3U2U A;  3I0E A;  2A8W A;  4CJC A;  2V0L A;  3U2W A;  1GQ9 A;  1H5T B;  3JUK A;  1R80 A;  2FFV A;  2P72 A;  2O1G A;  3DK5 A;  2D7I A;  3IOI A;  4FRB A;  5CMF X;  3SXD A;  1V84 A;  4P02 A;  4HO5 A;  3BCV A;  3Q7U A;  4EE5 A;  5IDT A;  5J49 A;  1ZI1 A;  1LVW A;  3V8Z A;  2DPW A;  2FYA A;  3FOQ A;  5CMJ A;  4CJB A;  3CKJ A;  3I0K A;  1H7T A;  3KIA A;  4NAK A;  4LW3 A;  1R82 A;  4ZDQ A;  1FGG A;  1IIN A;  2NXV A;  2RJ7 A;  5JQQ A;  1FOA A;  4NAN A;  1JV3 A;  2GGQ A;  2JCO A;  1G23 A;  3D98 A;  3U2T A;  4B3U A;  1MP4 A;  4FRE A;  3SX7 A;  1S4P A;  5CQL X;  1PZT A;  1H5R B;  1WVC A;  2CU2 A;  2WE9 A;  5DDV A;  5C49 A;  2P6W A;  3EE5 A;  2OEF A;  1H7E A;  2VXL A;  4KNR A;  1TZF A;  4C2S A;  3TZT A;  2OI7 A;  4HO9 A;  2X60 A;  3SX5 A;  2FYB A;  3OC9 A;  3SPT A;  2Y6P A;  3OH4 A;  3V0L A;  3PKP A;  4AYJ A;  5EJ1 A;  3LW6 A;  1OMZ A;  1NWG B;  2AES A;  1JV1 A;  3IOH A;  1PZY B;  4UEG A;  5C47 A;  1JYK A;  4ECM A;  2VSI A;  5C3B A;  1G93 A;  2A8U A;  3I0I X;  1NQI B;  1G9R A;  1TW5 A;  2XME A;  4KQL A;  3ZGG A;  1YP2 A;  2V0H A;  5CMI A;  4EEG A;  3CKO A;  1R7X A;  2FY7 A;  1ON6 A;  2RJ8 A;  2YQC A;  1ZJO A;  1VGT A;  1H5T A;  4D48 A;  3ST8 A;  1QWJ A;  5C4D A;  2GGO A;  4Y7F A;  1GWV A;  2V0K A;  4P00 A;  5FTS A;  3U2V A;  2MZB A;  4D0T A;  3HL3 A;  1Z90 A;  2VS3 A;  1H5S C;  5D92 A;  1G3L A;  3I0H A;  3V0O A;  2YC3 A;  1ZIZ A;  1ZHJ A;  3CGX A;  2Y4K A;  2YES A;  1YP3 A;  3NGW A;  4ASY A;  2Y4J A;  1HM8 A;  1ZJ0 A;  1QG8 A;  1FZW A;  1NF5 B;  2XWN A;  2PX7 A;  3U0Y A;  1O23 B;  3CKQ A;  2D0J A;  3K8D A;  2OI6 A;  5C4E A;  1ZI3 A;  4NAL A;  3V91 A;  3OKR A;  1TW1 A;  4G3Q A;  1NKH B;  1H5R A;  1ZJ2 A;  2X5S A;  3SX8 A;  5L6V A;  1ZCT A;  3Q80 A;  1FO8 A;  2ZU9 A;  3FWW A;  1FXO A;  2Y4L A;  4EEO A;  2XMH A;  3RMW A;  1GWW A;  1O7O A;  3ZLL A;  1LZ7 A;  2W0W A;  1H4E A;  4MND A;  1O0R A;  5C1H A;  2ZU7 A;  4HG6 A;  1V83 A;  1GA8 A;  4DEC A;  2O1H A;  4EE4 A;  4HO3 A;  4B4G A;  4B42 A;  1LL2 A;  1G8O A;  1QGQ A;  2Y7A A;  1NHE B;  3N9W A;  4FRA A;  1HJL A;  2I5K A;  1W77 A;  4EEA A;  2W0V A;  1KWS A;  1MC3 A;  2RJ1 A;  4GBP A;  2RIT A;  1LZ0 A;  5C48 A;  2VK9 A;  3V0Q A;  3I0L A;  2PGY A;  1IIM A;  2YQH A;  2Z86 A;  3RSB A;  5C8R A;  4IRQ A;  1FR8 A;  1EZI A;  2FYD B;  2QKX A;  2UX8 A;  3U0X A;  4IRP A;  3V0M A;  5C38 A;  1FRW A;  1ZJ1 A;  4Y7V A;  5HS2 A;  2JCL A;  3V0P A;  4HO6 A;  4Y7U A;  4EEM A;  4AAW A;  1G0R A;  1QGS A;  2AEC A;  4D11 C;  3O3P A;  1H7F A;  4G3S A;  5C1L A;  4B2W A;  1VZX A;  3OH0 A;  1WT3 A;  1WT0 A;  4KC2 A;  3IOJ A;  1VH3 A;  1H4D A;  5DDT A;  1VGZ A;  1VH1 A;  3SX3 A;  1H7H A;  2AM4 A;  2X5Z A;  1G2V A;  1ZCU A;  2P73 A;  4FRQ A;  4M2B A;  4FRH A;  1R7V A;  3I0F A;  5EJZ A;  2RJ4 A;  4KT7 A;  3T7N A;  3TQD A;  5C4B A;  1R7U A;  5CQN X;  1XHB A;  3I0J A;  2RIZ A;  4KPZ A;  4KPX A;  5IFY A;  1LL0 A;  4HCQ A;  2V0J A;  3SXC A;  1ZCY A;  5C4C A;  1G97 A;  3R3I A;  5CMG X;  4XWI A;  4FRM A;  1LZI A;  2I5E A;  1I52 A;  2AM5 A;  4DDZ A;  1MP5 A;  3CU0 A;  1VPA A;  5AJP A;  4M2A A;  3SXE A;  4JD0 A;  4FCU A;  1H5S B;  5C3D A;  4B5B A;  1H3M A;  4R7P A;  4KRV A;  3D5N A;  3D8V A;  5EIY A;  3ZLK A;  4KNX A;  1VM8 A;  1G95 A;  3E25 A;  2FFU A;  2X65 A;  1R81 A;  3F1Y A;  1K4V A;  1S4N A;  1R7Y A;  2VS4 A;  1E5K A;  1VGU A;  3JTJ A;  4KC4 A;  3BRK X;  1WSZ A;  2ZU8 A;  2BO6 A;  2WVM A;  2V0I A;  1WT2 A;  2BO8 A;  2PA4 A;  4D0Z A;  4ASJ A;  4YS8 A;  5FU8 A;  1V82 A;  1SS9 A;  1VIC A;  5CQM X;  4B2X A;  4KC1 A;  1G1L A;  2VS5 A;  2OI5 A;  4HO0 A;  2APC A;  3SXB A;  1EYR A;  1GQC A;  3DJ4 A;  3V90 A;  5C4F A;  2YCM A;  4AC3 A;  1H4C A;  2AM3 A;  3ZF8 A;  4BMA A;  5C36 A;  2E3D A;  4Q7C A;  4G3P A;  2I7B A;  2E8B A;  4FCE A;  2ICX A;  4FIX A;  4J18 A;  3T7M A;  2YQJ A;  5FV9 A;  1ZI5 A;  2WVL A;  3U2X A;  2BO4 A;  2WVK A;  2AGD A;  2FYC B;  3V8Y A;  1ZDF A;  3USQ A;  4B4B A;  4DE7 A;  3SXG A;  3V0N A;  5IDS A;  3OH1 A;  1JYL A;  1WT1 A;  5CQO A;  1O7Q A;  2JCK A;  5CQP A;  3JUJ A;  1H5S A;  2VSH A;  3I0G A;  4NAI A;  2D7R A;  2Q4J A;  4Y7G A;  1OMX A;  5AJN A;  3CKV A;  3PKQ A;  2RIY A;  4L41 C;  2VFZ A;  2C0N A;  4FRL A;  1FO9 A;  1HV9 A;  5FTV A;  4EVW A;  2Y4M A;  2ICY A;  4HOC A;  3PNN A;  3I0C A;  2RIX A;  1GX4 A;  4HO8 A;  4KXO A;  1ZJ3 A;  2QGI A;  1XZ6 A;  2QH5 A;  3CKN A;  3SXA A;  4CJ8 A;  2YC5 A;  3POL A;  2O1F A;  4MYB A;  1LZJ A;  1ZJP A;  2AE7 A;  1MP3 A;  4EE3 A;  1JVD A;  3RMV A;  4FRO A;  1HJJ A;  2YQS A;  4FIY A;  1YP4 A;  1H5S D;  2JCJ A;  2WGZ A;  4Y63 A;  1VGW A;  3OGZ A;  3I0D A;  1H7L A;  1ZI4 A;  4HO4 A;  4M4K A;  4Y6N A;  5C3A A;  5FYE A;  1FWY A;  3OH3 A;  3F1C A;  2VD4 A;  4ARW A;  2Z87 A;  2RJ9 A;  3DUV A;  4Y7T A;  1S4O A;  4AYL A;  3E26 A;  4O6N A;  2VXM A;  1YRO B;  3USR A;  4O6M A;  1INJ A;  4Y64 A;  1INI A;  1LL3 A;  4Y6U A;  1R7T A;  5FUH A;  2XWM A;  1FG5 N;  1W55 A;  2RJ5 A;  2WEE A;  2OEG A;  3OAM A;  4K6R A;  1ON8 A;  1FGX A;  1TVY A;  5FU0 A;  1W57 A;  2J0A A;  4FRP A;  1OQM B;  4FQW A;  4D11 A;  4E1K A;  1HM0 A;  5L6S A;  4M28 A;  5I1F A;  2RJ0 A;  5AJO A;  1GX0 A;  4JIS A;  4FRD A;  3Q4S A;  1VZU A;  3QVB A;  4MIX A;  4BQH A;  2XWL A;  1FR9 A;  4B4M A;  2WAW A;  5C1G A;  5CMH A;  2RJ6 A;  3K8E A;  4G87 A;  4Y9X A;  4Y62 A;  1VZT A;  4CVH A;  3R2W A;  1ZDG A;  3T7O A;  1NMM B;  1HM9 A;  2J0B A;  1JVG A;  3ZGF A;  4LW6 A;  2BO7 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...