2MZBA

Solution structural studies of gtp:adenosylcobinamide-phosphate guanylyltransferase (coby) from methanocaldococcus jannaschii
Total Genus 49
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
49
sequence length
196
structure length
196
Chain Sequence
MDALIMAGGKGTRMGGVEKPLIKLCGRCLIDYVVSPLLKSKVNNIFIATSPNTPKTKEYINSAYKDYKNIVVIDTSGKGYIEDLNECIGYFSEPFLVVSSDLINLKSKIINSIVDYFYCIKAKTPDVEALAVMIPKEKYPNPSIDFNGLVPAGINVVSPKHGYQKEEIMVIDELIFNINTKDDLKLAEMLLKKDGL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords Adenosylcobinamide-phosphate guanylyltransferase
publication title Solution Structural Studies of GTP:Adenosylcobinamide-Phosphateguanylyl Transferase (CobY) from Methanocaldococcus jannaschii.
pubmed doi rcsb
source organism Methanocaldococcus jannaschii
total genus 49
structure length 196
sequence length 196
ec nomenclature ec 2.7.7.62: Adenosylcobinamide-phosphate guanylyltransferase.
pdb deposition date 2015-02-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF12804 NTP_transf_3 MobA-like NTP transferase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.550.10 Alpha Beta Alpha-Beta Complex Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A 2mzbA00
2P6WA 5C48A 3V8ZA 1FZWA 2Y4MA 1V83A 2VD4A 2XWNA 1HM8A 4NALA 1QG8A 1ON6A 2RITA 4CJ8A 1S4PA 2BO7A 2XMHA 1H7EA 3T7MA 4FRMA 2FYDB 1TW5A 2OI5A 4LW3A 2RJ8A 5DDTA 1GX4A 5C4BA 1VGZA 1H5SD 5CQMX 2FYAA 1QWJA 2WE9A 1FXOA 1FO9A 1JV3A 2VS3A 4UEGA 4G3SA 4NAKA 4FRLA 3CKOA 3D98A 5CMIA 1VH3A 2X5ZA 3PNNA 5C4DA 3BCVA 2YQHA 1INJA 2O1GA 2RJ9A 4MNDA 3I0KA 4HO9A 1Z90A 1VZTA 1GX0A 2RIXA 2YC3A 1G1LA 2V0LA 2CU2A 1YROB 3ZGFA 2RJ6A 3LW6A 1ZJ1A 3E25A 4M2AA 5C36A 3R3IA 5CMJA 3JUJA 1VGUA 4FRBA 1I52A 4LW6A 4B42A 1S4NA 2V0KA 5HS2A 1VH1A 2GGOA 1W57A 4B4MA 4HO2A 1H7FA 4ECMA 2AH9A 1INIA 2X60A 1NF5B 4EEMA 2VXMA 4YS8A 3RMWA 2Z86A 4BMAA 1FGXA 1H5SA 4M28A 3PKQA 1GQ9A 4KC4A 3SX5A 4EVWA 4Y7UA 3I0GA 5EIYA 1WVCA 1LZ0A 1GQCA 3QVBA 4P00A 2AECA 4FRHA 2AM5A 5IFYA 3K8EA 1V84A 1ZDFA 4KNXA 2FFVA 1HJLA 1FO8A 2YQSA 4HO0A 1G2VA 1WT2A 2XMEA 1GA8A 1H4DA 2VSIA 4Y6UA 1FGGA 4FRAA 1ZI5A 4HO6A 1H5TB 3IOHA 1WSZA 2O1FA 5FTSA 1QGQA 2RJ4A 3OGZA 3OAMA 3U0XA 5C1HA 1K4VA 1WT1A 1ZHJA 1FR9A 1VGWA 1TW1A 2Y4KA 3I0HA 3SXDA 2P73A 3I0CA 3FOQA 2UX8A 1R7YA 1WT3A 1MC3A 5FUHA 1H5RB 2XWMA 3IOJA 1H4EA 4Y7FA 3SXEA 2MZBA 3OH2A 1R7VA 1IIMA 3ZF8A 1VGTA 5EJZA 2D7IA 4G87A 1TVYA 5FTVA 1H7GA 3USRA 4KPZA 5C8RA 2Z87A 3SXGA 1NKHB 5IDSA 2A8UA 1OQMB 3I0FA 4KQLA 2FYBA 4FRQA 1V82A 1MP3A 1WT0A 2YCMA 2OI6A 1VPAA 3HL3A 5CMGX 5C3AA 1VZUA 2NXVA 2ZU7A 2Y4LA 2V0JA 1FR8A 4B2WA 3CU0A 2ICYA 2E3DA 2PGYA 1GWWA 4ZDQA 1G9RA 1G97A 1H7QA 4Y63A 1ZCUA 2FFUA 2YC5A 2BO6A 4KRVA 1VZXA 3I0LA 3EE5A 1ZCVA 2FY7A 2AM3A 2I5KA 4P02A 1H5TA 3I0IX 4D48A 3V0QA 2X65A 5C3DA 1R82A 3SXAA 3U2TA 3U2VA 5C4FA 1O23B 2BO8A 4Y9XA 1R7TA 3T7OA 3RSBA 1O0RA 2VSHA 1LZIA 4G3QA 4Y6NA 4EEAA 4D0ZA 3OH0A 3V8YA 1H5RA 1MP4A 2ICXA 4AC3A 3NGWA 3FWWA 5C3BA 4IRPA 3SX3A 4D11A 4HOCA 1ZJ2A 2RJ0A 5C1GA 4C2SA 1XZ6A 4CJCA 3SXBA 1S4OA 2W0VA 3SX8A 3F1CA 2WGZA 3OC9A 1G23A 1PZYB 5CMFX 5C4CA 1G0RA 2RIZA 1ZI3A 1LL0A 2VFZA 2PGVA 2V0IA 2VS5A 1YP2A 3OH3A 5DDVA 2FYCB 3KIAA 4Y7VA 4CVHA 4JISA 1G3LA 4HG6A 5CQLX 3V0MA 1NQIB 3CKJA 2WVKA 2JCJA 1G93A 5J49A 4Y7TA 5L6SA 5FYEA 1ON8A 5C4EA 3O3PA 3Q4SA 1LVWA 2OI7A 1JV1A 1LL2A 2QH5A 1W55A 1VM8A 1ZJPA 4FREA 1W77A 1R7UA 4FRDA 4AAWA 2WAWA 3OKRA 3R2WA 4FRPA 3E26A 1ZCTA 4KXOA 1MP5A 2BO4A 4M2BA 3I0DA 3T7NA 1LZ7A 4HO3A 2OEGA 4HO5A 5CQPA 3GUEA 3SXCA 4Y7GA 2O1HA 3N9WA 3DK5A 2XWLA 1ZJ0A 4NANA 4K6RA 4IRQA 1ZI4A 1R81A 1G95A 1ZJOA 3JUKA 3U2WA 2GGQA 1H5SC 3TQDA 1O7QA 4KNRA 2JCKA 4ASYA 2Q4JA 5AJNA 4G3PA 2ZU8A 3I0JA 4M4KA 2VXLA 3U0YA 1IINA 2Y6PA 4DE7A 5IDTA 1R80A 1G8OA 2I7BA 3DJ4A 4ASJA 1E5KA 4FCUA 3TZTA 5FV9A 4BQHA 1NHEB 1JVGA 5L6VA 1LL3A 1FXJA 1H4CA 1H7LA 4B4BA 2I5EA 2X5SA 1HM0A 4KC2A 3V0OA 1JYLA 4GBPA 2RJ7A 2DPWA 3ZGGA 3K8DA 5AJPA 1XHBA 2WVMA 5FU8A 2D0JA 4HO4A 5CQNX 4EEOA 1FRWA 5CMHA 4EE5A 2PX7A 2APCA 2RIYA 2AE7A 4XWIA 5JQQA 4AYJA 3ZLKA 5I1FA 1HV9A 4B5BA 1OMXA 4KPXA 3Q7UA 1TZFA 1R7XA 1GWVA 2PA4A 1FWYA 5C49A 3Q80A 1VICA 3IOIA 3PKPA 1O7OA 4FCEA 1H7TA 4KC1A 5CQOA 2QGIA 2Y4JA 1FG5N 2RJ5A 5C38A 3JTJA 2JCOA 4KT7A 3RMVA 1PZTA 1HM9A 3SX7A 1SS9A 5C47A 4B4GA 2V0HA 4HCQA 2AM4A 1JYKA 3DUVA 2YQCA 4JD0A 4NAIA 4L41C 2QKXA 2OEFA 4R7PA 1ZCYA 5C1LA 1EYRA 4E1KA 4B2XA 4EE4A 1NWGB 2AESA 3USQA 2WEEA 3BRKX 5EJ1A 2JCLA 3V0PA 1NMMB 2YESA 2AGDA 2Y7AA 1ZIZA 5AJOA 1JVDA 3V0NA 1EZIA 4EE3A 4Y62A 3CKQA 1ZDGA 2ZU9A 4AYLA 3CKNA 2A8WA 4MYBA 4Y64A 1ZI1A 2YQJA 3D8VA 2W0WA 3SPTA 3V90A 3I0EA 2P72A 4DECA 4EEGA 3ZLLA 4J18A 3POLA 3CGXA 3V0LA 4ARWA 5FU0A 3V91A 3U2XA 3F1YA 3OH4A 1FOAA 1YP3A 1LZJA 1QGSA 2RJ1A 4FQWA 4CJBA 1H7HA 1H5SB 4B3UA 3U2UA 5BXCA 1H3MA 2VS4A 1OMZA 3CKVA 2WVLA 4HO8A 3OH1A 4DDZA 1KWSA 1YP4A 1ZJ3A 3D5NA 3ST8A 4D11C 2E8BA 4D0TA 1HJJA 4FROA 2D7RA
chains in the Genus database with same CATH superfamily
5D91A 2P6WA 5C48A 3V8ZA 1FZWA 2Y4MA 1V83A 2VD4A 2XWNA 4FIXA 1HM8A 4NALA 1QG8A 1ON6A 2RITA 4CJ8A 1S4PA 2BO7A 2XMHA 1H7EA 3T7MA 4FRMA 2FYDB 1TW5A 2OI5A 4LW3A 2RJ8A 5DDTA 1GX4A 5C4BA 1VGZA 1H5SD 5CQMX 2FYAA 1QWJA 2WE9A 1FXOA 1FO9A 1JV3A 2VS3A 4UEGA 4G3SA 4NAKA 4FRLA 3CKOA 3D98A 5CMIA 1VH3A 2X5ZA 3PNNA 5C4DA 3BCVA 2YQHA 1INJA 2O1GA 2RJ9A 4MNDA 3I0KA 4HO9A 1Z90A 1VZTA 1GX0A 2RIXA 2YC3A 1G1LA 2V0LA 2CU2A 1YROB 3ZGFA 2RJ6A 3LW6A 1ZJ1A 3E25A 4M2AA 5C36A 3R3IA 5CMJA 3JUJA 1VGUA 4FRBA 1I52A 4LW6A 4B42A 1S4NA 2V0KA 5HS2A 1VH1A 2GGOA 1W57A 4B4MA 4HO2A 1H7FA 4ECMA 2AH9A 1INIA 2X60A 1NF5B 4EEMA 2VXMA 4YS8A 3RMWA 2Z86A 4BMAA 1FGXA 1H5SA 4M28A 3PKQA 1GQ9A 4KC4A 3SX5A 4EVWA 4Y7UA 3I0GA 5EIYA 1WVCA 1LZ0A 1GQCA 3QVBA 4P00A 2AECA 4FRHA 2AM5A 5IFYA 3K8EA 1V84A 1ZDFA 4KNXA 2FFVA 1HJLA 1FO8A 2YQSA 4HO0A 1G2VA 1WT2A 2XMEA 4O6MA 1GA8A 1H4DA 2VSIA 4Y6UA 1FGGA 4FRAA 1ZI5A 4HO6A 1H5TB 3IOHA 1WSZA 2O1FA 5FTSA 1QGQA 2RJ4A 3OGZA 3OAMA 3U0XA 5C1HA 1K4VA 2J0BA 1WT1A 1ZHJA 1FR9A 1VGWA 1TW1A 2Y4KA 3I0HA 3SXDA 2P73A 3I0CA 3FOQA 2UX8A 1R7YA 1WT3A 1MC3A 5FUHA 1H5RB 2XWMA 3IOJA 1H4EA 4Y7FA 3SXEA 2MZBA 3OH2A 1R7VA 1IIMA 3ZF8A 1VGTA 5EJZA 2D7IA 4G87A 1TVYA 5FTVA 1H7GA 3USRA 4KPZA 5C8RA 2Z87A 3SXGA 1NKHB 5IDSA 2A8UA 1OQMB 3I0FA 4KQLA 2FYBA 4FRQA 1V82A 1MP3A 1WT0A 2YCMA 2OI6A 1VPAA 3HL3A 5CMGX 5C3AA 1VZUA 2NXVA 2ZU7A 2Y4LA 2V0JA 1FR8A 4B2WA 3CU0A 4MIXA 2ICYA 2E3DA 2PGYA 1GWWA 4ZDQA 1G9RA 1G97A 2C0NA 1H7QA 4Y63A 1ZCUA 2FFUA 2YC5A 2BO6A 4KRVA 1VZXA 3I0LA 3EE5A 1ZCVA 2FY7A 2AM3A 2I5KA 4P02A 1H5TA 3I0IX 4D48A 3V0QA 2X65A 5C3DA 1R82A 3SXAA 3U2TA 3U2VA 5C4FA 1O23B 2BO8A 4Y9XA 1R7TA 3T7OA 3RSBA 1O0RA 2VSHA 1LZIA 4G3QA 4Y6NA 4EEAA 4D0ZA 3OH0A 3V8YA 1H5RA 1MP4A 2ICXA 4AC3A 3NGWA 3FWWA 5C3BA 4IRPA 3SX3A 4D11A 4HOCA 1ZJ2A 2RJ0A 5C1GA 4C2SA 1XZ6A 4CJCA 3SXBA 1S4OA 2W0VA 3SX8A 3F1CA 2WGZA 3OC9A 1G23A 1PZYB 5CMFX 5C4CA 1G0RA 2RIZA 1ZI3A 1LL0A 2VFZA 2PGVA 2V0IA 2VS5A 1YP2A 3OH3A 5DDVA 2FYCB 3KIAA 4Y7VA 4CVHA 4JISA 1G3LA 4HG6A 5CQLX 3V0MA 1NQIB 3CKJA 2WVKA 2JCJA 1G93A 5J49A 4Y7TA 5L6SA 5FYEA 1ON8A 5C4EA 3O3PA 3Q4SA 1LVWA 2OI7A 1JV1A 4FIYA 1LL2A 2QH5A 1W55A 1VM8A 1ZJPA 4FREA 1W77A 1R7UA 4FRDA 4AAWA 2WAWA 3OKRA 2J0AA 3R2WA 4FRPA 3E26A 1ZCTA 4KXOA 1MP5A 2BO4A 4M2BA 3I0DA 3T7NA 1LZ7A 4HO3A 2OEGA 4HO5A 5CQPA 3GUEA 3SXCA 4Y7GA 2O1HA 3N9WA 3DK5A 2XWLA 1ZJ0A 4NANA 4K6RA 4IRQA 1ZI4A 1R81A 1G95A 1ZJOA 3JUKA 3U2WA 2GGQA 1H5SC 3TQDA 1O7QA 4KNRA 2JCKA 4ASYA 2Q4JA 5AJNA 4G3PA 2ZU8A 3I0JA 4M4KA 2VXLA 3U0YA 1IINA 2Y6PA 4DE7A 5IDTA 1R80A 1G8OA 2I7BA 3DJ4A 4ASJA 1E5KA 4FCUA 3TZTA 5FV9A 4BQHA 2VK9A 1NHEB 1JVGA 5L6VA 1LL3A 1FXJA 1H4CA 1H7LA 4B4BA 2I5EA 2X5SA 1HM0A 4KC2A 5D92A 1JYLA 4GBPA 3V0OA 2RJ7A 2DPWA 3ZGGA 3K8DA 5AJPA 1XHBA 2WVMA 5FU8A 2D0JA 4HO4A 5CQNX 4EEOA 1FRWA 5CMHA 4EE5A 2PX7A 2APCA 2RIYA 2AE7A 4XWIA 5JQQA 4AYJA 3ZLKA 5I1FA 1HV9A 4B5BA 1OMXA 4KPXA 3Q7UA 1TZFA 1R7XA 1GWVA 2PA4A 1FWYA 5C49A 3Q80A 1VICA 3IOIA 3PKPA 1O7OA 4FCEA 1H7TA 4KC1A 5CQOA 2QGIA 2Y4JA 1FG5N 2RJ5A 5C38A 3JTJA 2JCOA 4KT7A 3RMVA 1PZTA 1HM9A 3SX7A 1SS9A 5C47A 4B4GA 2V0HA 4HCQA 2AM4A 1JYKA 3DUVA 2YQCA 4JD0A 4NAIA 4L41C 2QKXA 2OEFA 4R7PA 1ZCYA 5C1LA 1EYRA 4E1KA 4B2XA 4EE4A 1NWGB 2AESA 3USQA 2WEEA 3BRKX 5EJ1A 2JCLA 3V0PA 1NMMB 2YESA 2AGDA 4Q7CA 2Y7AA 1ZIZA 5AJOA 1JVDA 3V0NA 4O6NA 1EZIA 4EE3A 4Y62A 3CKQA 1ZDGA 2ZU9A 4AYLA 3CKNA 2A8WA 4MYBA 4Y64A 1ZI1A 2YQJA 3D8VA 2W0WA 3SPTA 3V90A 3I0EA 2P72A 4DECA 4EEGA 3ZLLA 4J18A 3POLA 3CGXA 3V0LA 4ARWA 5FU0A 3V91A 3U2XA 3F1YA 3OH4A 1FOAA 1YP3A 1LZJA 1QGSA 2RJ1A 4FQWA 4CJBA 1H7HA 1H5SB 4B3UA 3U2UA 5BXCA 1H3MA 2VS4A 1OMZA 3CKVA 2WVLA 4HO8A 3OH1A 4DDZA 1KWSA 1YP4A 1ZJ3A 3D5NA 3ST8A 4D11C 2E8BA 4D0TA 1HJJA 4FROA 2D7RA
chains in the Genus database with same CATH topology
5D91A 2P6WA 5C48A 3V8ZA 1FZWA 2Y4MA 1V83A 2VD4A 2XWNA 4FIXA 1HM8A 4NALA 1QG8A 1ON6A 2RITA 4CJ8A 1S4PA 2BO7A 2XMHA 1H7EA 3T7MA 4FRMA 2FYDB 1TW5A 2OI5A 4LW3A 2RJ8A 5DDTA 1GX4A 5C4BA 1VGZA 1H5SD 5CQMX 2FYAA 1QWJA 2WE9A 1FXOA 1FO9A 1JV3A 2VS3A 4UEGA 4G3SA 4NAKA 4FRLA 3CKOA 3D98A 5CMIA 1VH3A 2X5ZA 3PNNA 5C4DA 3BCVA 2YQHA 1INJA 2O1GA 2RJ9A 4MNDA 3I0KA 4HO9A 1Z90A 1VZTA 1GX0A 2RIXA 2YC3A 1G1LA 2V0LA 2CU2A 1YROB 3ZGFA 2RJ6A 3LW6A 1ZJ1A 3E25A 4M2AA 5C36A 3R3IA 5CMJA 3JUJA 1VGUA 4FRBA 1I52A 4LW6A 4B42A 1S4NA 2V0KA 5HS2A 1VH1A 2GGOA 1W57A 4B4MA 4HO2A 1H7FA 4ECMA 2AH9A 1INIA 2X60A 1NF5B 4EEMA 2VXMA 4YS8A 3RMWA 2Z86A 4BMAA 1FGXA 1H5SA 4M28A 3PKQA 1GQ9A 4KC4A 3SX5A 4EVWA 4Y7UA 3I0GA 5EIYA 1WVCA 1LZ0A 1GQCA 3QVBA 4P00A 2AECA 4FRHA 2AM5A 5IFYA 3K8EA 1V84A 1ZDFA 4KNXA 2FFVA 1HJLA 1FO8A 2YQSA 4HO0A 1G2VA 1WT2A 2XMEA 4O6MA 1GA8A 1H4DA 2VSIA 4Y6UA 1FGGA 4FRAA 1ZI5A 4HO6A 1H5TB 3IOHA 1WSZA 2O1FA 5FTSA 1QGQA 2RJ4A 3OGZA 3OAMA 3U0XA 5C1HA 1K4VA 2J0BA 1WT1A 1ZHJA 1FR9A 1VGWA 1TW1A 2Y4KA 3I0HA 3SXDA 2P73A 3I0CA 3FOQA 2UX8A 1R7YA 1WT3A 1MC3A 5FUHA 1H5RB 2XWMA 3IOJA 1H4EA 4Y7FA 3SXEA 2MZBA 3OH2A 1R7VA 1IIMA 3ZF8A 1VGTA 5EJZA 2D7IA 4G87A 1TVYA 5FTVA 1H7GA 3USRA 4KPZA 5C8RA 2Z87A 3SXGA 1NKHB 5IDSA 2A8UA 1OQMB 3I0FA 4KQLA 2FYBA 4FRQA 1V82A 1MP3A 1WT0A 2YCMA 2OI6A 1VPAA 3HL3A 5CMGX 5C3AA 1VZUA 2NXVA 2ZU7A 2Y4LA 2V0JA 1FR8A 4B2WA 3CU0A 4MIXA 2ICYA 2E3DA 2PGYA 1GWWA 4ZDQA 1G9RA 1G97A 2C0NA 1H7QA 4Y63A 1ZCUA 2FFUA 2YC5A 2BO6A 4KRVA 1VZXA 3I0LA 3EE5A 1ZCVA 2FY7A 2AM3A 2I5KA 4P02A 1H5TA 3I0IX 4D48A 3V0QA 2X65A 5C3DA 1R82A 3SXAA 3U2TA 3U2VA 5C4FA 1O23B 2BO8A 4Y9XA 1R7TA 3T7OA 3RSBA 1O0RA 2VSHA 1LZIA 4G3QA 4Y6NA 4EEAA 4D0ZA 3OH0A 3V8YA 1H5RA 1MP4A 2ICXA 4AC3A 3NGWA 3FWWA 5C3BA 4IRPA 3SX3A 4D11A 4HOCA 1ZJ2A 2RJ0A 5C1GA 4C2SA 1XZ6A 4CJCA 3SXBA 1S4OA 2W0VA 3SX8A 3F1CA 2WGZA 3OC9A 1G23A 1PZYB 5CMFX 5C4CA 1G0RA 2RIZA 1ZI3A 1LL0A 2VFZA 2PGVA 2V0IA 2VS5A 1YP2A 3OH3A 5DDVA 2FYCB 3KIAA 4Y7VA 4CVHA 4JISA 1G3LA 4HG6A 5CQLX 3V0MA 1NQIB 3CKJA 2WVKA 2JCJA 1G93A 5J49A 4Y7TA 5L6SA 5FYEA 1ON8A 5C4EA 3O3PA 3Q4SA 1LVWA 2OI7A 1JV1A 4FIYA 1LL2A 2QH5A 1W55A 1VM8A 1ZJPA 4FREA 1W77A 1R7UA 4FRDA 4AAWA 2WAWA 3OKRA 2J0AA 3R2WA 4FRPA 3E26A 1ZCTA 4KXOA 1MP5A 2BO4A 4M2BA 3I0DA 3T7NA 1LZ7A 4HO3A 2OEGA 4HO5A 5CQPA 3GUEA 3SXCA 4Y7GA 2O1HA 3N9WA 3DK5A 2XWLA 1ZJ0A 4NANA 4K6RA 4IRQA 1ZI4A 1R81A 1G95A 1ZJOA 3JUKA 3U2WA 2GGQA 1H5SC 3TQDA 1O7QA 4KNRA 2JCKA 4ASYA 2Q4JA 5AJNA 4G3PA 2ZU8A 3I0JA 4M4KA 2VXLA 3U0YA 1IINA 2Y6PA 4DE7A 5IDTA 1R80A 1G8OA 2I7BA 3DJ4A 4ASJA 1E5KA 4FCUA 3TZTA 5FV9A 4BQHA 2VK9A 1NHEB 1JVGA 5L6VA 1LL3A 1FXJA 1H4CA 1H7LA 4B4BA 2I5EA 2X5SA 1HM0A 4KC2A 5D92A 1JYLA 4GBPA 3V0OA 2RJ7A 2DPWA 3ZGGA 3K8DA 5AJPA 1XHBA 2WVMA 5FU8A 2D0JA 4HO4A 5CQNX 4EEOA 1FRWA 5CMHA 4EE5A 2PX7A 2APCA 2RIYA 2AE7A 4XWIA 5JQQA 4AYJA 3ZLKA 5I1FA 1HV9A 4B5BA 1OMXA 4KPXA 3Q7UA 1TZFA 1R7XA 1GWVA 2PA4A 1FWYA 5C49A 3Q80A 1VICA 3IOIA 3PKPA 1O7OA 4FCEA 1H7TA 4KC1A 5CQOA 2QGIA 2Y4JA 1FG5N 2RJ5A 5C38A 3JTJA 2JCOA 4KT7A 3RMVA 1PZTA 1HM9A 3SX7A 1SS9A 5C47A 4B4GA 2V0HA 4HCQA 2AM4A 1JYKA 3DUVA 2YQCA 4JD0A 4NAIA 4L41C 2QKXA 2OEFA 4R7PA 1ZCYA 5C1LA 1EYRA 4E1KA 4B2XA 4EE4A 1NWGB 2AESA 3USQA 2WEEA 3BRKX 5EJ1A 2JCLA 3V0PA 1NMMB 2YESA 2AGDA 4Q7CA 2Y7AA 1ZIZA 5AJOA 1JVDA 3V0NA 4O6NA 1EZIA 4EE3A 4Y62A 3CKQA 1ZDGA 2ZU9A 4AYLA 3CKNA 2A8WA 4MYBA 4Y64A 1ZI1A 2YQJA 3D8VA 2W0WA 3SPTA 3V90A 3I0EA 2P72A 4DECA 4EEGA 3ZLLA 4J18A 3POLA 3CGXA 3V0LA 4ARWA 5FU0A 3V91A 3U2XA 3F1YA 3OH4A 1FOAA 1YP3A 1LZJA 1QGSA 2RJ1A 4FQWA 4CJBA 1H7HA 1H5SB 4B3UA 3U2UA 5BXCA 1H3MA 2VS4A 1OMZA 3CKVA 2WVLA 4HO8A 3OH1A 4DDZA 1KWSA 1YP4A 1ZJ3A 3D5NA 3ST8A 4D11C 2E8BA 4D0TA 1HJJA 4FROA 2D7RA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2P6W A;  5C48 A;  3V8Z A;  1FZW A;  2Y4M A;  1V83 A;  2VD4 A;  2XWN A;  1HM8 A;  4NAL A;  1QG8 A;  1ON6 A;  2RIT A;  4CJ8 A;  1S4P A;  2BO7 A;  2XMH A;  1H7E A;  3T7M A;  4FRM A;  2FYD B;  1TW5 A;  2OI5 A;  4LW3 A;  2RJ8 A;  5DDT A;  1GX4 A;  5C4B A;  1VGZ A;  1H5S D;  5CQM X;  2FYA A;  1QWJ A;  2WE9 A;  1FXO A;  1FO9 A;  1JV3 A;  2VS3 A;  4UEG A;  4G3S A;  4NAK A;  4FRL A;  3CKO A;  3D98 A;  5CMI A;  1VH3 A;  2X5Z A;  3PNN A;  5C4D A;  3BCV A;  2YQH A;  1INJ A;  2O1G A;  2RJ9 A;  4MND A;  3I0K A;  4HO9 A;  1Z90 A;  1VZT A;  1GX0 A;  2RIX A;  2YC3 A;  1G1L A;  2V0L A;  2CU2 A;  1YRO B;  3ZGF A;  2RJ6 A;  3LW6 A;  1ZJ1 A;  3E25 A;  4M2A A;  5C36 A;  3R3I A;  5CMJ A;  3JUJ A;  1VGU A;  4FRB A;  1I52 A;  4LW6 A;  4B42 A;  1S4N A;  2V0K A;  5HS2 A;  1VH1 A;  2GGO A;  1W57 A;  4B4M A;  4HO2 A;  1H7F A;  4ECM A;  2AH9 A;  1INI A;  2X60 A;  1NF5 B;  4EEM A;  2VXM A;  4YS8 A;  3RMW A;  2Z86 A;  4BMA A;  1FGX A;  1H5S A;  4M28 A;  3PKQ A;  1GQ9 A;  4KC4 A;  3SX5 A;  4EVW A;  4Y7U A;  3I0G A;  5EIY A;  1WVC A;  1LZ0 A;  1GQC A;  3QVB A;  4P00 A;  2AEC A;  4FRH A;  2AM5 A;  5IFY A;  3K8E A;  1V84 A;  1ZDF A;  4KNX A;  2FFV A;  1HJL A;  1FO8 A;  2YQS A;  4HO0 A;  1G2V A;  1WT2 A;  2XME A;  1GA8 A;  1H4D A;  2VSI A;  4Y6U A;  1FGG A;  4FRA A;  1ZI5 A;  4HO6 A;  1H5T B;  3IOH A;  1WSZ A;  2O1F A;  5FTS A;  1QGQ A;  2RJ4 A;  3OGZ A;  3OAM A;  3U0X A;  5C1H A;  1K4V A;  1WT1 A;  1ZHJ A;  1FR9 A;  1VGW A;  1TW1 A;  2Y4K A;  3I0H A;  3SXD A;  2P73 A;  3I0C A;  3FOQ A;  2UX8 A;  1R7Y A;  1WT3 A;  1MC3 A;  5FUH A;  1H5R B;  2XWM A;  3IOJ A;  1H4E A;  4Y7F A;  3SXE A;  2MZB A;  3OH2 A;  1R7V A;  1IIM A;  3ZF8 A;  1VGT A;  5EJZ A;  2D7I A;  4G87 A;  1TVY A;  5FTV A;  1H7G A;  3USR A;  4KPZ A;  5C8R A;  2Z87 A;  3SXG A;  1NKH B;  5IDS A;  2A8U A;  1OQM B;  3I0F A;  4KQL A;  2FYB A;  4FRQ A;  1V82 A;  1MP3 A;  1WT0 A;  2YCM A;  2OI6 A;  1VPA A;  3HL3 A;  5CMG X;  5C3A A;  1VZU A;  2NXV A;  2ZU7 A;  2Y4L A;  2V0J A;  1FR8 A;  4B2W A;  3CU0 A;  2ICY A;  2E3D A;  2PGY A;  1GWW A;  4ZDQ A;  1G9R A;  1G97 A;  1H7Q A;  4Y63 A;  1ZCU A;  2FFU A;  2YC5 A;  2BO6 A;  4KRV A;  1VZX A;  3I0L A;  3EE5 A;  1ZCV A;  2FY7 A;  2AM3 A;  2I5K A;  4P02 A;  1H5T A;  3I0I X;  4D48 A;  3V0Q A;  2X65 A;  5C3D A;  1R82 A;  3SXA A;  3U2T A;  3U2V A;  5C4F A;  1O23 B;  2BO8 A;  4Y9X A;  1R7T A;  3T7O A;  3RSB A;  1O0R A;  2VSH A;  1LZI A;  4G3Q A;  4Y6N A;  4EEA A;  4D0Z A;  3OH0 A;  3V8Y A;  1H5R A;  1MP4 A;  2ICX A;  4AC3 A;  3NGW A;  3FWW A;  5C3B A;  4IRP A;  3SX3 A;  4D11 A;  4HOC A;  1ZJ2 A;  2RJ0 A;  5C1G A;  4C2S A;  1XZ6 A;  4CJC A;  3SXB A;  1S4O A;  2W0V A;  3SX8 A;  3F1C A;  2WGZ A;  3OC9 A;  1G23 A;  1PZY B;  5CMF X;  5C4C A;  1G0R A;  2RIZ A;  1ZI3 A;  1LL0 A;  2VFZ A;  2PGV A;  2V0I A;  2VS5 A;  1YP2 A;  3OH3 A;  5DDV A;  2FYC B;  3KIA A;  4Y7V A;  4CVH A;  4JIS A;  1G3L A;  4HG6 A;  5CQL X;  3V0M A;  1NQI B;  3CKJ A;  2WVK A;  2JCJ A;  1G93 A;  5J49 A;  4Y7T A;  5L6S A;  5FYE A;  1ON8 A;  5C4E A;  3O3P A;  3Q4S A;  1LVW A;  2OI7 A;  1JV1 A;  1LL2 A;  2QH5 A;  1W55 A;  1VM8 A;  1ZJP A;  4FRE A;  1W77 A;  1R7U A;  4FRD A;  4AAW A;  2WAW A;  3OKR A;  3R2W A;  4FRP A;  3E26 A;  1ZCT A;  4KXO A;  1MP5 A;  2BO4 A;  4M2B A;  3I0D A;  3T7N A;  1LZ7 A;  4HO3 A;  2OEG A;  4HO5 A;  5CQP A;  3GUE A;  3SXC A;  4Y7G A;  2O1H A;  3N9W A;  3DK5 A;  2XWL A;  1ZJ0 A;  4NAN A;  4K6R A;  4IRQ A;  1ZI4 A;  1R81 A;  1G95 A;  1ZJO A;  3JUK A;  3U2W A;  2GGQ A;  1H5S C;  3TQD A;  1O7Q A;  4KNR A;  2JCK A;  4ASY A;  2Q4J A;  5AJN A;  4G3P A;  2ZU8 A;  3I0J A;  4M4K A;  2VXL A;  3U0Y A;  1IIN A;  2Y6P A;  4DE7 A;  5IDT A;  1R80 A;  1G8O A;  2I7B A;  3DJ4 A;  4ASJ A;  1E5K A;  4FCU A;  3TZT A;  5FV9 A;  4BQH A;  1NHE B;  1JVG A;  5L6V A;  1LL3 A;  1FXJ A;  1H4C A;  1H7L A;  4B4B A;  2I5E A;  2X5S A;  1HM0 A;  4KC2 A;  3V0O A;  1JYL A;  4GBP A;  2RJ7 A;  2DPW A;  3ZGG A;  3K8D A;  5AJP A;  1XHB A;  2WVM A;  5FU8 A;  2D0J A;  4HO4 A;  5CQN X;  4EEO A;  1FRW A;  5CMH A;  4EE5 A;  2PX7 A;  2APC A;  2RIY A;  2AE7 A;  4XWI A;  5JQQ A;  4AYJ A;  3ZLK A;  5I1F A;  1HV9 A;  4B5B A;  1OMX A;  4KPX A;  3Q7U A;  1TZF A;  1R7X A;  1GWV A;  2PA4 A;  1FWY A;  5C49 A;  3Q80 A;  1VIC A;  3IOI A;  3PKP A;  1O7O A;  4FCE A;  1H7T A;  4KC1 A;  5CQO A;  2QGI A;  2Y4J A;  1FG5 N;  2RJ5 A;  5C38 A;  3JTJ A;  2JCO A;  4KT7 A;  3RMV A;  1PZT A;  1HM9 A;  3SX7 A;  1SS9 A;  5C47 A;  4B4G A;  2V0H A;  4HCQ A;  2AM4 A;  1JYK A;  3DUV A;  2YQC A;  4JD0 A;  4NAI A;  4L41 C;  2QKX A;  2OEF A;  4R7P A;  1ZCY A;  5C1L A;  1EYR A;  4E1K A;  4B2X A;  4EE4 A;  1NWG B;  2AES A;  3USQ A;  2WEE A;  3BRK X;  5EJ1 A;  2JCL A;  3V0P A;  1NMM B;  2YES A;  2AGD A;  2Y7A A;  1ZIZ A;  5AJO A;  1JVD A;  3V0N A;  1EZI A;  4EE3 A;  4Y62 A;  3CKQ A;  1ZDG A;  2ZU9 A;  4AYL A;  3CKN A;  2A8W A;  4MYB A;  4Y64 A;  1ZI1 A;  2YQJ A;  3D8V A;  2W0W A;  3SPT A;  3V90 A;  3I0E A;  2P72 A;  4DEC A;  4EEG A;  3ZLL A;  4J18 A;  3POL A;  3CGX A;  3V0L A;  4ARW A;  5FU0 A;  3V91 A;  3U2X A;  3F1Y A;  3OH4 A;  1FOA A;  1YP3 A;  1LZJ A;  1QGS A;  2RJ1 A;  4FQW A;  4CJB A;  1H7H A;  1H5S B;  4B3U A;  3U2U A;  5BXC A;  1H3M A;  2VS4 A;  1OMZ A;  3CKV A;  2WVL A;  4HO8 A;  3OH1 A;  4DDZ A;  1KWS A;  1YP4 A;  1ZJ3 A;  3D5N A;  3ST8 A;  4D11 C;  2E8B A;  4D0T A;  1HJJ A;  4FRO A;  2D7R A; 
#chains in the Genus database with same CATH topology
 5D91 A;  2P6W A;  5C48 A;  3V8Z A;  1FZW A;  2Y4M A;  1V83 A;  2VD4 A;  2XWN A;  4FIX A;  1HM8 A;  4NAL A;  1QG8 A;  1ON6 A;  2RIT A;  4CJ8 A;  1S4P A;  2BO7 A;  2XMH A;  1H7E A;  3T7M A;  4FRM A;  2FYD B;  1TW5 A;  2OI5 A;  4LW3 A;  2RJ8 A;  5DDT A;  1GX4 A;  5C4B A;  1VGZ A;  1H5S D;  5CQM X;  2FYA A;  1QWJ A;  2WE9 A;  1FXO A;  1FO9 A;  1JV3 A;  2VS3 A;  4UEG A;  4G3S A;  4NAK A;  4FRL A;  3CKO A;  3D98 A;  5CMI A;  1VH3 A;  2X5Z A;  3PNN A;  5C4D A;  3BCV A;  2YQH A;  1INJ A;  2O1G A;  2RJ9 A;  4MND A;  3I0K A;  4HO9 A;  1Z90 A;  1VZT A;  1GX0 A;  2RIX A;  2YC3 A;  1G1L A;  2V0L A;  2CU2 A;  1YRO B;  3ZGF A;  2RJ6 A;  3LW6 A;  1ZJ1 A;  3E25 A;  4M2A A;  5C36 A;  3R3I A;  5CMJ A;  3JUJ A;  1VGU A;  4FRB A;  1I52 A;  4LW6 A;  4B42 A;  1S4N A;  2V0K A;  5HS2 A;  1VH1 A;  2GGO A;  1W57 A;  4B4M A;  4HO2 A;  1H7F A;  4ECM A;  2AH9 A;  1INI A;  2X60 A;  1NF5 B;  4EEM A;  2VXM A;  4YS8 A;  3RMW A;  2Z86 A;  4BMA A;  1FGX A;  1H5S A;  4M28 A;  3PKQ A;  1GQ9 A;  4KC4 A;  3SX5 A;  4EVW A;  4Y7U A;  3I0G A;  5EIY A;  1WVC A;  1LZ0 A;  1GQC A;  3QVB A;  4P00 A;  2AEC A;  4FRH A;  2AM5 A;  5IFY A;  3K8E A;  1V84 A;  1ZDF A;  4KNX A;  2FFV A;  1HJL A;  1FO8 A;  2YQS A;  4HO0 A;  1G2V A;  1WT2 A;  2XME A;  4O6M A;  1GA8 A;  1H4D A;  2VSI A;  4Y6U A;  1FGG A;  4FRA A;  1ZI5 A;  4HO6 A;  1H5T B;  3IOH A;  1WSZ A;  2O1F A;  5FTS A;  1QGQ A;  2RJ4 A;  3OGZ A;  3OAM A;  3U0X A;  5C1H A;  1K4V A;  2J0B A;  1WT1 A;  1ZHJ A;  1FR9 A;  1VGW A;  1TW1 A;  2Y4K A;  3I0H A;  3SXD A;  2P73 A;  3I0C A;  3FOQ A;  2UX8 A;  1R7Y A;  1WT3 A;  1MC3 A;  5FUH A;  1H5R B;  2XWM A;  3IOJ A;  1H4E A;  4Y7F A;  3SXE A;  2MZB A;  3OH2 A;  1R7V A;  1IIM A;  3ZF8 A;  1VGT A;  5EJZ A;  2D7I A;  4G87 A;  1TVY A;  5FTV A;  1H7G A;  3USR A;  4KPZ A;  5C8R A;  2Z87 A;  3SXG A;  1NKH B;  5IDS A;  2A8U A;  1OQM B;  3I0F A;  4KQL A;  2FYB A;  4FRQ A;  1V82 A;  1MP3 A;  1WT0 A;  2YCM A;  2OI6 A;  1VPA A;  3HL3 A;  5CMG X;  5C3A A;  1VZU A;  2NXV A;  2ZU7 A;  2Y4L A;  2V0J A;  1FR8 A;  4B2W A;  3CU0 A;  4MIX A;  2ICY A;  2E3D A;  2PGY A;  1GWW A;  4ZDQ A;  1G9R A;  1G97 A;  2C0N A;  1H7Q A;  4Y63 A;  1ZCU A;  2FFU A;  2YC5 A;  2BO6 A;  4KRV A;  1VZX A;  3I0L A;  3EE5 A;  1ZCV A;  2FY7 A;  2AM3 A;  2I5K A;  4P02 A;  1H5T A;  3I0I X;  4D48 A;  3V0Q A;  2X65 A;  5C3D A;  1R82 A;  3SXA A;  3U2T A;  3U2V A;  5C4F A;  1O23 B;  2BO8 A;  4Y9X A;  1R7T A;  3T7O A;  3RSB A;  1O0R A;  2VSH A;  1LZI A;  4G3Q A;  4Y6N A;  4EEA A;  4D0Z A;  3OH0 A;  3V8Y A;  1H5R A;  1MP4 A;  2ICX A;  4AC3 A;  3NGW A;  3FWW A;  5C3B A;  4IRP A;  3SX3 A;  4D11 A;  4HOC A;  1ZJ2 A;  2RJ0 A;  5C1G A;  4C2S A;  1XZ6 A;  4CJC A;  3SXB A;  1S4O A;  2W0V A;  3SX8 A;  3F1C A;  2WGZ A;  3OC9 A;  1G23 A;  1PZY B;  5CMF X;  5C4C A;  1G0R A;  2RIZ A;  1ZI3 A;  1LL0 A;  2VFZ A;  2PGV A;  2V0I A;  2VS5 A;  1YP2 A;  3OH3 A;  5DDV A;  2FYC B;  3KIA A;  4Y7V A;  4CVH A;  4JIS A;  1G3L A;  4HG6 A;  5CQL X;  3V0M A;  1NQI B;  3CKJ A;  2WVK A;  2JCJ A;  1G93 A;  5J49 A;  4Y7T A;  5L6S A;  5FYE A;  1ON8 A;  5C4E A;  3O3P A;  3Q4S A;  1LVW A;  2OI7 A;  1JV1 A;  4FIY A;  1LL2 A;  2QH5 A;  1W55 A;  1VM8 A;  1ZJP A;  4FRE A;  1W77 A;  1R7U A;  4FRD A;  4AAW A;  2WAW A;  3OKR A;  2J0A A;  3R2W A;  4FRP A;  3E26 A;  1ZCT A;  4KXO A;  1MP5 A;  2BO4 A;  4M2B A;  3I0D A;  3T7N A;  1LZ7 A;  4HO3 A;  2OEG A;  4HO5 A;  5CQP A;  3GUE A;  3SXC A;  4Y7G A;  2O1H A;  3N9W A;  3DK5 A;  2XWL A;  1ZJ0 A;  4NAN A;  4K6R A;  4IRQ A;  1ZI4 A;  1R81 A;  1G95 A;  1ZJO A;  3JUK A;  3U2W A;  2GGQ A;  1H5S C;  3TQD A;  1O7Q A;  4KNR A;  2JCK A;  4ASY A;  2Q4J A;  5AJN A;  4G3P A;  2ZU8 A;  3I0J A;  4M4K A;  2VXL A;  3U0Y A;  1IIN A;  2Y6P A;  4DE7 A;  5IDT A;  1R80 A;  1G8O A;  2I7B A;  3DJ4 A;  4ASJ A;  1E5K A;  4FCU A;  3TZT A;  5FV9 A;  4BQH A;  2VK9 A;  1NHE B;  1JVG A;  5L6V A;  1LL3 A;  1FXJ A;  1H4C A;  1H7L A;  4B4B A;  2I5E A;  2X5S A;  1HM0 A;  4KC2 A;  5D92 A;  1JYL A;  4GBP A;  3V0O A;  2RJ7 A;  2DPW A;  3ZGG A;  3K8D A;  5AJP A;  1XHB A;  2WVM A;  5FU8 A;  2D0J A;  4HO4 A;  5CQN X;  4EEO A;  1FRW A;  5CMH A;  4EE5 A;  2PX7 A;  2APC A;  2RIY A;  2AE7 A;  4XWI A;  5JQQ A;  4AYJ A;  3ZLK A;  5I1F A;  1HV9 A;  4B5B A;  1OMX A;  4KPX A;  3Q7U A;  1TZF A;  1R7X A;  1GWV A;  2PA4 A;  1FWY A;  5C49 A;  3Q80 A;  1VIC A;  3IOI A;  3PKP A;  1O7O A;  4FCE A;  1H7T A;  4KC1 A;  5CQO A;  2QGI A;  2Y4J A;  1FG5 N;  2RJ5 A;  5C38 A;  3JTJ A;  2JCO A;  4KT7 A;  3RMV A;  1PZT A;  1HM9 A;  3SX7 A;  1SS9 A;  5C47 A;  4B4G A;  2V0H A;  4HCQ A;  2AM4 A;  1JYK A;  3DUV A;  2YQC A;  4JD0 A;  4NAI A;  4L41 C;  2QKX A;  2OEF A;  4R7P A;  1ZCY A;  5C1L A;  1EYR A;  4E1K A;  4B2X A;  4EE4 A;  1NWG B;  2AES A;  3USQ A;  2WEE A;  3BRK X;  5EJ1 A;  2JCL A;  3V0P A;  1NMM B;  2YES A;  2AGD A;  4Q7C A;  2Y7A A;  1ZIZ A;  5AJO A;  1JVD A;  3V0N A;  4O6N A;  1EZI A;  4EE3 A;  4Y62 A;  3CKQ A;  1ZDG A;  2ZU9 A;  4AYL A;  3CKN A;  2A8W A;  4MYB A;  4Y64 A;  1ZI1 A;  2YQJ A;  3D8V A;  2W0W A;  3SPT A;  3V90 A;  3I0E A;  2P72 A;  4DEC A;  4EEG A;  3ZLL A;  4J18 A;  3POL A;  3CGX A;  3V0L A;  4ARW A;  5FU0 A;  3V91 A;  3U2X A;  3F1Y A;  3OH4 A;  1FOA A;  1YP3 A;  1LZJ A;  1QGS A;  2RJ1 A;  4FQW A;  4CJB A;  1H7H A;  1H5S B;  4B3U A;  3U2U A;  5BXC A;  1H3M A;  2VS4 A;  1OMZ A;  3CKV A;  2WVL A;  4HO8 A;  3OH1 A;  4DDZ A;  1KWS A;  1YP4 A;  1ZJ3 A;  3D5N A;  3ST8 A;  4D11 C;  2E8B A;  4D0T A;  1HJJ A;  4FRO A;  2D7R A; 
#chains in the Genus database with same CATH homology
 5D91 A;  2P6W A;  5C48 A;  3V8Z A;  1FZW A;  2Y4M A;  1V83 A;  2VD4 A;  2XWN A;  4FIX A;  1HM8 A;  4NAL A;  1QG8 A;  1ON6 A;  2RIT A;  4CJ8 A;  1S4P A;  2BO7 A;  2XMH A;  1H7E A;  3T7M A;  4FRM A;  2FYD B;  1TW5 A;  2OI5 A;  4LW3 A;  2RJ8 A;  5DDT A;  1GX4 A;  5C4B A;  1VGZ A;  1H5S D;  5CQM X;  2FYA A;  1QWJ A;  2WE9 A;  1FXO A;  1FO9 A;  1JV3 A;  2VS3 A;  4UEG A;  4G3S A;  4NAK A;  4FRL A;  3CKO A;  3D98 A;  5CMI A;  1VH3 A;  2X5Z A;  3PNN A;  5C4D A;  3BCV A;  2YQH A;  1INJ A;  2O1G A;  2RJ9 A;  4MND A;  3I0K A;  4HO9 A;  1Z90 A;  1VZT A;  1GX0 A;  2RIX A;  2YC3 A;  1G1L A;  2V0L A;  2CU2 A;  1YRO B;  3ZGF A;  2RJ6 A;  3LW6 A;  1ZJ1 A;  3E25 A;  4M2A A;  5C36 A;  3R3I A;  5CMJ A;  3JUJ A;  1VGU A;  4FRB A;  1I52 A;  4LW6 A;  4B42 A;  1S4N A;  2V0K A;  5HS2 A;  1VH1 A;  2GGO A;  1W57 A;  4B4M A;  4HO2 A;  1H7F A;  4ECM A;  2AH9 A;  1INI A;  2X60 A;  1NF5 B;  4EEM A;  2VXM A;  4YS8 A;  3RMW A;  2Z86 A;  4BMA A;  1FGX A;  1H5S A;  4M28 A;  3PKQ A;  1GQ9 A;  4KC4 A;  3SX5 A;  4EVW A;  4Y7U A;  3I0G A;  5EIY A;  1WVC A;  1LZ0 A;  1GQC A;  3QVB A;  4P00 A;  2AEC A;  4FRH A;  2AM5 A;  5IFY A;  3K8E A;  1V84 A;  1ZDF A;  4KNX A;  2FFV A;  1HJL A;  1FO8 A;  2YQS A;  4HO0 A;  1G2V A;  1WT2 A;  2XME A;  4O6M A;  1GA8 A;  1H4D A;  2VSI A;  4Y6U A;  1FGG A;  4FRA A;  1ZI5 A;  4HO6 A;  1H5T B;  3IOH A;  1WSZ A;  2O1F A;  5FTS A;  1QGQ A;  2RJ4 A;  3OGZ A;  3OAM A;  3U0X A;  5C1H A;  1K4V A;  2J0B A;  1WT1 A;  1ZHJ A;  1FR9 A;  1VGW A;  1TW1 A;  2Y4K A;  3I0H A;  3SXD A;  2P73 A;  3I0C A;  3FOQ A;  2UX8 A;  1R7Y A;  1WT3 A;  1MC3 A;  5FUH A;  1H5R B;  2XWM A;  3IOJ A;  1H4E A;  4Y7F A;  3SXE A;  2MZB A;  3OH2 A;  1R7V A;  1IIM A;  3ZF8 A;  1VGT A;  5EJZ A;  2D7I A;  4G87 A;  1TVY A;  5FTV A;  1H7G A;  3USR A;  4KPZ A;  5C8R A;  2Z87 A;  3SXG A;  1NKH B;  5IDS A;  2A8U A;  1OQM B;  3I0F A;  4KQL A;  2FYB A;  4FRQ A;  1V82 A;  1MP3 A;  1WT0 A;  2YCM A;  2OI6 A;  1VPA A;  3HL3 A;  5CMG X;  5C3A A;  1VZU A;  2NXV A;  2ZU7 A;  2Y4L A;  2V0J A;  1FR8 A;  4B2W A;  3CU0 A;  4MIX A;  2ICY A;  2E3D A;  2PGY A;  1GWW A;  4ZDQ A;  1G9R A;  1G97 A;  2C0N A;  1H7Q A;  4Y63 A;  1ZCU A;  2FFU A;  2YC5 A;  2BO6 A;  4KRV A;  1VZX A;  3I0L A;  3EE5 A;  1ZCV A;  2FY7 A;  2AM3 A;  2I5K A;  4P02 A;  1H5T A;  3I0I X;  4D48 A;  3V0Q A;  2X65 A;  5C3D A;  1R82 A;  3SXA A;  3U2T A;  3U2V A;  5C4F A;  1O23 B;  2BO8 A;  4Y9X A;  1R7T A;  3T7O A;  3RSB A;  1O0R A;  2VSH A;  1LZI A;  4G3Q A;  4Y6N A;  4EEA A;  4D0Z A;  3OH0 A;  3V8Y A;  1H5R A;  1MP4 A;  2ICX A;  4AC3 A;  3NGW A;  3FWW A;  5C3B A;  4IRP A;  3SX3 A;  4D11 A;  4HOC A;  1ZJ2 A;  2RJ0 A;  5C1G A;  4C2S A;  1XZ6 A;  4CJC A;  3SXB A;  1S4O A;  2W0V A;  3SX8 A;  3F1C A;  2WGZ A;  3OC9 A;  1G23 A;  1PZY B;  5CMF X;  5C4C A;  1G0R A;  2RIZ A;  1ZI3 A;  1LL0 A;  2VFZ A;  2PGV A;  2V0I A;  2VS5 A;  1YP2 A;  3OH3 A;  5DDV A;  2FYC B;  3KIA A;  4Y7V A;  4CVH A;  4JIS A;  1G3L A;  4HG6 A;  5CQL X;  3V0M A;  1NQI B;  3CKJ A;  2WVK A;  2JCJ A;  1G93 A;  5J49 A;  4Y7T A;  5L6S A;  5FYE A;  1ON8 A;  5C4E A;  3O3P A;  3Q4S A;  1LVW A;  2OI7 A;  1JV1 A;  4FIY A;  1LL2 A;  2QH5 A;  1W55 A;  1VM8 A;  1ZJP A;  4FRE A;  1W77 A;  1R7U A;  4FRD A;  4AAW A;  2WAW A;  3OKR A;  2J0A A;  3R2W A;  4FRP A;  3E26 A;  1ZCT A;  4KXO A;  1MP5 A;  2BO4 A;  4M2B A;  3I0D A;  3T7N A;  1LZ7 A;  4HO3 A;  2OEG A;  4HO5 A;  5CQP A;  3GUE A;  3SXC A;  4Y7G A;  2O1H A;  3N9W A;  3DK5 A;  2XWL A;  1ZJ0 A;  4NAN A;  4K6R A;  4IRQ A;  1ZI4 A;  1R81 A;  1G95 A;  1ZJO A;  3JUK A;  3U2W A;  2GGQ A;  1H5S C;  3TQD A;  1O7Q A;  4KNR A;  2JCK A;  4ASY A;  2Q4J A;  5AJN A;  4G3P A;  2ZU8 A;  3I0J A;  4M4K A;  2VXL A;  3U0Y A;  1IIN A;  2Y6P A;  4DE7 A;  5IDT A;  1R80 A;  1G8O A;  2I7B A;  3DJ4 A;  4ASJ A;  1E5K A;  4FCU A;  3TZT A;  5FV9 A;  4BQH A;  2VK9 A;  1NHE B;  1JVG A;  5L6V A;  1LL3 A;  1FXJ A;  1H4C A;  1H7L A;  4B4B A;  2I5E A;  2X5S A;  1HM0 A;  4KC2 A;  5D92 A;  1JYL A;  4GBP A;  3V0O A;  2RJ7 A;  2DPW A;  3ZGG A;  3K8D A;  5AJP A;  1XHB A;  2WVM A;  5FU8 A;  2D0J A;  4HO4 A;  5CQN X;  4EEO A;  1FRW A;  5CMH A;  4EE5 A;  2PX7 A;  2APC A;  2RIY A;  2AE7 A;  4XWI A;  5JQQ A;  4AYJ A;  3ZLK A;  5I1F A;  1HV9 A;  4B5B A;  1OMX A;  4KPX A;  3Q7U A;  1TZF A;  1R7X A;  1GWV A;  2PA4 A;  1FWY A;  5C49 A;  3Q80 A;  1VIC A;  3IOI A;  3PKP A;  1O7O A;  4FCE A;  1H7T A;  4KC1 A;  5CQO A;  2QGI A;  2Y4J A;  1FG5 N;  2RJ5 A;  5C38 A;  3JTJ A;  2JCO A;  4KT7 A;  3RMV A;  1PZT A;  1HM9 A;  3SX7 A;  1SS9 A;  5C47 A;  4B4G A;  2V0H A;  4HCQ A;  2AM4 A;  1JYK A;  3DUV A;  2YQC A;  4JD0 A;  4NAI A;  4L41 C;  2QKX A;  2OEF A;  4R7P A;  1ZCY A;  5C1L A;  1EYR A;  4E1K A;  4B2X A;  4EE4 A;  1NWG B;  2AES A;  3USQ A;  2WEE A;  3BRK X;  5EJ1 A;  2JCL A;  3V0P A;  1NMM B;  2YES A;  2AGD A;  4Q7C A;  2Y7A A;  1ZIZ A;  5AJO A;  1JVD A;  3V0N A;  4O6N A;  1EZI A;  4EE3 A;  4Y62 A;  3CKQ A;  1ZDG A;  2ZU9 A;  4AYL A;  3CKN A;  2A8W A;  4MYB A;  4Y64 A;  1ZI1 A;  2YQJ A;  3D8V A;  2W0W A;  3SPT A;  3V90 A;  3I0E A;  2P72 A;  4DEC A;  4EEG A;  3ZLL A;  4J18 A;  3POL A;  3CGX A;  3V0L A;  4ARW A;  5FU0 A;  3V91 A;  3U2X A;  3F1Y A;  3OH4 A;  1FOA A;  1YP3 A;  1LZJ A;  1QGS A;  2RJ1 A;  4FQW A;  4CJB A;  1H7H A;  1H5S B;  4B3U A;  3U2U A;  5BXC A;  1H3M A;  2VS4 A;  1OMZ A;  3CKV A;  2WVL A;  4HO8 A;  3OH1 A;  4DDZ A;  1KWS A;  1YP4 A;  1ZJ3 A;  3D5N A;  3ST8 A;  4D11 C;  2E8B A;  4D0T A;  1HJJ A;  4FRO A;  2D7R A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...