4FRMA

Crystal structure of bbbb+udp+gal at ph 7.0 with mpd as the cryoprotectant
Total Genus 81
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
81
sequence length
275
structure length
264
Chain Sequence
YPQPKVLTPCRKDVLVVTPWLAPIVWEGTFNIDILNEQFRLQNTTIGLTVFAIKKYVAFLKLFLETAEKHFMVGHRVHYYVFTDQPAAVPRVTLGTGRQLSVLEVGRRMEMISGCERRFLSEVDYLVCVDVDMEFRDHVGVEILTPLFGTLHPSFYGSSREAFTYERRPQSQAYIPKDEGDFYYMGAFFGGSVQEVQRLTRACHQAMMVDQANGIEAVWHDESHLNKYLLRHKPTKVLSPEYLWDQQLLGWPAVLRKLRFTAVP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Histo-blood group ABO system transferase
publication title pH-induced conformational changes in human ABO(H) blood group glycosyltransferases confirm the importance of electrostatic interactions in the formation of the semi-closed state.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 81
structure length 264
sequence length 275
ec nomenclature ec 2.4.1.37: Fucosylgalactoside 3-alpha-galactosyltransferase.
pdb deposition date 2012-06-26
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.550.10 Alpha Beta Alpha-Beta Complex Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A 4frmA00
5FUHA 2VSIA 2ICYA 4JISA 1G23A 4KC2A 4CVHA 1VICA 3SX5A 1G8OA 3CKQA 4FRHA 2AM3A 4XWIA 3V0LA 1ZCYA 4FRPA 1XHBA 1ZJ3A 3SXGA 2WAWA 2OEGA 1MC3A 1LL3A 3USRA 2Z86A 1PZYB 1ZJ1A 5C3DA 3CU0A 4Y7VA 4P00A 1FO9A 5CQLX 1VZUA 5C3BA 1HJLA 3Q80A 1R7XA 2VS3A 1MP3A 1V82A 2ZU8A 1H7QA 2PGYA 2UX8A 4C2SA 3SXEA 3PKQA 1ZI4A 3F1CA 1WT3A 2VS4A 4HG6A 3U2UA 4AYJA 1FRWA 4D0ZA 3K8EA 2AM5A 1W57A 1O23B 4HO0A 4B42A 4E1KA 5C38A 1H5TA 1PZTA 4M2BA 1WSZA 1TVYA 2X65A 3U0YA 2AECA 1R7UA 1S4NA 2Y4MA 3GUEA 1XZ6A 2QKXA 2YQHA 1FXOA 4Y7GA 4FRQA 1JYLA 4G87A 3K8DA 4Y6NA 4NALA 1Z90A 2JCLA 1V83A 4D11A 3E25A 3SXDA 5L6VA 4KPXA 1GX4A 5L6SA 4DE7A 3OKRA 2Y4LA 1ZJ0A 5CQOA 1VZTA 2I5KA 1QG8A 2VS5A 1FWYA 1HM0A 1JV3A 1WT2A 4HO6A 1QGSA 2DPWA 5CQMX 1FGGA 1NF5B 1QGQA 2O1FA 5DDVA 1MP5A 5FU8A 1H5TB 1LL2A 4HO8A 1R7TA 2BO8A 2RJ0A 3ZLKA 4FREA 5C4BA 2OI7A 3ST8A 1INJA 1G1LA 1G9RA 3T7MA 4B3UA 4HO9A 5CMGX 4YS8A 5DDTA 4LW6A 1H7GA 1WT1A 4ASYA 2O1HA 4G3SA 2A8WA 3BRKX 3CGXA 3BCVA 4Y7TA 3D5NA 3CKNA 1TZFA 4FROA 2WVMA 4B2XA 5C4EA 4IRPA 4JD0A 3QVBA 1ZI3A 3ZGFA 5CMHA 2RITA 5BXCA 5FTSA 3I0LA 1ZIZA 1GQ9A 3D98A 5CQNX 5FYEA 2AGDA 4FRAA 3V0MA 2YC5A 1LZ7A 4M28A 3SPTA 1G0RA 1HM8A 4CJCA 3ZLLA 3DK5A 2XWLA 3SXAA 1WVCA 4Y7UA 4KQLA 1ON8A 5C1GA 1INIA 3IOIA 4KXOA 3I0DA 5C49A 1H7TA 3SX8A 1TW1A 2VD4A 5C4DA 4EEGA 5C8RA 1H7HA 5AJOA 3OH0A 1FR8A 2X5ZA 4KNXA 2GGOA 3OAMA 1S4OA 4UEGA 3IOHA 2PX7A 4MYBA 4D11C 3FWWA 3U0XA 2YESA 1G93A 1GWVA 1ZJPA 3OH4A 3POLA 3U2XA 2XMEA 1H5SA 4B4BA 2D0JA 3I0FA 2GGQA 2JCKA 2RIYA 4K6RA 2JCOA 2QGIA 3PKPA 4Y62A 1NWGB 1LL0A 1ON6A 3R3IA 1V84A 1FZWA 4ARWA 2P73A 4Y64A 2W0WA 4FQWA 4R7PA 1JYKA 5CQPA 3JUJA 2FFUA 5FTVA 2V0IA 4D0TA 1JVDA 2VFZA 1MP4A 4P02A 1QWJA 2YQCA 2APCA 2OEFA 3FOQA 1H5SD 3CKJA 3SX3A 3OGZA 3I0KA 1LZJA 1GX0A 3V90A 4Y7FA 1G95A 2V0JA 3IOJA 5EJZA 1OMXA 1H5SB 4FRLA 4FRBA 4FCEA 2Y6PA 5C1HA 5C36A 3V8YA 5IFYA 4B5BA 1H7FA 1ZCUA 1GQCA 2FY7A 1ZCTA 2YCMA 2RIZA 3CKOA 1FG5N 1VGZA 2VSHA 3N9WA 4CJ8A 1KWSA 2P6WA 3TQDA 2PGVA 4Y6UA 2MZBA 3RSBA 4EVWA 1VGWA 4Y9XA 3EE5A 1H3MA 3V91A 1SS9A 4G3PA 3USQA 1O7OA 2WGZA 2I5EA 1WT0A 1ZJOA 1YP3A 2V0HA 2XMHA 3V0NA 3RMVA 3OH1A 5HS2A 4HOCA 1EYRA 3PNNA 4AC3A 2RJ5A 2W0VA 4D48A 1H5RB 1ZCVA 2XWNA 5FV9A 4HO4A 3HL3A 4NAKA 1FO8A 1FR9A 2FYAA 2FYDB 3T7NA 1H5SC 1IINA 2I7BA 2PA4A 3OH2A 2RJ8A 2BO4A 3U2WA 1HJJA 4DDZA 2JCJA 1LZIA 1VPAA 1S4PA 1I52A 1E5KA 4HO3A 4AAWA 3ZGGA 1LZ0A 5C1LA 4GBPA 1FOAA 3Q7UA 4ASJA 4L41C 5IDSA 4BQHA 2RJ6A 3JTJA 1O0RA 4KNRA 3KIAA 1G97A 1ZI1A 1TW5A 5I1FA 2OI6A 4ZDQA 3CKVA 2WVKA 1NMMB 5FU0A 3NGWA 4FRMA 1G2VA 1W77A 1FXJA 4EEAA 2OI5A 5C47A 3U2VA 2V0KA 3Q4SA 4HO5A 4EE4A 4EEOA 5C3AA 4DECA 5AJPA 1H4EA 2E8BA 1HM9A 4ECMA 1IIMA 3E26A 1YP2A 3V0PA 3D8VA 1VGTA 2P72A 5EJ1A 1OMZA 2NXVA 5CMIA 4IRQA 1GA8A 3ZF8A 1R80A 1H7LA 2BO7A 2VXMA 1VH3A 3F1YA 4LW3A 4AYLA 5C48A 3JUKA 3I0GA 2V0LA 3O3PA 2YC3A 4CJBA 2QH5A 4HCQA 2FFVA 5J49A 2RJ4A 4M2AA 1W55A 1VH1A 1NQIB 1H5RA 2Y7AA 4NAIA 2ZU7A 4J18A 5JQQA 1JVGA 2A8UA 2Q4JA 4FRDA 3U2TA 4EE3A 2AH9A 5C4FA 1H4CA 3OH3A 1FGXA 4KC4A 3I0HA 2ICXA 4G3QA 4NANA 3T7OA 2WE9A 3I0IX 1LVWA 2WVLA 2X60A 2D7RA 1ZI5A 1OQMB 1GWWA 4KPZA 2CU2A 1R7VA 1K4VA 5AJNA 1ZDFA 3V0QA 1VM8A 1NKHB 1R81A 2X5SA 1H7EA 4KRVA 3RMWA 2O1GA 1ZHJA 3I0JA 1ZDGA 1G3LA 2VXLA 4KT7A 4EEMA 1HV9A 5C4CA 4B4MA 1YP4A 2RJ1A 3I0EA 4MNDA 2Y4KA 3LW6A 1NHEB 2WEEA 3SXCA 2FYCB 2FYBA 4FCUA 3TZTA 1H4DA 4M4KA 2AESA 2D7IA 2XWMA 4B2WA 2E3DA 2RJ9A 4KC1A 2ZU9A 1O7QA 2RIXA 3DUVA 3SX7A 3SXBA 3I0CA 2AE7A 5CMJA 4Y63A 1VGUA 2RJ7A 3R2WA 4BMAA 1ZJ2A 5EIYA 2Z87A 4HO2A 3OC9A 4EE5A 1R7YA 5CMFX 3V8ZA 2Y4JA 5IDTA 2BO6A 2AM4A 4B4GA 1JV1A 1VZXA 1EZIA 2YQJA 3DJ4A 1R82A 2YQSA 1YROB 3V0OA
chains in the Genus database with same CATH superfamily
5FUHA 2VSIA 2ICYA 4JISA 1G23A 4KC2A 4CVHA 1VICA 3SX5A 1G8OA 3CKQA 4FRHA 2AM3A 4XWIA 3V0LA 1ZCYA 4FRPA 1XHBA 1ZJ3A 5D91A 3SXGA 2WAWA 2OEGA 1MC3A 1LL3A 3USRA 2Z86A 1PZYB 1ZJ1A 5C3DA 3CU0A 4Y7VA 4P00A 1FO9A 5CQLX 1VZUA 5C3BA 1HJLA 2J0AA 3Q80A 1R7XA 2VS3A 1MP3A 1V82A 2ZU8A 1H7QA 2PGYA 2UX8A 4C2SA 3SXEA 3PKQA 1ZI4A 3F1CA 1WT3A 2VS4A 4HG6A 3U2UA 4AYJA 1FRWA 4D0ZA 3K8EA 2AM5A 1W57A 1O23B 4HO0A 4B42A 4E1KA 5C38A 1H5TA 1PZTA 4M2BA 1WSZA 1TVYA 2X65A 3U0YA 2AECA 1R7UA 1S4NA 2Y4MA 3GUEA 1XZ6A 2QKXA 2YQHA 1FXOA 4Y7GA 4FRQA 1JYLA 4G87A 3K8DA 4Y6NA 2J0BA 4NALA 1Z90A 2JCLA 1V83A 4D11A 3E25A 3SXDA 5L6VA 4KPXA 1GX4A 5L6SA 4DE7A 3OKRA 2Y4LA 1ZJ0A 5CQOA 1VZTA 2I5KA 1QG8A 2VS5A 1FWYA 1HM0A 1JV3A 1WT2A 4HO6A 1QGSA 2DPWA 5CQMX 1FGGA 1NF5B 1QGQA 2O1FA 5DDVA 1MP5A 5FU8A 1H5TB 1LL2A 4HO8A 1R7TA 2BO8A 2RJ0A 3ZLKA 4FREA 5C4BA 2OI7A 2C0NA 3ST8A 1INJA 1G1LA 1G9RA 3T7MA 4B3UA 4HO9A 5CMGX 4YS8A 5DDTA 4LW6A 1H7GA 1WT1A 4ASYA 2O1HA 4G3SA 2A8WA 3BRKX 3CGXA 3BCVA 4Y7TA 3D5NA 3CKNA 1TZFA 4FROA 2WVMA 4B2XA 5C4EA 4IRPA 4JD0A 3QVBA 1ZI3A 4Q7CA 3ZGFA 5CMHA 2RITA 5BXCA 5FTSA 3I0LA 1ZIZA 1GQ9A 3D98A 5CQNX 5FYEA 2AGDA 4FRAA 3V0MA 2YC5A 1LZ7A 4M28A 3SPTA 1G0RA 1HM8A 4CJCA 3ZLLA 3DK5A 2XWLA 3SXAA 1WVCA 4Y7UA 4KQLA 1ON8A 5C1GA 1INIA 3IOIA 4KXOA 3I0DA 5C49A 1H7TA 3SX8A 1TW1A 2VD4A 5C4DA 4EEGA 5C8RA 1H7HA 5AJOA 3OH0A 1FR8A 2X5ZA 4KNXA 2GGOA 3OAMA 1S4OA 4UEGA 3IOHA 2PX7A 4MYBA 4D11C 3FWWA 3U0XA 2YESA 1G93A 1GWVA 1ZJPA 3OH4A 3POLA 3U2XA 2XMEA 5D92A 1H5SA 4B4BA 2D0JA 3I0FA 2GGQA 2JCKA 2RIYA 4K6RA 2JCOA 2QGIA 3PKPA 4Y62A 1NWGB 1LL0A 1ON6A 3R3IA 1V84A 1FZWA 4ARWA 2P73A 4Y64A 2W0WA 4FQWA 4R7PA 1JYKA 5CQPA 3JUJA 2FFUA 5FTVA 4MIXA 2V0IA 4D0TA 1JVDA 2VFZA 1MP4A 4P02A 1QWJA 2YQCA 2APCA 2OEFA 3FOQA 1H5SD 3CKJA 3SX3A 3OGZA 3I0KA 1LZJA 1GX0A 3V90A 4Y7FA 1G95A 2V0JA 3IOJA 5EJZA 1OMXA 1H5SB 4FRLA 4FRBA 4FCEA 2Y6PA 5C1HA 5C36A 3V8YA 5IFYA 4B5BA 1H7FA 1ZCUA 1GQCA 2FY7A 1ZCTA 2YCMA 2RIZA 3CKOA 1FG5N 1VGZA 2VSHA 3N9WA 4CJ8A 1KWSA 2P6WA 3TQDA 2PGVA 4Y6UA 2MZBA 3RSBA 4EVWA 1VGWA 4Y9XA 3EE5A 1H3MA 3V91A 1SS9A 4G3PA 3USQA 1O7OA 2WGZA 2I5EA 1WT0A 1ZJOA 1YP3A 4O6NA 2V0HA 2XMHA 3V0NA 3RMVA 3OH1A 5HS2A 4HOCA 1EYRA 3PNNA 4AC3A 2RJ5A 2W0VA 4D48A 1H5RB 1ZCVA 2XWNA 5FV9A 4HO4A 3HL3A 4NAKA 1FO8A 1FR9A 2FYAA 2FYDB 3T7NA 1H5SC 1IINA 2I7BA 2PA4A 3OH2A 2RJ8A 2BO4A 3U2WA 1HJJA 4DDZA 2JCJA 1LZIA 1VPAA 1S4PA 1I52A 1E5KA 4HO3A 4AAWA 3ZGGA 1LZ0A 5C1LA 4GBPA 1FOAA 3Q7UA 4ASJA 4L41C 5IDSA 4BQHA 2RJ6A 3JTJA 1O0RA 4KNRA 3KIAA 1G97A 1ZI1A 1TW5A 5I1FA 2OI6A 4ZDQA 3CKVA 2WVKA 1NMMB 5FU0A 3NGWA 4FRMA 1G2VA 1W77A 1FXJA 4EEAA 2OI5A 5C47A 3U2VA 2V0KA 3Q4SA 4HO5A 4EE4A 4EEOA 5C3AA 4DECA 5AJPA 1H4EA 2E8BA 1HM9A 4ECMA 1IIMA 3E26A 1YP2A 3V0PA 1VGTA 3D8VA 2P72A 5EJ1A 1OMZA 2NXVA 5CMIA 4IRQA 1GA8A 3ZF8A 1R80A 1H7LA 2BO7A 2VXMA 1VH3A 3F1YA 4LW3A 4AYLA 5C48A 3JUKA 3I0GA 2V0LA 3O3PA 2YC3A 4CJBA 2QH5A 4HCQA 2FFVA 5J49A 2VK9A 2RJ4A 4M2AA 1W55A 1VH1A 1NQIB 1H5RA 2Y7AA 4NAIA 2ZU7A 4J18A 5JQQA 1JVGA 2A8UA 2Q4JA 4FRDA 3U2TA 4EE3A 2AH9A 5C4FA 1H4CA 3OH3A 1FGXA 4KC4A 3I0HA 2ICXA 4G3QA 4NANA 3T7OA 2WE9A 3I0IX 1LVWA 2WVLA 2X60A 2D7RA 1ZI5A 1OQMB 1GWWA 4KPZA 2CU2A 1R7VA 1K4VA 5AJNA 4FIXA 1ZDFA 3V0QA 1VM8A 1NKHB 1R81A 2X5SA 1H7EA 4KRVA 3RMWA 2O1GA 1ZHJA 3I0JA 1ZDGA 1G3LA 2VXLA 4KT7A 4EEMA 1HV9A 5C4CA 4B4MA 1YP4A 2RJ1A 3I0EA 4MNDA 2Y4KA 3LW6A 1NHEB 2WEEA 3SXCA 2FYCB 2FYBA 4FCUA 3TZTA 1H4DA 4M4KA 2AESA 2D7IA 2XWMA 4B2WA 2E3DA 2RJ9A 4KC1A 2ZU9A 4O6MA 1O7QA 2RIXA 3DUVA 3SX7A 3SXBA 3I0CA 2AE7A 5CMJA 4Y63A 1VGUA 2RJ7A 3R2WA 4BMAA 1ZJ2A 5EIYA 2Z87A 4HO2A 3OC9A 4EE5A 1R7YA 5CMFX 3V8ZA 2Y4JA 4FIYA 5IDTA 2BO6A 2AM4A 4B4GA 1JV1A 1VZXA 1EZIA 2YQJA 3DJ4A 1R82A 2YQSA 1YROB 3V0OA
chains in the Genus database with same CATH topology
5FUHA 2VSIA 2ICYA 4JISA 1G23A 4KC2A 4CVHA 1VICA 3SX5A 1G8OA 3CKQA 4FRHA 2AM3A 4XWIA 3V0LA 1ZCYA 4FRPA 1XHBA 1ZJ3A 5D91A 3SXGA 2WAWA 2OEGA 1MC3A 1LL3A 3USRA 2Z86A 1PZYB 1ZJ1A 5C3DA 3CU0A 4Y7VA 4P00A 1FO9A 5CQLX 1VZUA 5C3BA 1HJLA 2J0AA 3Q80A 1R7XA 2VS3A 1MP3A 1V82A 2ZU8A 1H7QA 2PGYA 2UX8A 4C2SA 3SXEA 3PKQA 1ZI4A 3F1CA 1WT3A 2VS4A 4HG6A 3U2UA 4AYJA 1FRWA 4D0ZA 3K8EA 2AM5A 1W57A 1O23B 4HO0A 4B42A 4E1KA 5C38A 1H5TA 1PZTA 4M2BA 1WSZA 1TVYA 2X65A 3U0YA 2AECA 1R7UA 1S4NA 2Y4MA 3GUEA 1XZ6A 2QKXA 2YQHA 1FXOA 4Y7GA 4FRQA 1JYLA 4G87A 3K8DA 4Y6NA 2J0BA 4NALA 1Z90A 2JCLA 1V83A 4D11A 3E25A 3SXDA 5L6VA 4KPXA 1GX4A 5L6SA 4DE7A 3OKRA 2Y4LA 1ZJ0A 5CQOA 1VZTA 2I5KA 1QG8A 2VS5A 1FWYA 1HM0A 1JV3A 1WT2A 4HO6A 1QGSA 2DPWA 5CQMX 1FGGA 1NF5B 1QGQA 2O1FA 5DDVA 1MP5A 5FU8A 1H5TB 1LL2A 4HO8A 1R7TA 2BO8A 2RJ0A 3ZLKA 4FREA 5C4BA 2OI7A 2C0NA 3ST8A 1INJA 1G1LA 1G9RA 3T7MA 4B3UA 4HO9A 5CMGX 4YS8A 5DDTA 4LW6A 1H7GA 1WT1A 4ASYA 2O1HA 4G3SA 2A8WA 3BRKX 3CGXA 3BCVA 4Y7TA 3D5NA 3CKNA 1TZFA 4FROA 2WVMA 4B2XA 5C4EA 4IRPA 4JD0A 3QVBA 1ZI3A 4Q7CA 3ZGFA 5CMHA 2RITA 5BXCA 5FTSA 3I0LA 1ZIZA 1GQ9A 3D98A 5CQNX 5FYEA 2AGDA 4FRAA 3V0MA 2YC5A 1LZ7A 4M28A 3SPTA 1G0RA 1HM8A 4CJCA 3ZLLA 3DK5A 2XWLA 3SXAA 1WVCA 4Y7UA 4KQLA 1ON8A 5C1GA 1INIA 3IOIA 4KXOA 3I0DA 5C49A 1H7TA 3SX8A 1TW1A 2VD4A 5C4DA 4EEGA 5C8RA 1H7HA 5AJOA 3OH0A 1FR8A 2X5ZA 4KNXA 2GGOA 3OAMA 1S4OA 4UEGA 3IOHA 2PX7A 4MYBA 4D11C 3FWWA 3U0XA 2YESA 1G93A 1GWVA 1ZJPA 3OH4A 3POLA 3U2XA 2XMEA 5D92A 1H5SA 4B4BA 2D0JA 3I0FA 2GGQA 2JCKA 2RIYA 4K6RA 2JCOA 2QGIA 3PKPA 4Y62A 1NWGB 1LL0A 1ON6A 3R3IA 1V84A 1FZWA 4ARWA 2P73A 4Y64A 2W0WA 4FQWA 4R7PA 1JYKA 5CQPA 3JUJA 2FFUA 5FTVA 4MIXA 2V0IA 4D0TA 1JVDA 2VFZA 1MP4A 4P02A 1QWJA 2YQCA 2APCA 2OEFA 3FOQA 1H5SD 3CKJA 3SX3A 3OGZA 3I0KA 1LZJA 1GX0A 3V90A 4Y7FA 1G95A 2V0JA 3IOJA 5EJZA 1OMXA 1H5SB 4FRLA 4FRBA 4FCEA 2Y6PA 5C1HA 5C36A 3V8YA 5IFYA 4B5BA 1H7FA 1ZCUA 1GQCA 2FY7A 1ZCTA 2YCMA 2RIZA 3CKOA 1FG5N 1VGZA 2VSHA 3N9WA 4CJ8A 1KWSA 2P6WA 3TQDA 2PGVA 4Y6UA 2MZBA 3RSBA 4EVWA 1VGWA 4Y9XA 3EE5A 1H3MA 3V91A 1SS9A 4G3PA 3USQA 1O7OA 2WGZA 2I5EA 1WT0A 1ZJOA 1YP3A 4O6NA 2V0HA 2XMHA 3V0NA 3RMVA 3OH1A 5HS2A 4HOCA 1EYRA 3PNNA 4AC3A 2RJ5A 2W0VA 4D48A 1H5RB 1ZCVA 2XWNA 5FV9A 4HO4A 3HL3A 4NAKA 1FO8A 1FR9A 2FYAA 2FYDB 3T7NA 1H5SC 1IINA 2I7BA 2PA4A 3OH2A 2RJ8A 2BO4A 3U2WA 1HJJA 4DDZA 2JCJA 1LZIA 1VPAA 1S4PA 1I52A 1E5KA 4HO3A 4AAWA 3ZGGA 1LZ0A 5C1LA 4GBPA 1FOAA 3Q7UA 4ASJA 4L41C 5IDSA 4BQHA 2RJ6A 3JTJA 1O0RA 4KNRA 3KIAA 1G97A 1ZI1A 1TW5A 5I1FA 2OI6A 4ZDQA 3CKVA 2WVKA 1NMMB 5FU0A 3NGWA 4FRMA 1G2VA 1W77A 1FXJA 4EEAA 2OI5A 5C47A 3U2VA 2V0KA 3Q4SA 4HO5A 4EE4A 4EEOA 5C3AA 4DECA 5AJPA 1H4EA 2E8BA 1HM9A 4ECMA 1IIMA 3E26A 1YP2A 3V0PA 1VGTA 3D8VA 2P72A 5EJ1A 1OMZA 2NXVA 5CMIA 4IRQA 1GA8A 3ZF8A 1R80A 1H7LA 2BO7A 2VXMA 1VH3A 3F1YA 4LW3A 4AYLA 5C48A 3JUKA 3I0GA 2V0LA 3O3PA 2YC3A 4CJBA 2QH5A 4HCQA 2FFVA 5J49A 2VK9A 2RJ4A 4M2AA 1W55A 1VH1A 1NQIB 1H5RA 2Y7AA 4NAIA 2ZU7A 4J18A 5JQQA 1JVGA 2A8UA 2Q4JA 4FRDA 3U2TA 4EE3A 2AH9A 5C4FA 1H4CA 3OH3A 1FGXA 4KC4A 3I0HA 2ICXA 4G3QA 4NANA 3T7OA 2WE9A 3I0IX 1LVWA 2WVLA 2X60A 2D7RA 1ZI5A 1OQMB 1GWWA 4KPZA 2CU2A 1R7VA 1K4VA 5AJNA 4FIXA 1ZDFA 3V0QA 1VM8A 1NKHB 1R81A 2X5SA 1H7EA 4KRVA 3RMWA 2O1GA 1ZHJA 3I0JA 1ZDGA 1G3LA 2VXLA 4KT7A 4EEMA 1HV9A 5C4CA 4B4MA 1YP4A 2RJ1A 3I0EA 4MNDA 2Y4KA 3LW6A 1NHEB 2WEEA 3SXCA 2FYCB 2FYBA 4FCUA 3TZTA 1H4DA 4M4KA 2AESA 2D7IA 2XWMA 4B2WA 2E3DA 2RJ9A 4KC1A 2ZU9A 4O6MA 1O7QA 2RIXA 3DUVA 3SX7A 3SXBA 3I0CA 2AE7A 5CMJA 4Y63A 1VGUA 2RJ7A 3R2WA 4BMAA 1ZJ2A 5EIYA 2Z87A 4HO2A 3OC9A 4EE5A 1R7YA 5CMFX 3V8ZA 2Y4JA 4FIYA 5IDTA 2BO6A 2AM4A 4B4GA 1JV1A 1VZXA 1EZIA 2YQJA 3DJ4A 1R82A 2YQSA 1YROB 3V0OA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5FUH A;  2VSI A;  2ICY A;  4JIS A;  1G23 A;  4KC2 A;  4CVH A;  1VIC A;  3SX5 A;  1G8O A;  3CKQ A;  4FRH A;  2AM3 A;  4XWI A;  3V0L A;  1ZCY A;  4FRP A;  1XHB A;  1ZJ3 A;  3SXG A;  2WAW A;  2OEG A;  1MC3 A;  1LL3 A;  3USR A;  2Z86 A;  1PZY B;  1ZJ1 A;  5C3D A;  3CU0 A;  4Y7V A;  4P00 A;  1FO9 A;  5CQL X;  1VZU A;  5C3B A;  1HJL A;  3Q80 A;  1R7X A;  2VS3 A;  1MP3 A;  1V82 A;  2ZU8 A;  1H7Q A;  2PGY A;  2UX8 A;  4C2S A;  3SXE A;  3PKQ A;  1ZI4 A;  3F1C A;  1WT3 A;  2VS4 A;  4HG6 A;  3U2U A;  4AYJ A;  1FRW A;  4D0Z A;  3K8E A;  2AM5 A;  1W57 A;  1O23 B;  4HO0 A;  4B42 A;  4E1K A;  5C38 A;  1H5T A;  1PZT A;  4M2B A;  1WSZ A;  1TVY A;  2X65 A;  3U0Y A;  2AEC A;  1R7U A;  1S4N A;  2Y4M A;  3GUE A;  1XZ6 A;  2QKX A;  2YQH A;  1FXO A;  4Y7G A;  4FRQ A;  1JYL A;  4G87 A;  3K8D A;  4Y6N A;  4NAL A;  1Z90 A;  2JCL A;  1V83 A;  4D11 A;  3E25 A;  3SXD A;  5L6V A;  4KPX A;  1GX4 A;  5L6S A;  4DE7 A;  3OKR A;  2Y4L A;  1ZJ0 A;  5CQO A;  1VZT A;  2I5K A;  1QG8 A;  2VS5 A;  1FWY A;  1HM0 A;  1JV3 A;  1WT2 A;  4HO6 A;  1QGS A;  2DPW A;  5CQM X;  1FGG A;  1NF5 B;  1QGQ A;  2O1F A;  5DDV A;  1MP5 A;  5FU8 A;  1H5T B;  1LL2 A;  4HO8 A;  1R7T A;  2BO8 A;  2RJ0 A;  3ZLK A;  4FRE A;  5C4B A;  2OI7 A;  3ST8 A;  1INJ A;  1G1L A;  1G9R A;  3T7M A;  4B3U A;  4HO9 A;  5CMG X;  4YS8 A;  5DDT A;  4LW6 A;  1H7G A;  1WT1 A;  4ASY A;  2O1H A;  4G3S A;  2A8W A;  3BRK X;  3CGX A;  3BCV A;  4Y7T A;  3D5N A;  3CKN A;  1TZF A;  4FRO A;  2WVM A;  4B2X A;  5C4E A;  4IRP A;  4JD0 A;  3QVB A;  1ZI3 A;  3ZGF A;  5CMH A;  2RIT A;  5BXC A;  5FTS A;  3I0L A;  1ZIZ A;  1GQ9 A;  3D98 A;  5CQN X;  5FYE A;  2AGD A;  4FRA A;  3V0M A;  2YC5 A;  1LZ7 A;  4M28 A;  3SPT A;  1G0R A;  1HM8 A;  4CJC A;  3ZLL A;  3DK5 A;  2XWL A;  3SXA A;  1WVC A;  4Y7U A;  4KQL A;  1ON8 A;  5C1G A;  1INI A;  3IOI A;  4KXO A;  3I0D A;  5C49 A;  1H7T A;  3SX8 A;  1TW1 A;  2VD4 A;  5C4D A;  4EEG A;  5C8R A;  1H7H A;  5AJO A;  3OH0 A;  1FR8 A;  2X5Z A;  4KNX A;  2GGO A;  3OAM A;  1S4O A;  4UEG A;  3IOH A;  2PX7 A;  4MYB A;  4D11 C;  3FWW A;  3U0X A;  2YES A;  1G93 A;  1GWV A;  1ZJP A;  3OH4 A;  3POL A;  3U2X A;  2XME A;  1H5S A;  4B4B A;  2D0J A;  3I0F A;  2GGQ A;  2JCK A;  2RIY A;  4K6R A;  2JCO A;  2QGI A;  3PKP A;  4Y62 A;  1NWG B;  1LL0 A;  1ON6 A;  3R3I A;  1V84 A;  1FZW A;  4ARW A;  2P73 A;  4Y64 A;  2W0W A;  4FQW A;  4R7P A;  1JYK A;  5CQP A;  3JUJ A;  2FFU A;  5FTV A;  2V0I A;  4D0T A;  1JVD A;  2VFZ A;  1MP4 A;  4P02 A;  1QWJ A;  2YQC A;  2APC A;  2OEF A;  3FOQ A;  1H5S D;  3CKJ A;  3SX3 A;  3OGZ A;  3I0K A;  1LZJ A;  1GX0 A;  3V90 A;  4Y7F A;  1G95 A;  2V0J A;  3IOJ A;  5EJZ A;  1OMX A;  1H5S B;  4FRL A;  4FRB A;  4FCE A;  2Y6P A;  5C1H A;  5C36 A;  3V8Y A;  5IFY A;  4B5B A;  1H7F A;  1ZCU A;  1GQC A;  2FY7 A;  1ZCT A;  2YCM A;  2RIZ A;  3CKO A;  1FG5 N;  1VGZ A;  2VSH A;  3N9W A;  4CJ8 A;  1KWS A;  2P6W A;  3TQD A;  2PGV A;  4Y6U A;  2MZB A;  3RSB A;  4EVW A;  1VGW A;  4Y9X A;  3EE5 A;  1H3M A;  3V91 A;  1SS9 A;  4G3P A;  3USQ A;  1O7O A;  2WGZ A;  2I5E A;  1WT0 A;  1ZJO A;  1YP3 A;  2V0H A;  2XMH A;  3V0N A;  3RMV A;  3OH1 A;  5HS2 A;  4HOC A;  1EYR A;  3PNN A;  4AC3 A;  2RJ5 A;  2W0V A;  4D48 A;  1H5R B;  1ZCV A;  2XWN A;  5FV9 A;  4HO4 A;  3HL3 A;  4NAK A;  1FO8 A;  1FR9 A;  2FYA A;  2FYD B;  3T7N A;  1H5S C;  1IIN A;  2I7B A;  2PA4 A;  3OH2 A;  2RJ8 A;  2BO4 A;  3U2W A;  1HJJ A;  4DDZ A;  2JCJ A;  1LZI A;  1VPA A;  1S4P A;  1I52 A;  1E5K A;  4HO3 A;  4AAW A;  3ZGG A;  1LZ0 A;  5C1L A;  4GBP A;  1FOA A;  3Q7U A;  4ASJ A;  4L41 C;  5IDS A;  4BQH A;  2RJ6 A;  3JTJ A;  1O0R A;  4KNR A;  3KIA A;  1G97 A;  1ZI1 A;  1TW5 A;  5I1F A;  2OI6 A;  4ZDQ A;  3CKV A;  2WVK A;  1NMM B;  5FU0 A;  3NGW A;  4FRM A;  1G2V A;  1W77 A;  1FXJ A;  4EEA A;  2OI5 A;  5C47 A;  3U2V A;  2V0K A;  3Q4S A;  4HO5 A;  4EE4 A;  4EEO A;  5C3A A;  4DEC A;  5AJP A;  1H4E A;  2E8B A;  1HM9 A;  4ECM A;  1IIM A;  3E26 A;  1YP2 A;  3V0P A;  3D8V A;  1VGT A;  2P72 A;  5EJ1 A;  1OMZ A;  2NXV A;  5CMI A;  4IRQ A;  1GA8 A;  3ZF8 A;  1R80 A;  1H7L A;  2BO7 A;  2VXM A;  1VH3 A;  3F1Y A;  4LW3 A;  4AYL A;  5C48 A;  3JUK A;  3I0G A;  2V0L A;  3O3P A;  2YC3 A;  4CJB A;  2QH5 A;  4HCQ A;  2FFV A;  5J49 A;  2RJ4 A;  4M2A A;  1W55 A;  1VH1 A;  1NQI B;  1H5R A;  2Y7A A;  4NAI A;  2ZU7 A;  4J18 A;  5JQQ A;  1JVG A;  2A8U A;  2Q4J A;  4FRD A;  3U2T A;  4EE3 A;  2AH9 A;  5C4F A;  1H4C A;  3OH3 A;  1FGX A;  4KC4 A;  3I0H A;  2ICX A;  4G3Q A;  4NAN A;  3T7O A;  2WE9 A;  3I0I X;  1LVW A;  2WVL A;  2X60 A;  2D7R A;  1ZI5 A;  1OQM B;  1GWW A;  4KPZ A;  2CU2 A;  1R7V A;  1K4V A;  5AJN A;  1ZDF A;  3V0Q A;  1VM8 A;  1NKH B;  1R81 A;  2X5S A;  1H7E A;  4KRV A;  3RMW A;  2O1G A;  1ZHJ A;  3I0J A;  1ZDG A;  1G3L A;  2VXL A;  4KT7 A;  4EEM A;  1HV9 A;  5C4C A;  4B4M A;  1YP4 A;  2RJ1 A;  3I0E A;  4MND A;  2Y4K A;  3LW6 A;  1NHE B;  2WEE A;  3SXC A;  2FYC B;  2FYB A;  4FCU A;  3TZT A;  1H4D A;  4M4K A;  2AES A;  2D7I A;  2XWM A;  4B2W A;  2E3D A;  2RJ9 A;  4KC1 A;  2ZU9 A;  1O7Q A;  2RIX A;  3DUV A;  3SX7 A;  3SXB A;  3I0C A;  2AE7 A;  5CMJ A;  4Y63 A;  1VGU A;  2RJ7 A;  3R2W A;  4BMA A;  1ZJ2 A;  5EIY A;  2Z87 A;  4HO2 A;  3OC9 A;  4EE5 A;  1R7Y A;  5CMF X;  3V8Z A;  2Y4J A;  5IDT A;  2BO6 A;  2AM4 A;  4B4G A;  1JV1 A;  1VZX A;  1EZI A;  2YQJ A;  3DJ4 A;  1R82 A;  2YQS A;  1YRO B;  3V0O A; 
#chains in the Genus database with same CATH topology
 5FUH A;  2VSI A;  2ICY A;  4JIS A;  1G23 A;  4KC2 A;  4CVH A;  1VIC A;  3SX5 A;  1G8O A;  3CKQ A;  4FRH A;  2AM3 A;  4XWI A;  3V0L A;  1ZCY A;  4FRP A;  1XHB A;  1ZJ3 A;  5D91 A;  3SXG A;  2WAW A;  2OEG A;  1MC3 A;  1LL3 A;  3USR A;  2Z86 A;  1PZY B;  1ZJ1 A;  5C3D A;  3CU0 A;  4Y7V A;  4P00 A;  1FO9 A;  5CQL X;  1VZU A;  5C3B A;  1HJL A;  2J0A A;  3Q80 A;  1R7X A;  2VS3 A;  1MP3 A;  1V82 A;  2ZU8 A;  1H7Q A;  2PGY A;  2UX8 A;  4C2S A;  3SXE A;  3PKQ A;  1ZI4 A;  3F1C A;  1WT3 A;  2VS4 A;  4HG6 A;  3U2U A;  4AYJ A;  1FRW A;  4D0Z A;  3K8E A;  2AM5 A;  1W57 A;  1O23 B;  4HO0 A;  4B42 A;  4E1K A;  5C38 A;  1H5T A;  1PZT A;  4M2B A;  1WSZ A;  1TVY A;  2X65 A;  3U0Y A;  2AEC A;  1R7U A;  1S4N A;  2Y4M A;  3GUE A;  1XZ6 A;  2QKX A;  2YQH A;  1FXO A;  4Y7G A;  4FRQ A;  1JYL A;  4G87 A;  3K8D A;  4Y6N A;  2J0B A;  4NAL A;  1Z90 A;  2JCL A;  1V83 A;  4D11 A;  3E25 A;  3SXD A;  5L6V A;  4KPX A;  1GX4 A;  5L6S A;  4DE7 A;  3OKR A;  2Y4L A;  1ZJ0 A;  5CQO A;  1VZT A;  2I5K A;  1QG8 A;  2VS5 A;  1FWY A;  1HM0 A;  1JV3 A;  1WT2 A;  4HO6 A;  1QGS A;  2DPW A;  5CQM X;  1FGG A;  1NF5 B;  1QGQ A;  2O1F A;  5DDV A;  1MP5 A;  5FU8 A;  1H5T B;  1LL2 A;  4HO8 A;  1R7T A;  2BO8 A;  2RJ0 A;  3ZLK A;  4FRE A;  5C4B A;  2OI7 A;  2C0N A;  3ST8 A;  1INJ A;  1G1L A;  1G9R A;  3T7M A;  4B3U A;  4HO9 A;  5CMG X;  4YS8 A;  5DDT A;  4LW6 A;  1H7G A;  1WT1 A;  4ASY A;  2O1H A;  4G3S A;  2A8W A;  3BRK X;  3CGX A;  3BCV A;  4Y7T A;  3D5N A;  3CKN A;  1TZF A;  4FRO A;  2WVM A;  4B2X A;  5C4E A;  4IRP A;  4JD0 A;  3QVB A;  1ZI3 A;  4Q7C A;  3ZGF A;  5CMH A;  2RIT A;  5BXC A;  5FTS A;  3I0L A;  1ZIZ A;  1GQ9 A;  3D98 A;  5CQN X;  5FYE A;  2AGD A;  4FRA A;  3V0M A;  2YC5 A;  1LZ7 A;  4M28 A;  3SPT A;  1G0R A;  1HM8 A;  4CJC A;  3ZLL A;  3DK5 A;  2XWL A;  3SXA A;  1WVC A;  4Y7U A;  4KQL A;  1ON8 A;  5C1G A;  1INI A;  3IOI A;  4KXO A;  3I0D A;  5C49 A;  1H7T A;  3SX8 A;  1TW1 A;  2VD4 A;  5C4D A;  4EEG A;  5C8R A;  1H7H A;  5AJO A;  3OH0 A;  1FR8 A;  2X5Z A;  4KNX A;  2GGO A;  3OAM A;  1S4O A;  4UEG A;  3IOH A;  2PX7 A;  4MYB A;  4D11 C;  3FWW A;  3U0X A;  2YES A;  1G93 A;  1GWV A;  1ZJP A;  3OH4 A;  3POL A;  3U2X A;  2XME A;  5D92 A;  1H5S A;  4B4B A;  2D0J A;  3I0F A;  2GGQ A;  2JCK A;  2RIY A;  4K6R A;  2JCO A;  2QGI A;  3PKP A;  4Y62 A;  1NWG B;  1LL0 A;  1ON6 A;  3R3I A;  1V84 A;  1FZW A;  4ARW A;  2P73 A;  4Y64 A;  2W0W A;  4FQW A;  4R7P A;  1JYK A;  5CQP A;  3JUJ A;  2FFU A;  5FTV A;  4MIX A;  2V0I A;  4D0T A;  1JVD A;  2VFZ A;  1MP4 A;  4P02 A;  1QWJ A;  2YQC A;  2APC A;  2OEF A;  3FOQ A;  1H5S D;  3CKJ A;  3SX3 A;  3OGZ A;  3I0K A;  1LZJ A;  1GX0 A;  3V90 A;  4Y7F A;  1G95 A;  2V0J A;  3IOJ A;  5EJZ A;  1OMX A;  1H5S B;  4FRL A;  4FRB A;  4FCE A;  2Y6P A;  5C1H A;  5C36 A;  3V8Y A;  5IFY A;  4B5B A;  1H7F A;  1ZCU A;  1GQC A;  2FY7 A;  1ZCT A;  2YCM A;  2RIZ A;  3CKO A;  1FG5 N;  1VGZ A;  2VSH A;  3N9W A;  4CJ8 A;  1KWS A;  2P6W A;  3TQD A;  2PGV A;  4Y6U A;  2MZB A;  3RSB A;  4EVW A;  1VGW A;  4Y9X A;  3EE5 A;  1H3M A;  3V91 A;  1SS9 A;  4G3P A;  3USQ A;  1O7O A;  2WGZ A;  2I5E A;  1WT0 A;  1ZJO A;  1YP3 A;  4O6N A;  2V0H A;  2XMH A;  3V0N A;  3RMV A;  3OH1 A;  5HS2 A;  4HOC A;  1EYR A;  3PNN A;  4AC3 A;  2RJ5 A;  2W0V A;  4D48 A;  1H5R B;  1ZCV A;  2XWN A;  5FV9 A;  4HO4 A;  3HL3 A;  4NAK A;  1FO8 A;  1FR9 A;  2FYA A;  2FYD B;  3T7N A;  1H5S C;  1IIN A;  2I7B A;  2PA4 A;  3OH2 A;  2RJ8 A;  2BO4 A;  3U2W A;  1HJJ A;  4DDZ A;  2JCJ A;  1LZI A;  1VPA A;  1S4P A;  1I52 A;  1E5K A;  4HO3 A;  4AAW A;  3ZGG A;  1LZ0 A;  5C1L A;  4GBP A;  1FOA A;  3Q7U A;  4ASJ A;  4L41 C;  5IDS A;  4BQH A;  2RJ6 A;  3JTJ A;  1O0R A;  4KNR A;  3KIA A;  1G97 A;  1ZI1 A;  1TW5 A;  5I1F A;  2OI6 A;  4ZDQ A;  3CKV A;  2WVK A;  1NMM B;  5FU0 A;  3NGW A;  4FRM A;  1G2V A;  1W77 A;  1FXJ A;  4EEA A;  2OI5 A;  5C47 A;  3U2V A;  2V0K A;  3Q4S A;  4HO5 A;  4EE4 A;  4EEO A;  5C3A A;  4DEC A;  5AJP A;  1H4E A;  2E8B A;  1HM9 A;  4ECM A;  1IIM A;  3E26 A;  1YP2 A;  3V0P A;  1VGT A;  3D8V A;  2P72 A;  5EJ1 A;  1OMZ A;  2NXV A;  5CMI A;  4IRQ A;  1GA8 A;  3ZF8 A;  1R80 A;  1H7L A;  2BO7 A;  2VXM A;  1VH3 A;  3F1Y A;  4LW3 A;  4AYL A;  5C48 A;  3JUK A;  3I0G A;  2V0L A;  3O3P A;  2YC3 A;  4CJB A;  2QH5 A;  4HCQ A;  2FFV A;  5J49 A;  2VK9 A;  2RJ4 A;  4M2A A;  1W55 A;  1VH1 A;  1NQI B;  1H5R A;  2Y7A A;  4NAI A;  2ZU7 A;  4J18 A;  5JQQ A;  1JVG A;  2A8U A;  2Q4J A;  4FRD A;  3U2T A;  4EE3 A;  2AH9 A;  5C4F A;  1H4C A;  3OH3 A;  1FGX A;  4KC4 A;  3I0H A;  2ICX A;  4G3Q A;  4NAN A;  3T7O A;  2WE9 A;  3I0I X;  1LVW A;  2WVL A;  2X60 A;  2D7R A;  1ZI5 A;  1OQM B;  1GWW A;  4KPZ A;  2CU2 A;  1R7V A;  1K4V A;  5AJN A;  4FIX A;  1ZDF A;  3V0Q A;  1VM8 A;  1NKH B;  1R81 A;  2X5S A;  1H7E A;  4KRV A;  3RMW A;  2O1G A;  1ZHJ A;  3I0J A;  1ZDG A;  1G3L A;  2VXL A;  4KT7 A;  4EEM A;  1HV9 A;  5C4C A;  4B4M A;  1YP4 A;  2RJ1 A;  3I0E A;  4MND A;  2Y4K A;  3LW6 A;  1NHE B;  2WEE A;  3SXC A;  2FYC B;  2FYB A;  4FCU A;  3TZT A;  1H4D A;  4M4K A;  2AES A;  2D7I A;  2XWM A;  4B2W A;  2E3D A;  2RJ9 A;  4KC1 A;  2ZU9 A;  4O6M A;  1O7Q A;  2RIX A;  3DUV A;  3SX7 A;  3SXB A;  3I0C A;  2AE7 A;  5CMJ A;  4Y63 A;  1VGU A;  2RJ7 A;  3R2W A;  4BMA A;  1ZJ2 A;  5EIY A;  2Z87 A;  4HO2 A;  3OC9 A;  4EE5 A;  1R7Y A;  5CMF X;  3V8Z A;  2Y4J A;  4FIY A;  5IDT A;  2BO6 A;  2AM4 A;  4B4G A;  1JV1 A;  1VZX A;  1EZI A;  2YQJ A;  3DJ4 A;  1R82 A;  2YQS A;  1YRO B;  3V0O A; 
#chains in the Genus database with same CATH homology
 5FUH A;  2VSI A;  2ICY A;  4JIS A;  1G23 A;  4KC2 A;  4CVH A;  1VIC A;  3SX5 A;  1G8O A;  3CKQ A;  4FRH A;  2AM3 A;  4XWI A;  3V0L A;  1ZCY A;  4FRP A;  1XHB A;  1ZJ3 A;  5D91 A;  3SXG A;  2WAW A;  2OEG A;  1MC3 A;  1LL3 A;  3USR A;  2Z86 A;  1PZY B;  1ZJ1 A;  5C3D A;  3CU0 A;  4Y7V A;  4P00 A;  1FO9 A;  5CQL X;  1VZU A;  5C3B A;  1HJL A;  2J0A A;  3Q80 A;  1R7X A;  2VS3 A;  1MP3 A;  1V82 A;  2ZU8 A;  1H7Q A;  2PGY A;  2UX8 A;  4C2S A;  3SXE A;  3PKQ A;  1ZI4 A;  3F1C A;  1WT3 A;  2VS4 A;  4HG6 A;  3U2U A;  4AYJ A;  1FRW A;  4D0Z A;  3K8E A;  2AM5 A;  1W57 A;  1O23 B;  4HO0 A;  4B42 A;  4E1K A;  5C38 A;  1H5T A;  1PZT A;  4M2B A;  1WSZ A;  1TVY A;  2X65 A;  3U0Y A;  2AEC A;  1R7U A;  1S4N A;  2Y4M A;  3GUE A;  1XZ6 A;  2QKX A;  2YQH A;  1FXO A;  4Y7G A;  4FRQ A;  1JYL A;  4G87 A;  3K8D A;  4Y6N A;  2J0B A;  4NAL A;  1Z90 A;  2JCL A;  1V83 A;  4D11 A;  3E25 A;  3SXD A;  5L6V A;  4KPX A;  1GX4 A;  5L6S A;  4DE7 A;  3OKR A;  2Y4L A;  1ZJ0 A;  5CQO A;  1VZT A;  2I5K A;  1QG8 A;  2VS5 A;  1FWY A;  1HM0 A;  1JV3 A;  1WT2 A;  4HO6 A;  1QGS A;  2DPW A;  5CQM X;  1FGG A;  1NF5 B;  1QGQ A;  2O1F A;  5DDV A;  1MP5 A;  5FU8 A;  1H5T B;  1LL2 A;  4HO8 A;  1R7T A;  2BO8 A;  2RJ0 A;  3ZLK A;  4FRE A;  5C4B A;  2OI7 A;  2C0N A;  3ST8 A;  1INJ A;  1G1L A;  1G9R A;  3T7M A;  4B3U A;  4HO9 A;  5CMG X;  4YS8 A;  5DDT A;  4LW6 A;  1H7G A;  1WT1 A;  4ASY A;  2O1H A;  4G3S A;  2A8W A;  3BRK X;  3CGX A;  3BCV A;  4Y7T A;  3D5N A;  3CKN A;  1TZF A;  4FRO A;  2WVM A;  4B2X A;  5C4E A;  4IRP A;  4JD0 A;  3QVB A;  1ZI3 A;  4Q7C A;  3ZGF A;  5CMH A;  2RIT A;  5BXC A;  5FTS A;  3I0L A;  1ZIZ A;  1GQ9 A;  3D98 A;  5CQN X;  5FYE A;  2AGD A;  4FRA A;  3V0M A;  2YC5 A;  1LZ7 A;  4M28 A;  3SPT A;  1G0R A;  1HM8 A;  4CJC A;  3ZLL A;  3DK5 A;  2XWL A;  3SXA A;  1WVC A;  4Y7U A;  4KQL A;  1ON8 A;  5C1G A;  1INI A;  3IOI A;  4KXO A;  3I0D A;  5C49 A;  1H7T A;  3SX8 A;  1TW1 A;  2VD4 A;  5C4D A;  4EEG A;  5C8R A;  1H7H A;  5AJO A;  3OH0 A;  1FR8 A;  2X5Z A;  4KNX A;  2GGO A;  3OAM A;  1S4O A;  4UEG A;  3IOH A;  2PX7 A;  4MYB A;  4D11 C;  3FWW A;  3U0X A;  2YES A;  1G93 A;  1GWV A;  1ZJP A;  3OH4 A;  3POL A;  3U2X A;  2XME A;  5D92 A;  1H5S A;  4B4B A;  2D0J A;  3I0F A;  2GGQ A;  2JCK A;  2RIY A;  4K6R A;  2JCO A;  2QGI A;  3PKP A;  4Y62 A;  1NWG B;  1LL0 A;  1ON6 A;  3R3I A;  1V84 A;  1FZW A;  4ARW A;  2P73 A;  4Y64 A;  2W0W A;  4FQW A;  4R7P A;  1JYK A;  5CQP A;  3JUJ A;  2FFU A;  5FTV A;  4MIX A;  2V0I A;  4D0T A;  1JVD A;  2VFZ A;  1MP4 A;  4P02 A;  1QWJ A;  2YQC A;  2APC A;  2OEF A;  3FOQ A;  1H5S D;  3CKJ A;  3SX3 A;  3OGZ A;  3I0K A;  1LZJ A;  1GX0 A;  3V90 A;  4Y7F A;  1G95 A;  2V0J A;  3IOJ A;  5EJZ A;  1OMX A;  1H5S B;  4FRL A;  4FRB A;  4FCE A;  2Y6P A;  5C1H A;  5C36 A;  3V8Y A;  5IFY A;  4B5B A;  1H7F A;  1ZCU A;  1GQC A;  2FY7 A;  1ZCT A;  2YCM A;  2RIZ A;  3CKO A;  1FG5 N;  1VGZ A;  2VSH A;  3N9W A;  4CJ8 A;  1KWS A;  2P6W A;  3TQD A;  2PGV A;  4Y6U A;  2MZB A;  3RSB A;  4EVW A;  1VGW A;  4Y9X A;  3EE5 A;  1H3M A;  3V91 A;  1SS9 A;  4G3P A;  3USQ A;  1O7O A;  2WGZ A;  2I5E A;  1WT0 A;  1ZJO A;  1YP3 A;  4O6N A;  2V0H A;  2XMH A;  3V0N A;  3RMV A;  3OH1 A;  5HS2 A;  4HOC A;  1EYR A;  3PNN A;  4AC3 A;  2RJ5 A;  2W0V A;  4D48 A;  1H5R B;  1ZCV A;  2XWN A;  5FV9 A;  4HO4 A;  3HL3 A;  4NAK A;  1FO8 A;  1FR9 A;  2FYA A;  2FYD B;  3T7N A;  1H5S C;  1IIN A;  2I7B A;  2PA4 A;  3OH2 A;  2RJ8 A;  2BO4 A;  3U2W A;  1HJJ A;  4DDZ A;  2JCJ A;  1LZI A;  1VPA A;  1S4P A;  1I52 A;  1E5K A;  4HO3 A;  4AAW A;  3ZGG A;  1LZ0 A;  5C1L A;  4GBP A;  1FOA A;  3Q7U A;  4ASJ A;  4L41 C;  5IDS A;  4BQH A;  2RJ6 A;  3JTJ A;  1O0R A;  4KNR A;  3KIA A;  1G97 A;  1ZI1 A;  1TW5 A;  5I1F A;  2OI6 A;  4ZDQ A;  3CKV A;  2WVK A;  1NMM B;  5FU0 A;  3NGW A;  4FRM A;  1G2V A;  1W77 A;  1FXJ A;  4EEA A;  2OI5 A;  5C47 A;  3U2V A;  2V0K A;  3Q4S A;  4HO5 A;  4EE4 A;  4EEO A;  5C3A A;  4DEC A;  5AJP A;  1H4E A;  2E8B A;  1HM9 A;  4ECM A;  1IIM A;  3E26 A;  1YP2 A;  3V0P A;  1VGT A;  3D8V A;  2P72 A;  5EJ1 A;  1OMZ A;  2NXV A;  5CMI A;  4IRQ A;  1GA8 A;  3ZF8 A;  1R80 A;  1H7L A;  2BO7 A;  2VXM A;  1VH3 A;  3F1Y A;  4LW3 A;  4AYL A;  5C48 A;  3JUK A;  3I0G A;  2V0L A;  3O3P A;  2YC3 A;  4CJB A;  2QH5 A;  4HCQ A;  2FFV A;  5J49 A;  2VK9 A;  2RJ4 A;  4M2A A;  1W55 A;  1VH1 A;  1NQI B;  1H5R A;  2Y7A A;  4NAI A;  2ZU7 A;  4J18 A;  5JQQ A;  1JVG A;  2A8U A;  2Q4J A;  4FRD A;  3U2T A;  4EE3 A;  2AH9 A;  5C4F A;  1H4C A;  3OH3 A;  1FGX A;  4KC4 A;  3I0H A;  2ICX A;  4G3Q A;  4NAN A;  3T7O A;  2WE9 A;  3I0I X;  1LVW A;  2WVL A;  2X60 A;  2D7R A;  1ZI5 A;  1OQM B;  1GWW A;  4KPZ A;  2CU2 A;  1R7V A;  1K4V A;  5AJN A;  4FIX A;  1ZDF A;  3V0Q A;  1VM8 A;  1NKH B;  1R81 A;  2X5S A;  1H7E A;  4KRV A;  3RMW A;  2O1G A;  1ZHJ A;  3I0J A;  1ZDG A;  1G3L A;  2VXL A;  4KT7 A;  4EEM A;  1HV9 A;  5C4C A;  4B4M A;  1YP4 A;  2RJ1 A;  3I0E A;  4MND A;  2Y4K A;  3LW6 A;  1NHE B;  2WEE A;  3SXC A;  2FYC B;  2FYB A;  4FCU A;  3TZT A;  1H4D A;  4M4K A;  2AES A;  2D7I A;  2XWM A;  4B2W A;  2E3D A;  2RJ9 A;  4KC1 A;  2ZU9 A;  4O6M A;  1O7Q A;  2RIX A;  3DUV A;  3SX7 A;  3SXB A;  3I0C A;  2AE7 A;  5CMJ A;  4Y63 A;  1VGU A;  2RJ7 A;  3R2W A;  4BMA A;  1ZJ2 A;  5EIY A;  2Z87 A;  4HO2 A;  3OC9 A;  4EE5 A;  1R7Y A;  5CMF X;  3V8Z A;  2Y4J A;  4FIY A;  5IDT A;  2BO6 A;  2AM4 A;  4B4G A;  1JV1 A;  1VZX A;  1EZI A;  2YQJ A;  3DJ4 A;  1R82 A;  2YQS A;  1YRO B;  3V0O A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...