2MZBA

Solution structural studies of gtp:adenosylcobinamide-phosphate guanylyltransferase (coby) from methanocaldococcus jannaschii
Total Genus 49
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
49
sequence length
196
structure length
196
Chain Sequence
MDALIMAGGKGTRMGGVEKPLIKLCGRCLIDYVVSPLLKSKVNNIFIATSPNTPKTKEYINSAYKDYKNIVVIDTSGKGYIEDLNECIGYFSEPFLVVSSDLINLKSKIINSIVDYFYCIKAKTPDVEALAVMIPKEKYPNPSIDFNGLVPAGINVVSPKHGYQKEEIMVIDELIFNINTKDDLKLAEMLLKKDGL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Adenosylcobinamide-phosphate guanylyltransferase
publication title Solution Structural Studies of GTP:Adenosylcobinamide-Phosphateguanylyl Transferase (CobY) from Methanocaldococcus jannaschii.
pubmed doi rcsb
source organism Methanocaldococcus jannaschii
molecule tags Transferase
total genus 49
structure length 196
sequence length 196
ec nomenclature ec 2.7.7.62: Adenosylcobinamide-phosphate guanylyltransferase.
pdb deposition date 2015-02-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF12804 NTP_transf_3 MobA-like NTP transferase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.550.10 Alpha Beta Alpha-Beta Complex Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A 2mzbA00
4EE4A 3SXAA 3U0YA 3SXEA 1TW5A 1S4PA 1R7UA 4ARWA 1TVYA 2NXVA 4EEGA 3ZF8A 1R82A 4D48A 4K6RA 4LW3A 2VSHA 1YP2A 4M2AA 4L41C 2ICYA 5AJNA 1INJA 4M2BA 1TW1A 2OEGA 4Y62A 3OH3A 2WVMA 2XMEA 4FQWA 3RMVA 5C48A 4Y64A 3V0QA 1FG5N 2DPWA 4HO4A 1ZI1A 3I0HA 2WAWA 4HO9A 1QGSA 2O1HA 1H4EA 5C4EA 2VXMA 1WT3A 2FYDB 2RJ5A 2AESA 2AM5A 1NKHB 3KIAA 1H7FA 4NANA 4Y7FA 5IFYA 1ZJ0A 5DDVA 2RJ4A 4FCUA 5C49A 3OH1A 5FYEA 3ZLLA 3PKPA 2Y6PA 1VGUA 1QG8A 4EEAA 2OI7A 1R7TA 2Z86A 3D8VA 5JQQA 2VFZA 1W57A 4EE3A 1WVCA 2Z87A 5AJOA 1H7LA 4D11C 4CJCA 3OGZA 2RIZA 4FRBA 4EE5A 3PKQA 3OH0A 2VS3A 3TQDA 4M28A 1PZYB 4AAWA 4M4KA 3RSBA 2OEFA 3I0GA 3CKVA 1VM8A 3ZGFA 2P6WA 4B42A 4JISA 2E8BA 4KT7A 3JTJA 1IIMA 2XMHA 1G3LA 4NAKA 3CKQA 4D11A 5FTSA 2BO7A 1G23A 1ZCUA 1G9RA 1HJLA 4DECA 1ZI3A 4D0TA 3Q7UA 2YQCA 2Y4KA 1ZDFA 2FFUA 5CMIA 3PNNA 4XWIA 3RMWA 1GX4A 3SXBA 3SX5A 2UX8A 3Q4SA 3OAMA 4Y9XA 3U2UA 3U2TA 1ZI5A 1I52A 3SX3A 1LZJA 3V0OA 2D7IA 3USRA 2AM3A 3I0KA 2AGDA 2VSIA 3R3IA 2P73A 4CVHA 5EJZA 2V0IA 1YROB 5EIYA 1FO9A 2MZBA 2YC5A 4BMAA 1GWWA 5C4CA 1FGXA 2V0KA 4Y7TA 5CQLX 2JCOA 3I0IX 3Q80A 2AECA 2Y4MA 4FRDA 2RIXA 2RITA 1MC3A 4C2SA 3DUVA 1G8OA 4DDZA 2Q4JA 1H4DA 4ASJA 4HO3A 2Y4JA 1FGGA 3F1YA 3OKRA 4B4MA 4FREA 1H7QA 1H7GA 3U2XA 1FWYA 1LL0A 1W55A 5IDTA 3I0EA 5FV9A 4HO0A 2P72A 4Y6NA 1H3MA 2APCA 4KXOA 2QH5A 3U2VA 3ST8A 4HO8A 3V0LA 2QGIA 1H5SD 3F1CA 2AH9A 2OI5A 3V0MA 4KPZA 1LZIA 1H7EA 3SX7A 1KWSA 2PGVA 4IRQA 4GBPA 1Z90A 2FYAA 4Y7VA 1VGZA 2X60A 1JYLA 2RIYA 2BO4A 4G87A 2X5SA 5BXCA 3SXDA 4KNXA 1INIA 1TZFA 5I1FA 1FR9A 2A8WA 3OH2A 5C38A 1QWJA 1FOAA 2RJ6A 1FZWA 1GA8A 1HM9A 4CJBA 3SXCA 1O7QA 1R7VA 2CU2A 1G1LA 4B5BA 3D98A 1ZJ1A 4NALA 1GQCA 1WT0A 4Y6UA 5C3DA 5J49A 4D0ZA 1O23B 2RJ1A 2YESA 5C47A 3DJ4A 2VD4A 5C1GA 3E26A 4AC3A 4FROA 2FYBA 5CQMX 3V8YA 1W77A 3I0DA 5C36A 4KNRA 2RJ9A 2RJ7A 4HG6A 1G93A 1V83A 2I5EA 3O3PA 1VGTA 1VPAA 3V8ZA 2JCKA 2O1FA 3TZTA 4Y63A 4AYLA 1FR8A 1NQIB 2W0VA 4CJ8A 1ZJ3A 3E25A 4KPXA 3T7NA 3JUJA 3OH4A 1OMXA 1R7YA 2W0WA 1HM8A 1YP3A 1ZHJA 1O7OA 4HO5A 5CQOA 4B4BA 1LZ7A 4YS8A 3JUKA 1H5RB 4P02A 4G3PA 2E3DA 3IOHA 3I0JA 2X5ZA 1OMZA 3SPTA 4BQHA 2Y7AA 3FOQA 1VZXA 3HL3A 4FRLA 1FXJA 4R7PA 5CQNX 3BRKX 4J18A 1H5RA 2YQJA 4EEOA 4B3UA 4KC1A 4KC4A 1HV9A 2BO6A 2XWMA 3SXGA 4HO2A 4KRVA 3V90A 2AE7A 1G0RA 1O0RA 2WVLA 3ZLKA 5FU8A 1ZJOA 4Y7UA 2VXLA 1FO8A 1JV3A 2FFVA 1JVDA 4JD0A 4Y7GA 4FRQA 2FY7A 2WVKA 1ZDGA 5C1LA 1JVGA 1YP4A 4ECMA 1XHBA 2VS4A 2D7RA 4ZDQA 1VH1A 1VZTA 3USQA 1WT1A 4MYBA 3K8EA 1E5KA 1ZJPA 4HCQA 5EJ1A 2XWLA 1SS9A 5HS2A 1R7XA 1NHEB 5IDSA 3U0XA 3LW6A 1LVWA 1H5SC 3ZGGA 4KQLA 3BCVA 1MP5A 4EEMA 2PA4A 5C8RA 4AYJA 2PGYA 1FXOA 2V0HA 1LL2A 2GGQA 3NGWA 3IOJA 3T7OA 4DE7A 1FRWA 4FRPA 1VZUA 2RJ0A 2X65A 2AM4A 1EZIA 1H5SB 1MP3A 2WEEA 2OI6A 2RJ8A 4UEGA 1ZI4A 2GGOA 4E1KA 4EVWA 1V82A 3N9WA 1ON6A 1G97A 2I7BA 3R2WA 1QGQA 4HO6A 1K4VA 1H5SA 3I0CA 3SX8A 5L6SA 3I0LA 5C4BA 1NF5B 1IINA 2V0JA 1LZ0A 3CKJA 5DDTA 5AJPA 1HJJA 3T7MA 4ASYA 1G2VA 2BO8A 2ZU9A 5C3AA 2VS5A 3V0PA 1MP4A 4FRMA 2XWNA 5C4FA 1JYKA 2JCJA 2ZU8A 3I0FA 1S4OA 2D0JA 3D5NA 4B2XA 2YQSA 1EYRA 4FCEA 1ZCVA 3OC9A 1ON8A 3K8DA 4IRPA 1G95A 4MNDA 2YCMA 3QVBA 2V0LA 4G3SA 3V0NA 2Y4LA 1H7TA 2JCLA 1PZTA 3FWWA 5FU0A 1WSZA 3V91A 1H7HA 2ICXA 1GX0A 2WGZA 3U2WA 4KC2A 2O1GA 1LL3A 2PX7A 1VICA 2QKXA 5CMFX 4FRAA 2A8UA 4FRHA 1VGWA 1NMMB 5C3BA 1NWGB 1GQ9A 1ZCYA 2ZU7A 1ZCTA 5FTVA 3CU0A 1R81A 1JV1A 2FYCB 5C4DA 3CGXA 4P00A 3EE5A 3GUEA 1WT2A 1OQMB 4NAIA 5L6VA 1HM0A 1XZ6A 4G3QA 5CMGX 1ZIZA 4B2WA 1R80A 5CMHA 3POLA 5C1HA 1H4CA 3IOIA 2I5KA 4B4GA 3CKNA 5CMJA 5CQPA 1H5TB 1ZJ2A 1GWVA 4LW6A 3DK5A 1S4NA 1V84A 3CKOA 5FUHA 1H5TA 2YC3A 1VH3A 4HOCA 2WE9A 2YQHA
chains in the Genus database with same CATH superfamily
4EE4A 3SXAA 3U0YA 3SXEA 1TW5A 1S4PA 1R7UA 4ARWA 1TVYA 2NXVA 4EEGA 4FIXA 1R82A 3ZF8A 4K6RA 4LW3A 4D48A 2VSHA 1YP2A 4M2AA 4L41C 2ICYA 5AJNA 1INJA 4M2BA 1TW1A 2OEGA 4Y62A 3OH3A 2WVMA 2XMEA 4FQWA 3RMVA 5C48A 4Y64A 3V0QA 1FG5N 2DPWA 4HO4A 1ZI1A 3I0HA 2WAWA 4HO9A 1QGSA 2O1HA 1H4EA 5C4EA 2VXMA 1WT3A 2FYDB 2RJ5A 2AESA 2AM5A 1NKHB 3KIAA 1H7FA 4NANA 4Y7FA 5IFYA 1ZJ0A 5DDVA 2RJ4A 4FCUA 5C49A 3OH1A 5FYEA 3ZLLA 3PKPA 2Y6PA 1VGUA 1QG8A 4EEAA 2OI7A 1R7TA 2Z86A 3D8VA 5JQQA 2VFZA 1W57A 4EE3A 1WVCA 2Z87A 5AJOA 1H7LA 4D11C 4CJCA 3OGZA 2RIZA 4FRBA 4EE5A 3PKQA 3OH0A 2VS3A 3TQDA 4M28A 1PZYB 4AAWA 4M4KA 3RSBA 2OEFA 3I0GA 3CKVA 1VM8A 2C0NA 3ZGFA 2P6WA 4B42A 4JISA 2E8BA 4KT7A 3JTJA 1IIMA 2XMHA 1G3LA 4NAKA 3CKQA 4D11A 5FTSA 2BO7A 1G23A 1ZCUA 1G9RA 1HJLA 4DECA 1ZI3A 4D0TA 3Q7UA 4FIYA 2YQCA 2Y4KA 1ZDFA 2FFUA 5CMIA 3PNNA 4XWIA 3RMWA 1GX4A 3SXBA 3SX5A 2UX8A 3Q4SA 3OAMA 4Y9XA 3U2UA 3U2TA 1ZI5A 1I52A 3SX3A 1LZJA 3V0OA 2D7IA 3USRA 2AM3A 3I0KA 2AGDA 2VSIA 2J0AA 3R3IA 2P73A 4CVHA 5EJZA 2V0IA 1YROB 5EIYA 1FO9A 2MZBA 2YC5A 4BMAA 1GWWA 5C4CA 1FGXA 2V0KA 4Y7TA 5CQLX 2JCOA 3I0IX 3Q80A 2AECA 2Y4MA 4FRDA 2RIXA 2RITA 1MC3A 4C2SA 3DUVA 1G8OA 4DDZA 2Q4JA 1H4DA 4ASJA 4HO3A 2Y4JA 1FGGA 3F1YA 3OKRA 4B4MA 4FREA 1H7QA 1H7GA 3U2XA 1FWYA 1LL0A 1W55A 5IDTA 3I0EA 5FV9A 4HO0A 2P72A 4Y6NA 1H3MA 2APCA 4KXOA 2QH5A 3U2VA 3ST8A 4HO8A 3V0LA 2QGIA 1H5SD 3F1CA 2AH9A 2OI5A 3V0MA 4KPZA 1LZIA 1H7EA 3SX7A 1KWSA 2PGVA 4IRQA 4GBPA 4MIXA 1Z90A 2FYAA 4Y7VA 1VGZA 2X60A 1JYLA 2RIYA 2BO4A 4G87A 2X5SA 5BXCA 3SXDA 4KNXA 1INIA 1TZFA 5I1FA 1FR9A 2A8WA 3OH2A 5C38A 1QWJA 1FOAA 2RJ6A 1FZWA 1GA8A 1HM9A 4CJBA 3SXCA 1O7QA 1R7VA 2CU2A 1G1LA 4B5BA 3D98A 1ZJ1A 4NALA 1GQCA 1WT0A 4Y6UA 5C3DA 5J49A 4D0ZA 1O23B 2RJ1A 2YESA 5C47A 3DJ4A 2VD4A 5C1GA 3E26A 4AC3A 4FROA 2FYBA 5CQMX 3V8YA 1W77A 3I0DA 5C36A 4KNRA 2RJ9A 2RJ7A 4HG6A 2VK9A 1G93A 1V83A 2I5EA 3O3PA 1VGTA 1VPAA 3V8ZA 2JCKA 2O1FA 3TZTA 4Y63A 2J0BA 4AYLA 1FR8A 1NQIB 2W0VA 4CJ8A 1ZJ3A 3E25A 4KPXA 3T7NA 3JUJA 3OH4A 1OMXA 1R7YA 2W0WA 1HM8A 1YP3A 1ZHJA 1O7OA 4HO5A 4O6MA 5CQOA 4B4BA 1LZ7A 4YS8A 3JUKA 1H5RB 4P02A 4G3PA 2E3DA 3IOHA 3I0JA 2X5ZA 1OMZA 3SPTA 4BQHA 2Y7AA 3FOQA 1VZXA 3HL3A 4FRLA 1FXJA 4R7PA 5CQNX 3BRKX 4J18A 1H5RA 2YQJA 4EEOA 4B3UA 4KC1A 4KC4A 1HV9A 2BO6A 2XWMA 3SXGA 4HO2A 4KRVA 3V90A 2AE7A 5D91A 1G0RA 1O0RA 2WVLA 3ZLKA 5FU8A 1ZJOA 4Y7UA 2VXLA 1FO8A 1JV3A 2FFVA 1JVDA 4JD0A 4Y7GA 4FRQA 2FY7A 2WVKA 1ZDGA 5C1LA 1JVGA 1YP4A 4ECMA 1XHBA 2VS4A 2D7RA 4ZDQA 1VH1A 1VZTA 3USQA 1WT1A 4MYBA 3K8EA 1E5KA 1ZJPA 4HCQA 5EJ1A 2XWLA 1SS9A 5HS2A 1R7XA 1NHEB 5IDSA 3U0XA 3LW6A 1LVWA 1H5SC 3ZGGA 4KQLA 3BCVA 1MP5A 4EEMA 2PA4A 5C8RA 4AYJA 2PGYA 1FXOA 2V0HA 1LL2A 2GGQA 3NGWA 3IOJA 3T7OA 4DE7A 1FRWA 4FRPA 1VZUA 2RJ0A 2X65A 2AM4A 1EZIA 1H5SB 1MP3A 2WEEA 2OI6A 2RJ8A 4UEGA 1ZI4A 2GGOA 4E1KA 4EVWA 1V82A 3N9WA 1ON6A 1G97A 2I7BA 3R2WA 1QGQA 4HO6A 1K4VA 1H5SA 3I0CA 3SX8A 5L6SA 3I0LA 5C4BA 1NF5B 1IINA 2V0JA 1LZ0A 3CKJA 5DDTA 5AJPA 1HJJA 3T7MA 4ASYA 1G2VA 2BO8A 2ZU9A 5C3AA 2VS5A 4Q7CA 1MP4A 4FRMA 2XWNA 3V0PA 5C4FA 4O6NA 1JYKA 2JCJA 2ZU8A 3I0FA 1S4OA 2D0JA 3D5NA 4B2XA 2YQSA 1EYRA 4FCEA 1ZCVA 3OC9A 1ON8A 3K8DA 4IRPA 1G95A 4MNDA 2YCMA 3QVBA 2V0LA 4G3SA 3V0NA 2Y4LA 1H7TA 2JCLA 1PZTA 3FWWA 5FU0A 1WSZA 3V91A 1H7HA 2ICXA 1GX0A 2WGZA 3U2WA 4KC2A 2O1GA 1LL3A 2PX7A 1VICA 2QKXA 5CMFX 4FRAA 2A8UA 4FRHA 1VGWA 1NMMB 5C3BA 1NWGB 1GQ9A 1ZCYA 2ZU7A 1ZCTA 5FTVA 3CU0A 1R81A 1JV1A 2FYCB 5C4DA 3CGXA 4P00A 3EE5A 3GUEA 1WT2A 1OQMB 4NAIA 5L6VA 1HM0A 1XZ6A 4G3QA 5CMGX 1ZIZA 4B2WA 1R80A 5CMHA 3POLA 5C1HA 1H4CA 3IOIA 2I5KA 4B4GA 3CKNA 5CMJA 5CQPA 1H5TB 1ZJ2A 1GWVA 4LW6A 3DK5A 5D92A 1S4NA 1V84A 3CKOA 5FUHA 1H5TA 2YC3A 1VH3A 4HOCA 2WE9A 2YQHA
chains in the Genus database with same CATH topology
4EE4A 3SXAA 3U0YA 3SXEA 1TW5A 1S4PA 1R7UA 4ARWA 1TVYA 2NXVA 4EEGA 4FIXA 1R82A 3ZF8A 4K6RA 4LW3A 4D48A 2VSHA 1YP2A 4M2AA 4L41C 2ICYA 5AJNA 1INJA 4M2BA 1TW1A 2OEGA 4Y62A 3OH3A 2WVMA 2XMEA 4FQWA 3RMVA 5C48A 4Y64A 3V0QA 1FG5N 2DPWA 4HO4A 1ZI1A 3I0HA 2WAWA 4HO9A 1QGSA 2O1HA 1H4EA 5C4EA 2VXMA 1WT3A 2FYDB 2RJ5A 2AESA 2AM5A 1NKHB 3KIAA 1H7FA 4NANA 4Y7FA 5IFYA 1ZJ0A 5DDVA 2RJ4A 4FCUA 5C49A 3OH1A 5FYEA 3ZLLA 3PKPA 2Y6PA 1VGUA 1QG8A 4EEAA 2OI7A 1R7TA 2Z86A 3D8VA 5JQQA 2VFZA 1W57A 4EE3A 1WVCA 2Z87A 5AJOA 1H7LA 4D11C 4CJCA 3OGZA 2RIZA 4FRBA 4EE5A 3PKQA 3OH0A 2VS3A 3TQDA 4M28A 1PZYB 4AAWA 4M4KA 3RSBA 2OEFA 3I0GA 3CKVA 1VM8A 2C0NA 3ZGFA 2P6WA 4B42A 4JISA 2E8BA 4KT7A 3JTJA 1IIMA 2XMHA 1G3LA 4NAKA 3CKQA 4D11A 5FTSA 2BO7A 1G23A 1ZCUA 1G9RA 1HJLA 4DECA 1ZI3A 4D0TA 3Q7UA 4FIYA 2YQCA 2Y4KA 1ZDFA 2FFUA 5CMIA 3PNNA 4XWIA 3RMWA 1GX4A 3SXBA 3SX5A 2UX8A 3Q4SA 3OAMA 4Y9XA 3U2UA 3U2TA 1ZI5A 1I52A 3SX3A 1LZJA 3V0OA 2D7IA 3USRA 2AM3A 3I0KA 2AGDA 2VSIA 2J0AA 3R3IA 2P73A 4CVHA 5EJZA 2V0IA 1YROB 5EIYA 1FO9A 2MZBA 2YC5A 4BMAA 1GWWA 5C4CA 1FGXA 2V0KA 4Y7TA 5CQLX 2JCOA 3I0IX 3Q80A 2AECA 2Y4MA 4FRDA 2RIXA 2RITA 1MC3A 4C2SA 3DUVA 1G8OA 4DDZA 2Q4JA 1H4DA 4ASJA 4HO3A 2Y4JA 1FGGA 3F1YA 3OKRA 4B4MA 4FREA 1H7QA 1H7GA 3U2XA 1FWYA 1LL0A 1W55A 5IDTA 3I0EA 5FV9A 4HO0A 2P72A 4Y6NA 1H3MA 2APCA 4KXOA 2QH5A 3U2VA 3ST8A 4HO8A 3V0LA 2QGIA 1H5SD 3F1CA 2AH9A 2OI5A 3V0MA 4KPZA 1LZIA 1H7EA 3SX7A 1KWSA 2PGVA 4IRQA 4GBPA 4MIXA 1Z90A 2FYAA 4Y7VA 1VGZA 2X60A 1JYLA 2RIYA 2BO4A 4G87A 2X5SA 5BXCA 3SXDA 4KNXA 1INIA 1TZFA 5I1FA 1FR9A 2A8WA 3OH2A 5C38A 1QWJA 1FOAA 2RJ6A 1FZWA 1GA8A 1HM9A 4CJBA 3SXCA 1O7QA 1R7VA 2CU2A 1G1LA 4B5BA 3D98A 1ZJ1A 4NALA 1GQCA 1WT0A 4Y6UA 5C3DA 5J49A 4D0ZA 1O23B 2RJ1A 2YESA 5C47A 3DJ4A 2VD4A 5C1GA 3E26A 4AC3A 4FROA 2FYBA 5CQMX 3V8YA 1W77A 3I0DA 5C36A 4KNRA 2RJ9A 2RJ7A 4HG6A 2VK9A 1G93A 1V83A 2I5EA 3O3PA 1VGTA 1VPAA 3V8ZA 2JCKA 2O1FA 3TZTA 4Y63A 2J0BA 4AYLA 1FR8A 1NQIB 2W0VA 4CJ8A 1ZJ3A 3E25A 4KPXA 3T7NA 3JUJA 3OH4A 1OMXA 1R7YA 2W0WA 1HM8A 1YP3A 1ZHJA 1O7OA 4HO5A 4O6MA 5CQOA 4B4BA 1LZ7A 4YS8A 3JUKA 1H5RB 4P02A 4G3PA 2E3DA 3IOHA 3I0JA 2X5ZA 1OMZA 3SPTA 4BQHA 2Y7AA 3FOQA 1VZXA 3HL3A 4FRLA 1FXJA 4R7PA 5CQNX 3BRKX 4J18A 1H5RA 2YQJA 4EEOA 4B3UA 4KC1A 4KC4A 1HV9A 2BO6A 2XWMA 3SXGA 4HO2A 4KRVA 3V90A 2AE7A 5D91A 1G0RA 1O0RA 2WVLA 3ZLKA 5FU8A 1ZJOA 4Y7UA 2VXLA 1FO8A 1JV3A 2FFVA 1JVDA 4JD0A 4Y7GA 4FRQA 2FY7A 2WVKA 1ZDGA 5C1LA 1JVGA 1YP4A 4ECMA 1XHBA 2VS4A 2D7RA 4ZDQA 1VH1A 1VZTA 3USQA 1WT1A 4MYBA 3K8EA 1E5KA 1ZJPA 4HCQA 5EJ1A 2XWLA 1SS9A 5HS2A 1R7XA 1NHEB 5IDSA 3U0XA 3LW6A 1LVWA 1H5SC 3ZGGA 4KQLA 3BCVA 1MP5A 4EEMA 2PA4A 5C8RA 4AYJA 2PGYA 1FXOA 2V0HA 1LL2A 2GGQA 3NGWA 3IOJA 3T7OA 4DE7A 1FRWA 4FRPA 1VZUA 2RJ0A 2X65A 2AM4A 1EZIA 1H5SB 1MP3A 2WEEA 2OI6A 2RJ8A 4UEGA 1ZI4A 2GGOA 4E1KA 4EVWA 1V82A 3N9WA 1ON6A 1G97A 2I7BA 3R2WA 1QGQA 4HO6A 1K4VA 1H5SA 3I0CA 3SX8A 5L6SA 3I0LA 5C4BA 1NF5B 1IINA 2V0JA 1LZ0A 3CKJA 5DDTA 5AJPA 1HJJA 3T7MA 4ASYA 1G2VA 2BO8A 2ZU9A 5C3AA 2VS5A 4Q7CA 1MP4A 4FRMA 2XWNA 3V0PA 5C4FA 4O6NA 1JYKA 2JCJA 2ZU8A 3I0FA 1S4OA 2D0JA 3D5NA 4B2XA 2YQSA 1EYRA 4FCEA 1ZCVA 3OC9A 1ON8A 3K8DA 4IRPA 1G95A 4MNDA 2YCMA 3QVBA 2V0LA 4G3SA 3V0NA 2Y4LA 1H7TA 2JCLA 1PZTA 3FWWA 5FU0A 1WSZA 3V91A 1H7HA 2ICXA 1GX0A 2WGZA 3U2WA 4KC2A 2O1GA 1LL3A 2PX7A 1VICA 2QKXA 5CMFX 4FRAA 2A8UA 4FRHA 1VGWA 1NMMB 5C3BA 1NWGB 1GQ9A 1ZCYA 2ZU7A 1ZCTA 5FTVA 3CU0A 1R81A 1JV1A 2FYCB 5C4DA 3CGXA 4P00A 3EE5A 3GUEA 1WT2A 1OQMB 4NAIA 5L6VA 1HM0A 1XZ6A 4G3QA 5CMGX 1ZIZA 4B2WA 1R80A 5CMHA 3POLA 5C1HA 1H4CA 3IOIA 2I5KA 4B4GA 3CKNA 5CMJA 5CQPA 1H5TB 1ZJ2A 1GWVA 4LW6A 3DK5A 5D92A 1S4NA 1V84A 3CKOA 5FUHA 1H5TA 2YC3A 1VH3A 4HOCA 2WE9A 2YQHA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4EE4 A;  3SXA A;  3U0Y A;  3SXE A;  1TW5 A;  1S4P A;  1R7U A;  4ARW A;  1TVY A;  2NXV A;  4EEG A;  3ZF8 A;  1R82 A;  4D48 A;  4K6R A;  4LW3 A;  2VSH A;  1YP2 A;  4M2A A;  4L41 C;  2ICY A;  5AJN A;  1INJ A;  4M2B A;  1TW1 A;  2OEG A;  4Y62 A;  3OH3 A;  2WVM A;  2XME A;  4FQW A;  3RMV A;  5C48 A;  4Y64 A;  3V0Q A;  1FG5 N;  2DPW A;  4HO4 A;  1ZI1 A;  3I0H A;  2WAW A;  4HO9 A;  1QGS A;  2O1H A;  1H4E A;  5C4E A;  2VXM A;  1WT3 A;  2FYD B;  2RJ5 A;  2AES A;  2AM5 A;  1NKH B;  3KIA A;  1H7F A;  4NAN A;  4Y7F A;  5IFY A;  1ZJ0 A;  5DDV A;  2RJ4 A;  4FCU A;  5C49 A;  3OH1 A;  5FYE A;  3ZLL A;  3PKP A;  2Y6P A;  1VGU A;  1QG8 A;  4EEA A;  2OI7 A;  1R7T A;  2Z86 A;  3D8V A;  5JQQ A;  2VFZ A;  1W57 A;  4EE3 A;  1WVC A;  2Z87 A;  5AJO A;  1H7L A;  4D11 C;  4CJC A;  3OGZ A;  2RIZ A;  4FRB A;  4EE5 A;  3PKQ A;  3OH0 A;  2VS3 A;  3TQD A;  4M28 A;  1PZY B;  4AAW A;  4M4K A;  3RSB A;  2OEF A;  3I0G A;  3CKV A;  1VM8 A;  3ZGF A;  2P6W A;  4B42 A;  4JIS A;  2E8B A;  4KT7 A;  3JTJ A;  1IIM A;  2XMH A;  1G3L A;  4NAK A;  3CKQ A;  4D11 A;  5FTS A;  2BO7 A;  1G23 A;  1ZCU A;  1G9R A;  1HJL A;  4DEC A;  1ZI3 A;  4D0T A;  3Q7U A;  2YQC A;  2Y4K A;  1ZDF A;  2FFU A;  5CMI A;  3PNN A;  4XWI A;  3RMW A;  1GX4 A;  3SXB A;  3SX5 A;  2UX8 A;  3Q4S A;  3OAM A;  4Y9X A;  3U2U A;  3U2T A;  1ZI5 A;  1I52 A;  3SX3 A;  1LZJ A;  3V0O A;  2D7I A;  3USR A;  2AM3 A;  3I0K A;  2AGD A;  2VSI A;  3R3I A;  2P73 A;  4CVH A;  5EJZ A;  2V0I A;  1YRO B;  5EIY A;  1FO9 A;  2MZB A;  2YC5 A;  4BMA A;  1GWW A;  5C4C A;  1FGX A;  2V0K A;  4Y7T A;  5CQL X;  2JCO A;  3I0I X;  3Q80 A;  2AEC A;  2Y4M A;  4FRD A;  2RIX A;  2RIT A;  1MC3 A;  4C2S A;  3DUV A;  1G8O A;  4DDZ A;  2Q4J A;  1H4D A;  4ASJ A;  4HO3 A;  2Y4J A;  1FGG A;  3F1Y A;  3OKR A;  4B4M A;  4FRE A;  1H7Q A;  1H7G A;  3U2X A;  1FWY A;  1LL0 A;  1W55 A;  5IDT A;  3I0E A;  5FV9 A;  4HO0 A;  2P72 A;  4Y6N A;  1H3M A;  2APC A;  4KXO A;  2QH5 A;  3U2V A;  3ST8 A;  4HO8 A;  3V0L A;  2QGI A;  1H5S D;  3F1C A;  2AH9 A;  2OI5 A;  3V0M A;  4KPZ A;  1LZI A;  1H7E A;  3SX7 A;  1KWS A;  2PGV A;  4IRQ A;  4GBP A;  1Z90 A;  2FYA A;  4Y7V A;  1VGZ A;  2X60 A;  1JYL A;  2RIY A;  2BO4 A;  4G87 A;  2X5S A;  5BXC A;  3SXD A;  4KNX A;  1INI A;  1TZF A;  5I1F A;  1FR9 A;  2A8W A;  3OH2 A;  5C38 A;  1QWJ A;  1FOA A;  2RJ6 A;  1FZW A;  1GA8 A;  1HM9 A;  4CJB A;  3SXC A;  1O7Q A;  1R7V A;  2CU2 A;  1G1L A;  4B5B A;  3D98 A;  1ZJ1 A;  4NAL A;  1GQC A;  1WT0 A;  4Y6U A;  5C3D A;  5J49 A;  4D0Z A;  1O23 B;  2RJ1 A;  2YES A;  5C47 A;  3DJ4 A;  2VD4 A;  5C1G A;  3E26 A;  4AC3 A;  4FRO A;  2FYB A;  5CQM X;  3V8Y A;  1W77 A;  3I0D A;  5C36 A;  4KNR A;  2RJ9 A;  2RJ7 A;  4HG6 A;  1G93 A;  1V83 A;  2I5E A;  3O3P A;  1VGT A;  1VPA A;  3V8Z A;  2JCK A;  2O1F A;  3TZT A;  4Y63 A;  4AYL A;  1FR8 A;  1NQI B;  2W0V A;  4CJ8 A;  1ZJ3 A;  3E25 A;  4KPX A;  3T7N A;  3JUJ A;  3OH4 A;  1OMX A;  1R7Y A;  2W0W A;  1HM8 A;  1YP3 A;  1ZHJ A;  1O7O A;  4HO5 A;  5CQO A;  4B4B A;  1LZ7 A;  4YS8 A;  3JUK A;  1H5R B;  4P02 A;  4G3P A;  2E3D A;  3IOH A;  3I0J A;  2X5Z A;  1OMZ A;  3SPT A;  4BQH A;  2Y7A A;  3FOQ A;  1VZX A;  3HL3 A;  4FRL A;  1FXJ A;  4R7P A;  5CQN X;  3BRK X;  4J18 A;  1H5R A;  2YQJ A;  4EEO A;  4B3U A;  4KC1 A;  4KC4 A;  1HV9 A;  2BO6 A;  2XWM A;  3SXG A;  4HO2 A;  4KRV A;  3V90 A;  2AE7 A;  1G0R A;  1O0R A;  2WVL A;  3ZLK A;  5FU8 A;  1ZJO A;  4Y7U A;  2VXL A;  1FO8 A;  1JV3 A;  2FFV A;  1JVD A;  4JD0 A;  4Y7G A;  4FRQ A;  2FY7 A;  2WVK A;  1ZDG A;  5C1L A;  1JVG A;  1YP4 A;  4ECM A;  1XHB A;  2VS4 A;  2D7R A;  4ZDQ A;  1VH1 A;  1VZT A;  3USQ A;  1WT1 A;  4MYB A;  3K8E A;  1E5K A;  1ZJP A;  4HCQ A;  5EJ1 A;  2XWL A;  1SS9 A;  5HS2 A;  1R7X A;  1NHE B;  5IDS A;  3U0X A;  3LW6 A;  1LVW A;  1H5S C;  3ZGG A;  4KQL A;  3BCV A;  1MP5 A;  4EEM A;  2PA4 A;  5C8R A;  4AYJ A;  2PGY A;  1FXO A;  2V0H A;  1LL2 A;  2GGQ A;  3NGW A;  3IOJ A;  3T7O A;  4DE7 A;  1FRW A;  4FRP A;  1VZU A;  2RJ0 A;  2X65 A;  2AM4 A;  1EZI A;  1H5S B;  1MP3 A;  2WEE A;  2OI6 A;  2RJ8 A;  4UEG A;  1ZI4 A;  2GGO A;  4E1K A;  4EVW A;  1V82 A;  3N9W A;  1ON6 A;  1G97 A;  2I7B A;  3R2W A;  1QGQ A;  4HO6 A;  1K4V A;  1H5S A;  3I0C A;  3SX8 A;  5L6S A;  3I0L A;  5C4B A;  1NF5 B;  1IIN A;  2V0J A;  1LZ0 A;  3CKJ A;  5DDT A;  5AJP A;  1HJJ A;  3T7M A;  4ASY A;  1G2V A;  2BO8 A;  2ZU9 A;  5C3A A;  2VS5 A;  3V0P A;  1MP4 A;  4FRM A;  2XWN A;  5C4F A;  1JYK A;  2JCJ A;  2ZU8 A;  3I0F A;  1S4O A;  2D0J A;  3D5N A;  4B2X A;  2YQS A;  1EYR A;  4FCE A;  1ZCV A;  3OC9 A;  1ON8 A;  3K8D A;  4IRP A;  1G95 A;  4MND A;  2YCM A;  3QVB A;  2V0L A;  4G3S A;  3V0N A;  2Y4L A;  1H7T A;  2JCL A;  1PZT A;  3FWW A;  5FU0 A;  1WSZ A;  3V91 A;  1H7H A;  2ICX A;  1GX0 A;  2WGZ A;  3U2W A;  4KC2 A;  2O1G A;  1LL3 A;  2PX7 A;  1VIC A;  2QKX A;  5CMF X;  4FRA A;  2A8U A;  4FRH A;  1VGW A;  1NMM B;  5C3B A;  1NWG B;  1GQ9 A;  1ZCY A;  2ZU7 A;  1ZCT A;  5FTV A;  3CU0 A;  1R81 A;  1JV1 A;  2FYC B;  5C4D A;  3CGX A;  4P00 A;  3EE5 A;  3GUE A;  1WT2 A;  1OQM B;  4NAI A;  5L6V A;  1HM0 A;  1XZ6 A;  4G3Q A;  5CMG X;  1ZIZ A;  4B2W A;  1R80 A;  5CMH A;  3POL A;  5C1H A;  1H4C A;  3IOI A;  2I5K A;  4B4G A;  3CKN A;  5CMJ A;  5CQP A;  1H5T B;  1ZJ2 A;  1GWV A;  4LW6 A;  3DK5 A;  1S4N A;  1V84 A;  3CKO A;  5FUH A;  1H5T A;  2YC3 A;  1VH3 A;  4HOC A;  2WE9 A;  2YQH A; 
#chains in the Genus database with same CATH topology
 4EE4 A;  3SXA A;  3U0Y A;  3SXE A;  1TW5 A;  1S4P A;  1R7U A;  4ARW A;  1TVY A;  2NXV A;  4EEG A;  4FIX A;  1R82 A;  3ZF8 A;  4K6R A;  4LW3 A;  4D48 A;  2VSH A;  1YP2 A;  4M2A A;  4L41 C;  2ICY A;  5AJN A;  1INJ A;  4M2B A;  1TW1 A;  2OEG A;  4Y62 A;  3OH3 A;  2WVM A;  2XME A;  4FQW A;  3RMV A;  5C48 A;  4Y64 A;  3V0Q A;  1FG5 N;  2DPW A;  4HO4 A;  1ZI1 A;  3I0H A;  2WAW A;  4HO9 A;  1QGS A;  2O1H A;  1H4E A;  5C4E A;  2VXM A;  1WT3 A;  2FYD B;  2RJ5 A;  2AES A;  2AM5 A;  1NKH B;  3KIA A;  1H7F A;  4NAN A;  4Y7F A;  5IFY A;  1ZJ0 A;  5DDV A;  2RJ4 A;  4FCU A;  5C49 A;  3OH1 A;  5FYE A;  3ZLL A;  3PKP A;  2Y6P A;  1VGU A;  1QG8 A;  4EEA A;  2OI7 A;  1R7T A;  2Z86 A;  3D8V A;  5JQQ A;  2VFZ A;  1W57 A;  4EE3 A;  1WVC A;  2Z87 A;  5AJO A;  1H7L A;  4D11 C;  4CJC A;  3OGZ A;  2RIZ A;  4FRB A;  4EE5 A;  3PKQ A;  3OH0 A;  2VS3 A;  3TQD A;  4M28 A;  1PZY B;  4AAW A;  4M4K A;  3RSB A;  2OEF A;  3I0G A;  3CKV A;  1VM8 A;  2C0N A;  3ZGF A;  2P6W A;  4B42 A;  4JIS A;  2E8B A;  4KT7 A;  3JTJ A;  1IIM A;  2XMH A;  1G3L A;  4NAK A;  3CKQ A;  4D11 A;  5FTS A;  2BO7 A;  1G23 A;  1ZCU A;  1G9R A;  1HJL A;  4DEC A;  1ZI3 A;  4D0T A;  3Q7U A;  4FIY A;  2YQC A;  2Y4K A;  1ZDF A;  2FFU A;  5CMI A;  3PNN A;  4XWI A;  3RMW A;  1GX4 A;  3SXB A;  3SX5 A;  2UX8 A;  3Q4S A;  3OAM A;  4Y9X A;  3U2U A;  3U2T A;  1ZI5 A;  1I52 A;  3SX3 A;  1LZJ A;  3V0O A;  2D7I A;  3USR A;  2AM3 A;  3I0K A;  2AGD A;  2VSI A;  2J0A A;  3R3I A;  2P73 A;  4CVH A;  5EJZ A;  2V0I A;  1YRO B;  5EIY A;  1FO9 A;  2MZB A;  2YC5 A;  4BMA A;  1GWW A;  5C4C A;  1FGX A;  2V0K A;  4Y7T A;  5CQL X;  2JCO A;  3I0I X;  3Q80 A;  2AEC A;  2Y4M A;  4FRD A;  2RIX A;  2RIT A;  1MC3 A;  4C2S A;  3DUV A;  1G8O A;  4DDZ A;  2Q4J A;  1H4D A;  4ASJ A;  4HO3 A;  2Y4J A;  1FGG A;  3F1Y A;  3OKR A;  4B4M A;  4FRE A;  1H7Q A;  1H7G A;  3U2X A;  1FWY A;  1LL0 A;  1W55 A;  5IDT A;  3I0E A;  5FV9 A;  4HO0 A;  2P72 A;  4Y6N A;  1H3M A;  2APC A;  4KXO A;  2QH5 A;  3U2V A;  3ST8 A;  4HO8 A;  3V0L A;  2QGI A;  1H5S D;  3F1C A;  2AH9 A;  2OI5 A;  3V0M A;  4KPZ A;  1LZI A;  1H7E A;  3SX7 A;  1KWS A;  2PGV A;  4IRQ A;  4GBP A;  4MIX A;  1Z90 A;  2FYA A;  4Y7V A;  1VGZ A;  2X60 A;  1JYL A;  2RIY A;  2BO4 A;  4G87 A;  2X5S A;  5BXC A;  3SXD A;  4KNX A;  1INI A;  1TZF A;  5I1F A;  1FR9 A;  2A8W A;  3OH2 A;  5C38 A;  1QWJ A;  1FOA A;  2RJ6 A;  1FZW A;  1GA8 A;  1HM9 A;  4CJB A;  3SXC A;  1O7Q A;  1R7V A;  2CU2 A;  1G1L A;  4B5B A;  3D98 A;  1ZJ1 A;  4NAL A;  1GQC A;  1WT0 A;  4Y6U A;  5C3D A;  5J49 A;  4D0Z A;  1O23 B;  2RJ1 A;  2YES A;  5C47 A;  3DJ4 A;  2VD4 A;  5C1G A;  3E26 A;  4AC3 A;  4FRO A;  2FYB A;  5CQM X;  3V8Y A;  1W77 A;  3I0D A;  5C36 A;  4KNR A;  2RJ9 A;  2RJ7 A;  4HG6 A;  2VK9 A;  1G93 A;  1V83 A;  2I5E A;  3O3P A;  1VGT A;  1VPA A;  3V8Z A;  2JCK A;  2O1F A;  3TZT A;  4Y63 A;  2J0B A;  4AYL A;  1FR8 A;  1NQI B;  2W0V A;  4CJ8 A;  1ZJ3 A;  3E25 A;  4KPX A;  3T7N A;  3JUJ A;  3OH4 A;  1OMX A;  1R7Y A;  2W0W A;  1HM8 A;  1YP3 A;  1ZHJ A;  1O7O A;  4HO5 A;  4O6M A;  5CQO A;  4B4B A;  1LZ7 A;  4YS8 A;  3JUK A;  1H5R B;  4P02 A;  4G3P A;  2E3D A;  3IOH A;  3I0J A;  2X5Z A;  1OMZ A;  3SPT A;  4BQH A;  2Y7A A;  3FOQ A;  1VZX A;  3HL3 A;  4FRL A;  1FXJ A;  4R7P A;  5CQN X;  3BRK X;  4J18 A;  1H5R A;  2YQJ A;  4EEO A;  4B3U A;  4KC1 A;  4KC4 A;  1HV9 A;  2BO6 A;  2XWM A;  3SXG A;  4HO2 A;  4KRV A;  3V90 A;  2AE7 A;  5D91 A;  1G0R A;  1O0R A;  2WVL A;  3ZLK A;  5FU8 A;  1ZJO A;  4Y7U A;  2VXL A;  1FO8 A;  1JV3 A;  2FFV A;  1JVD A;  4JD0 A;  4Y7G A;  4FRQ A;  2FY7 A;  2WVK A;  1ZDG A;  5C1L A;  1JVG A;  1YP4 A;  4ECM A;  1XHB A;  2VS4 A;  2D7R A;  4ZDQ A;  1VH1 A;  1VZT A;  3USQ A;  1WT1 A;  4MYB A;  3K8E A;  1E5K A;  1ZJP A;  4HCQ A;  5EJ1 A;  2XWL A;  1SS9 A;  5HS2 A;  1R7X A;  1NHE B;  5IDS A;  3U0X A;  3LW6 A;  1LVW A;  1H5S C;  3ZGG A;  4KQL A;  3BCV A;  1MP5 A;  4EEM A;  2PA4 A;  5C8R A;  4AYJ A;  2PGY A;  1FXO A;  2V0H A;  1LL2 A;  2GGQ A;  3NGW A;  3IOJ A;  3T7O A;  4DE7 A;  1FRW A;  4FRP A;  1VZU A;  2RJ0 A;  2X65 A;  2AM4 A;  1EZI A;  1H5S B;  1MP3 A;  2WEE A;  2OI6 A;  2RJ8 A;  4UEG A;  1ZI4 A;  2GGO A;  4E1K A;  4EVW A;  1V82 A;  3N9W A;  1ON6 A;  1G97 A;  2I7B A;  3R2W A;  1QGQ A;  4HO6 A;  1K4V A;  1H5S A;  3I0C A;  3SX8 A;  5L6S A;  3I0L A;  5C4B A;  1NF5 B;  1IIN A;  2V0J A;  1LZ0 A;  3CKJ A;  5DDT A;  5AJP A;  1HJJ A;  3T7M A;  4ASY A;  1G2V A;  2BO8 A;  2ZU9 A;  5C3A A;  2VS5 A;  4Q7C A;  1MP4 A;  4FRM A;  2XWN A;  3V0P A;  5C4F A;  4O6N A;  1JYK A;  2JCJ A;  2ZU8 A;  3I0F A;  1S4O A;  2D0J A;  3D5N A;  4B2X A;  2YQS A;  1EYR A;  4FCE A;  1ZCV A;  3OC9 A;  1ON8 A;  3K8D A;  4IRP A;  1G95 A;  4MND A;  2YCM A;  3QVB A;  2V0L A;  4G3S A;  3V0N A;  2Y4L A;  1H7T A;  2JCL A;  1PZT A;  3FWW A;  5FU0 A;  1WSZ A;  3V91 A;  1H7H A;  2ICX A;  1GX0 A;  2WGZ A;  3U2W A;  4KC2 A;  2O1G A;  1LL3 A;  2PX7 A;  1VIC A;  2QKX A;  5CMF X;  4FRA A;  2A8U A;  4FRH A;  1VGW A;  1NMM B;  5C3B A;  1NWG B;  1GQ9 A;  1ZCY A;  2ZU7 A;  1ZCT A;  5FTV A;  3CU0 A;  1R81 A;  1JV1 A;  2FYC B;  5C4D A;  3CGX A;  4P00 A;  3EE5 A;  3GUE A;  1WT2 A;  1OQM B;  4NAI A;  5L6V A;  1HM0 A;  1XZ6 A;  4G3Q A;  5CMG X;  1ZIZ A;  4B2W A;  1R80 A;  5CMH A;  3POL A;  5C1H A;  1H4C A;  3IOI A;  2I5K A;  4B4G A;  3CKN A;  5CMJ A;  5CQP A;  1H5T B;  1ZJ2 A;  1GWV A;  4LW6 A;  3DK5 A;  5D92 A;  1S4N A;  1V84 A;  3CKO A;  5FUH A;  1H5T A;  2YC3 A;  1VH3 A;  4HOC A;  2WE9 A;  2YQH A; 
#chains in the Genus database with same CATH homology
 4EE4 A;  3SXA A;  3U0Y A;  3SXE A;  1TW5 A;  1S4P A;  1R7U A;  4ARW A;  1TVY A;  2NXV A;  4EEG A;  4FIX A;  1R82 A;  3ZF8 A;  4K6R A;  4LW3 A;  4D48 A;  2VSH A;  1YP2 A;  4M2A A;  4L41 C;  2ICY A;  5AJN A;  1INJ A;  4M2B A;  1TW1 A;  2OEG A;  4Y62 A;  3OH3 A;  2WVM A;  2XME A;  4FQW A;  3RMV A;  5C48 A;  4Y64 A;  3V0Q A;  1FG5 N;  2DPW A;  4HO4 A;  1ZI1 A;  3I0H A;  2WAW A;  4HO9 A;  1QGS A;  2O1H A;  1H4E A;  5C4E A;  2VXM A;  1WT3 A;  2FYD B;  2RJ5 A;  2AES A;  2AM5 A;  1NKH B;  3KIA A;  1H7F A;  4NAN A;  4Y7F A;  5IFY A;  1ZJ0 A;  5DDV A;  2RJ4 A;  4FCU A;  5C49 A;  3OH1 A;  5FYE A;  3ZLL A;  3PKP A;  2Y6P A;  1VGU A;  1QG8 A;  4EEA A;  2OI7 A;  1R7T A;  2Z86 A;  3D8V A;  5JQQ A;  2VFZ A;  1W57 A;  4EE3 A;  1WVC A;  2Z87 A;  5AJO A;  1H7L A;  4D11 C;  4CJC A;  3OGZ A;  2RIZ A;  4FRB A;  4EE5 A;  3PKQ A;  3OH0 A;  2VS3 A;  3TQD A;  4M28 A;  1PZY B;  4AAW A;  4M4K A;  3RSB A;  2OEF A;  3I0G A;  3CKV A;  1VM8 A;  2C0N A;  3ZGF A;  2P6W A;  4B42 A;  4JIS A;  2E8B A;  4KT7 A;  3JTJ A;  1IIM A;  2XMH A;  1G3L A;  4NAK A;  3CKQ A;  4D11 A;  5FTS A;  2BO7 A;  1G23 A;  1ZCU A;  1G9R A;  1HJL A;  4DEC A;  1ZI3 A;  4D0T A;  3Q7U A;  4FIY A;  2YQC A;  2Y4K A;  1ZDF A;  2FFU A;  5CMI A;  3PNN A;  4XWI A;  3RMW A;  1GX4 A;  3SXB A;  3SX5 A;  2UX8 A;  3Q4S A;  3OAM A;  4Y9X A;  3U2U A;  3U2T A;  1ZI5 A;  1I52 A;  3SX3 A;  1LZJ A;  3V0O A;  2D7I A;  3USR A;  2AM3 A;  3I0K A;  2AGD A;  2VSI A;  2J0A A;  3R3I A;  2P73 A;  4CVH A;  5EJZ A;  2V0I A;  1YRO B;  5EIY A;  1FO9 A;  2MZB A;  2YC5 A;  4BMA A;  1GWW A;  5C4C A;  1FGX A;  2V0K A;  4Y7T A;  5CQL X;  2JCO A;  3I0I X;  3Q80 A;  2AEC A;  2Y4M A;  4FRD A;  2RIX A;  2RIT A;  1MC3 A;  4C2S A;  3DUV A;  1G8O A;  4DDZ A;  2Q4J A;  1H4D A;  4ASJ A;  4HO3 A;  2Y4J A;  1FGG A;  3F1Y A;  3OKR A;  4B4M A;  4FRE A;  1H7Q A;  1H7G A;  3U2X A;  1FWY A;  1LL0 A;  1W55 A;  5IDT A;  3I0E A;  5FV9 A;  4HO0 A;  2P72 A;  4Y6N A;  1H3M A;  2APC A;  4KXO A;  2QH5 A;  3U2V A;  3ST8 A;  4HO8 A;  3V0L A;  2QGI A;  1H5S D;  3F1C A;  2AH9 A;  2OI5 A;  3V0M A;  4KPZ A;  1LZI A;  1H7E A;  3SX7 A;  1KWS A;  2PGV A;  4IRQ A;  4GBP A;  4MIX A;  1Z90 A;  2FYA A;  4Y7V A;  1VGZ A;  2X60 A;  1JYL A;  2RIY A;  2BO4 A;  4G87 A;  2X5S A;  5BXC A;  3SXD A;  4KNX A;  1INI A;  1TZF A;  5I1F A;  1FR9 A;  2A8W A;  3OH2 A;  5C38 A;  1QWJ A;  1FOA A;  2RJ6 A;  1FZW A;  1GA8 A;  1HM9 A;  4CJB A;  3SXC A;  1O7Q A;  1R7V A;  2CU2 A;  1G1L A;  4B5B A;  3D98 A;  1ZJ1 A;  4NAL A;  1GQC A;  1WT0 A;  4Y6U A;  5C3D A;  5J49 A;  4D0Z A;  1O23 B;  2RJ1 A;  2YES A;  5C47 A;  3DJ4 A;  2VD4 A;  5C1G A;  3E26 A;  4AC3 A;  4FRO A;  2FYB A;  5CQM X;  3V8Y A;  1W77 A;  3I0D A;  5C36 A;  4KNR A;  2RJ9 A;  2RJ7 A;  4HG6 A;  2VK9 A;  1G93 A;  1V83 A;  2I5E A;  3O3P A;  1VGT A;  1VPA A;  3V8Z A;  2JCK A;  2O1F A;  3TZT A;  4Y63 A;  2J0B A;  4AYL A;  1FR8 A;  1NQI B;  2W0V A;  4CJ8 A;  1ZJ3 A;  3E25 A;  4KPX A;  3T7N A;  3JUJ A;  3OH4 A;  1OMX A;  1R7Y A;  2W0W A;  1HM8 A;  1YP3 A;  1ZHJ A;  1O7O A;  4HO5 A;  4O6M A;  5CQO A;  4B4B A;  1LZ7 A;  4YS8 A;  3JUK A;  1H5R B;  4P02 A;  4G3P A;  2E3D A;  3IOH A;  3I0J A;  2X5Z A;  1OMZ A;  3SPT A;  4BQH A;  2Y7A A;  3FOQ A;  1VZX A;  3HL3 A;  4FRL A;  1FXJ A;  4R7P A;  5CQN X;  3BRK X;  4J18 A;  1H5R A;  2YQJ A;  4EEO A;  4B3U A;  4KC1 A;  4KC4 A;  1HV9 A;  2BO6 A;  2XWM A;  3SXG A;  4HO2 A;  4KRV A;  3V90 A;  2AE7 A;  5D91 A;  1G0R A;  1O0R A;  2WVL A;  3ZLK A;  5FU8 A;  1ZJO A;  4Y7U A;  2VXL A;  1FO8 A;  1JV3 A;  2FFV A;  1JVD A;  4JD0 A;  4Y7G A;  4FRQ A;  2FY7 A;  2WVK A;  1ZDG A;  5C1L A;  1JVG A;  1YP4 A;  4ECM A;  1XHB A;  2VS4 A;  2D7R A;  4ZDQ A;  1VH1 A;  1VZT A;  3USQ A;  1WT1 A;  4MYB A;  3K8E A;  1E5K A;  1ZJP A;  4HCQ A;  5EJ1 A;  2XWL A;  1SS9 A;  5HS2 A;  1R7X A;  1NHE B;  5IDS A;  3U0X A;  3LW6 A;  1LVW A;  1H5S C;  3ZGG A;  4KQL A;  3BCV A;  1MP5 A;  4EEM A;  2PA4 A;  5C8R A;  4AYJ A;  2PGY A;  1FXO A;  2V0H A;  1LL2 A;  2GGQ A;  3NGW A;  3IOJ A;  3T7O A;  4DE7 A;  1FRW A;  4FRP A;  1VZU A;  2RJ0 A;  2X65 A;  2AM4 A;  1EZI A;  1H5S B;  1MP3 A;  2WEE A;  2OI6 A;  2RJ8 A;  4UEG A;  1ZI4 A;  2GGO A;  4E1K A;  4EVW A;  1V82 A;  3N9W A;  1ON6 A;  1G97 A;  2I7B A;  3R2W A;  1QGQ A;  4HO6 A;  1K4V A;  1H5S A;  3I0C A;  3SX8 A;  5L6S A;  3I0L A;  5C4B A;  1NF5 B;  1IIN A;  2V0J A;  1LZ0 A;  3CKJ A;  5DDT A;  5AJP A;  1HJJ A;  3T7M A;  4ASY A;  1G2V A;  2BO8 A;  2ZU9 A;  5C3A A;  2VS5 A;  4Q7C A;  1MP4 A;  4FRM A;  2XWN A;  3V0P A;  5C4F A;  4O6N A;  1JYK A;  2JCJ A;  2ZU8 A;  3I0F A;  1S4O A;  2D0J A;  3D5N A;  4B2X A;  2YQS A;  1EYR A;  4FCE A;  1ZCV A;  3OC9 A;  1ON8 A;  3K8D A;  4IRP A;  1G95 A;  4MND A;  2YCM A;  3QVB A;  2V0L A;  4G3S A;  3V0N A;  2Y4L A;  1H7T A;  2JCL A;  1PZT A;  3FWW A;  5FU0 A;  1WSZ A;  3V91 A;  1H7H A;  2ICX A;  1GX0 A;  2WGZ A;  3U2W A;  4KC2 A;  2O1G A;  1LL3 A;  2PX7 A;  1VIC A;  2QKX A;  5CMF X;  4FRA A;  2A8U A;  4FRH A;  1VGW A;  1NMM B;  5C3B A;  1NWG B;  1GQ9 A;  1ZCY A;  2ZU7 A;  1ZCT A;  5FTV A;  3CU0 A;  1R81 A;  1JV1 A;  2FYC B;  5C4D A;  3CGX A;  4P00 A;  3EE5 A;  3GUE A;  1WT2 A;  1OQM B;  4NAI A;  5L6V A;  1HM0 A;  1XZ6 A;  4G3Q A;  5CMG X;  1ZIZ A;  4B2W A;  1R80 A;  5CMH A;  3POL A;  5C1H A;  1H4C A;  3IOI A;  2I5K A;  4B4G A;  3CKN A;  5CMJ A;  5CQP A;  1H5T B;  1ZJ2 A;  1GWV A;  4LW6 A;  3DK5 A;  5D92 A;  1S4N A;  1V84 A;  3CKO A;  5FUH A;  1H5T A;  2YC3 A;  1VH3 A;  4HOC A;  2WE9 A;  2YQH A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...