3I0IX

Crystal structure of gtb c80s/c196s/c209s + udp
Total Genus 91
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
91
sequence length
275
structure length
272
Chain Sequence
YPQPKVLTPSRKDVLVVTPWLAPIVWEGTFNIDILNEQFRLQNTTIGLTVFAIKKYVAFLKLFLETAEKHFMVGHRVHYYVFTDQPAAVPRVTLGTGRQLSVLEVGRWQDVSMRRMEMISDFSERRFLSEVDYLVSVDVDMEFRDHVGVEILTPLFGTLHPSFYGSSREAFTYERRPQSQAYIPKDEGDFYYMGAFFGGSVQEVQRLTRACHQAMMVDQANGIEAVWHDESHLNKYLLRHKPTKVLSPEYLWDQQLLGWPAVLRKLRFTAVP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords ABO glycosyltransferase
publication title Cysteine-to-serine mutants dramatically reorder the active site of human ABO(H) blood group B glycosyltransferase without affecting activity: structural insights into cooperative substrate binding
pubmed doi rcsb
source organism Homo sapiens
total genus 91
structure length 272
sequence length 275
ec nomenclature ec 2.4.1.37: Fucosylgalactoside 3-alpha-galactosyltransferase.
pdb deposition date 2009-06-25
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.550.10 Alpha Beta Alpha-Beta Complex Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A 3i0iX00
1EZIA 2PA4A 1WT3A 1LL3A 2BO7A 5CMJA 2XWNA 4G3SA 4CJCA 3ZGGA 2BO6A 5FU0A 4KC2A 2A8WA 3V8ZA 3V8YA 1HM9A 3USQA 3SX8A 2D0JA 5FTSA 3PNNA 2P73A 5FYEA 2Y7AA 4CVHA 4YS8A 1VGZA 1V83A 3I0HA 1FZWA 1JVGA 3I0IX 1YP2A 3I0CA 1V82A 1V84A 3CKNA 1R7YA 2D7IA 1FO8A 2XMEA 1S4PA 5L6SA 5CQLX 1INJA 2AH9A 3RMVA 1XZ6A 2MZBA 1TVYA 2VXLA 3U0XA 4Y7GA 2Z86A 2DPWA 1FR8A 3V90A 3D98A 2FYDB 4B42A 1ZJ1A 4BQHA 5C49A 4ZDQA 4FRLA 5C1GA 1QGSA 1JYKA 1ZCUA 1HV9A 1HJJA 4Y7UA 2WAWA 2P72A 5CMHA 3ST8A 3Q7UA 2GGQA 3USRA 4LW3A 4FRHA 4FROA 1I52A 2O1FA 3ZF8A 3U0YA 2XWMA 4M2BA 2WE9A 5AJOA 2FY7A 4HO2A 4JISA 1JV3A 1MP4A 1NHEB 2WVKA 2X5SA 1NMMB 1VM8A 3K8DA 4G87A 4KXOA 1ZJ0A 1ZJOA 1ZCYA 1GQCA 3IOIA 4Y6NA 5BXCA 1ZCTA 2AM3A 4HOCA 4EE5A 2RJ4A 4CJBA 2FYBA 1O7QA 4NAIA 5FU8A 2FYCB 2RIZA 3POLA 4FQWA 1H5SA 2OI7A 1FXOA 4D11A 2YQSA 2WGZA 1VGUA 1HM0A 1MP3A 3R2WA 3SXEA 1FOAA 1EYRA 2VSIA 3DUVA 2GGOA 1LL0A 3SXGA 4UEGA 5C3DA 4M28A 1VZTA 2E3DA 4B5BA 5I1FA 1H5RA 1Z90A 4DECA 4HCQA 1K4VA 3EE5A 1H4CA 1W77A 1ON6A 4B4MA 3DJ4A 1G9RA 3T7MA 4DE7A 4B4BA 5C48A 3CGXA 1ON8A 2ZU9A 2Y4MA 1WT1A 3T7NA 1TW5A 4C2SA 2JCKA 3LW6A 4EVWA 2V0KA 1FGGA 2XWLA 1ZCVA 1OMXA 3OH3A 5AJNA 2V0LA 4FRQA 4AYLA 4FRBA 1QWJA 3N9WA 2ZU8A 2YQHA 5JQQA 2V0IA 3CKVA 1R7XA 2AE7A 3I0EA 1G93A 5C4DA 1ZJPA 2VS4A 3I0FA 5C36A 4ASYA 2E8BA 3U2UA 5C4BA 4KNRA 2YQCA 4KPZA 4Y9XA 1FG5N 2PGVA 4FREA 1R82A 2I5KA 4B2XA 4DDZA 3CKJA 1PZYB 4E1KA 1MC3A 4HO9A 1H3MA 2X5ZA 3NGWA 3IOHA 4D0ZA 2RITA 1FGXA 5FV9A 3V0NA 4D0TA 1JYLA 1R7TA 4KC4A 4FCEA 1GX4A 1OMZA 4KNXA 1G95A 1INIA 3SXDA 2JCLA 3SXAA 5C3BA 3E25A 2YESA 2PGYA 3FOQA 3U2WA 4AC3A 1VICA 2RJ1A 3O3PA 2YC5A 5IFYA 4NALA 1WT0A 3OH2A 4EEGA 3SX5A 2A8UA 2AM4A 3OKRA 2ICXA 3K8EA 4HO0A 1VZXA 2FFVA 3V0PA 2I5EA 4KQLA 3RMWA 1QG8A 3V0LA 4M4KA 4KC1A 2Y6PA 4KPXA 1JVDA 5C1LA 2YC3A 4HO8A 1HJLA 4FRAA 1G2VA 2RIXA 1VGTA 1R80A 1YROB 1R7UA 5HS2A 2QGIA 3CU0A 3PKPA 1TZFA 4CJ8A 1FO9A 2OEGA 1MP5A 3ZLKA 4D48A 4HO5A 5FUHA 3GUEA 5EIYA 1H7FA 2D7RA 2CU2A 3BCVA 4FRMA 4Y6UA 4Y64A 1KWSA 3RSBA 2QKXA 1GX0A 3ZGFA 2Q4JA 3JUJA 2AM5A 3OGZA 1H7GA 2WEEA 1XHBA 1FRWA 3OH0A 1W55A 4J18A 1IINA 4Y62A 1JV1A 5C38A 1S4NA 2VS3A 3TZTA 1VGWA 5DDVA 4AAWA 5CQNX 1ZIZA 1W57A 2X60A 2XMHA 1H5SB 1O0RA 2FYAA 1GQ9A 2W0WA 4FRDA 4G3QA 2AGDA 2V0JA 5C8RA 3QVBA 1ZDGA 2YQJA 3I0GA 4G3PA 5IDSA 5CMIA 4GBPA 1ZI4A 4Y7TA 1H4EA 4Y7FA 2Y4JA 4NAKA 5C3AA 2WVLA 1H5TB 3SX3A 1S4OA 1ZJ3A 2RJ6A 2RJ5A 3KIAA 2APCA 4ECMA 5EJZA 2UX8A 4LW6A 1YP3A 1LZ0A 1E5KA 5CQPA 1G1LA 2PX7A 3D5NA 2I7BA 2VXMA 1VH1A 1HM8A 1PZTA 2FFUA 4EE3A 1R7VA 1H5SD 1YP4A 1OQMB 3SXCA 1G0RA 2RJ8A 2VSHA 3R3IA 5CQMX 3CKOA 3SXBA 5FTVA 3V0MA 1VH3A 3V0QA 3I0LA 1TW1A 3DK5A 2QH5A 4B2WA 4HO3A 1O23B 1ZDFA 3OH1A 4R7PA 1G8OA 2VFZA 2JCOA 3I0DA 1H7LA 4EE4A 2BO4A 4MYBA 1IIMA 1NQIB 3BRKX 4KT7A 4FCUA 1ZJ2A 3Q4SA 3D8VA 1NWGB 3CKQA 3F1CA 5J49A 2Y4LA 2NXVA 4IRQA 4ASJA 5C4FA 4KRVA 5C47A 3V0OA 2AESA 1G3LA 1ZI5A 4ARWA 4JD0A 3OAMA 5EJ1A 2O1HA 4K6RA 1GWVA 4M2AA 3T7OA 1H4DA 3JUKA 2RJ7A 4HO6A 1SS9A 4Y63A 3OC9A 1G97A 2AECA 2W0VA 1QGQA 3I0JA 5AJPA 3JTJA 4MNDA 3V91A 1ZI1A 2ICYA 5CQOA 3OH4A 1LZIA 4IRPA 3I0KA 2O1GA 1R81A 5L6VA 1GA8A 3IOJA 2OI5A 3SPTA 2VS5A 4FRPA 3E26A 1NF5B 1LVWA 1WVCA 3U2VA 4HO4A 1VZUA 4P02A 2WVMA 5C1HA 4L41C 1LL2A 1H7HA 3SX7A 4EEMA 3Q80A 1GWWA 1WSZA 5C4CA 1H7EA 3U2TA 2BO8A 2X65A 4EEOA 1ZI3A 1FXJA 1NKHB 2VD4A 4BMAA 5IDTA 1H5TA 4P00A 2RJ0A 2JCJA 1FWYA 2Y4KA 5DDTA 1LZ7A 5CMFX 1G23A 1H7TA 1ZHJA 4AYJA 2Z87A 2V0HA 4HG6A 4XWIA 1VPAA 4Y7VA 1H5SC 4EEAA 2OI6A 1H5RB 4D11C 2P6WA 3TQDA 4B3UA 2YCMA 2RJ9A 2OEFA 3F1YA 1LZJA 2ZU7A 3HL3A 1O7OA 4NANA 2RIYA 5C4EA 1FR9A 3U2XA 4B4GA 1H7QA 5CMGX 3ZLLA 1WT2A 3PKQA 3FWWA
chains in the Genus database with same CATH superfamily
1EZIA 2PA4A 1WT3A 1LL3A 2BO7A 5CMJA 2XWNA 4G3SA 4CJCA 3ZGGA 2BO6A 5FU0A 4KC2A 2A8WA 3V8ZA 3V8YA 1HM9A 3USQA 3SX8A 2D0JA 5FTSA 3PNNA 2P73A 2VK9A 5FYEA 2Y7AA 4CVHA 4YS8A 1VGZA 1V83A 3I0HA 1FZWA 1JVGA 3I0IX 1YP2A 3I0CA 1V82A 1V84A 3CKNA 1R7YA 2D7IA 1FO8A 2XMEA 1S4PA 5L6SA 5CQLX 1INJA 2AH9A 3RMVA 1XZ6A 2MZBA 1TVYA 2VXLA 3U0XA 4Y7GA 2Z86A 2DPWA 1FR8A 3V90A 3D98A 2FYDB 4B42A 1ZJ1A 4BQHA 5C49A 4ZDQA 4FRLA 5C1GA 1QGSA 1JYKA 1ZCUA 1HV9A 1HJJA 4Y7UA 2WAWA 2P72A 5CMHA 3ST8A 3Q7UA 2J0BA 2GGQA 3USRA 4LW3A 4FRHA 4FROA 1I52A 2O1FA 3ZF8A 3U0YA 2XWMA 4M2BA 2WE9A 5AJOA 2FY7A 4HO2A 4JISA 1JV3A 1MP4A 1NHEB 2WVKA 2X5SA 1NMMB 1VM8A 3K8DA 5D92A 4G87A 4KXOA 1ZJ0A 1ZJOA 1ZCYA 1GQCA 3IOIA 4Y6NA 5BXCA 1ZCTA 2AM3A 4HOCA 4EE5A 2RJ4A 5D91A 4CJBA 2FYBA 1O7QA 4NAIA 5FU8A 2FYCB 2RIZA 3POLA 4FQWA 1H5SA 2OI7A 1FXOA 4D11A 2YQSA 2WGZA 1VGUA 1HM0A 1MP3A 3R2WA 3SXEA 4MIXA 1FOAA 1EYRA 2VSIA 3DUVA 2GGOA 1LL0A 3SXGA 4UEGA 5C3DA 4M28A 1VZTA 2E3DA 4B5BA 5I1FA 1H5RA 1Z90A 4DECA 4HCQA 1K4VA 3EE5A 1H4CA 1W77A 1ON6A 4B4MA 3DJ4A 1G9RA 3T7MA 4DE7A 4B4BA 5C48A 3CGXA 1ON8A 2ZU9A 2Y4MA 1WT1A 3T7NA 1TW5A 4C2SA 2JCKA 3LW6A 4EVWA 2V0KA 1FGGA 2XWLA 1ZCVA 1OMXA 3OH3A 5AJNA 2V0LA 4FRQA 4AYLA 4FRBA 1QWJA 3N9WA 2ZU8A 4O6MA 2YQHA 5JQQA 2V0IA 3CKVA 1R7XA 2AE7A 3I0EA 1G93A 5C4DA 1ZJPA 2VS4A 3I0FA 5C36A 4ASYA 2E8BA 3U2UA 5C4BA 4KNRA 2YQCA 4KPZA 4Y9XA 1FG5N 2PGVA 4FREA 1R82A 2I5KA 4B2XA 4DDZA 3CKJA 1PZYB 4FIXA 4E1KA 1MC3A 4HO9A 1H3MA 2X5ZA 3NGWA 3IOHA 4D0ZA 2RITA 1FGXA 5FV9A 3V0NA 4D0TA 2J0AA 1JYLA 1R7TA 4KC4A 4FCEA 1GX4A 1OMZA 4KNXA 1G95A 1INIA 3SXDA 2JCLA 3SXAA 5C3BA 3E25A 2YESA 2PGYA 3FOQA 3U2WA 4AC3A 1VICA 2RJ1A 3O3PA 2YC5A 5IFYA 4NALA 1WT0A 3OH2A 4EEGA 3SX5A 2A8UA 2AM4A 3OKRA 2ICXA 3K8EA 4HO0A 1VZXA 2FFVA 3V0PA 2I5EA 4KQLA 3RMWA 1QG8A 3V0LA 4M4KA 4KC1A 2Y6PA 4KPXA 1JVDA 5C1LA 2YC3A 4HO8A 1HJLA 4FRAA 1G2VA 2RIXA 1VGTA 1R80A 1YROB 1R7UA 5HS2A 2QGIA 3CU0A 3PKPA 1TZFA 4CJ8A 1FO9A 2OEGA 1MP5A 3ZLKA 4D48A 4HO5A 5FUHA 3GUEA 5EIYA 2C0NA 1H7FA 2D7RA 2CU2A 3BCVA 4FRMA 4Y6UA 4Y64A 1KWSA 3RSBA 2QKXA 1GX0A 3ZGFA 2Q4JA 3JUJA 2AM5A 3OGZA 1H7GA 2WEEA 1XHBA 1FRWA 3OH0A 1W55A 4J18A 1IINA 4Y62A 1JV1A 5C38A 1S4NA 2VS3A 3TZTA 1VGWA 5DDVA 4AAWA 5CQNX 1ZIZA 1W57A 2X60A 2XMHA 1H5SB 1O0RA 2FYAA 1GQ9A 2W0WA 4FRDA 4G3QA 2AGDA 2V0JA 5C8RA 3QVBA 1ZDGA 2YQJA 3I0GA 4G3PA 5IDSA 5CMIA 4GBPA 1ZI4A 4Y7TA 1H4EA 4Y7FA 2Y4JA 4NAKA 5C3AA 2WVLA 1H5TB 3SX3A 1S4OA 1ZJ3A 2RJ6A 2RJ5A 3KIAA 4Q7CA 2APCA 4ECMA 5EJZA 2UX8A 4LW6A 1YP3A 1LZ0A 1E5KA 5CQPA 1G1LA 2PX7A 3D5NA 2I7BA 2VXMA 1VH1A 1HM8A 1PZTA 2FFUA 4EE3A 1R7VA 1H5SD 1YP4A 1OQMB 3SXCA 1G0RA 2RJ8A 2VSHA 3R3IA 5CQMX 3CKOA 3SXBA 5FTVA 3V0MA 1VH3A 3V0QA 3I0LA 1TW1A 3DK5A 2QH5A 4B2WA 4HO3A 1O23B 1ZDFA 3OH1A 4R7PA 1G8OA 2VFZA 2JCOA 3I0DA 1H7LA 4EE4A 2BO4A 4MYBA 1IIMA 1NQIB 3BRKX 4KT7A 4FCUA 1ZJ2A 3Q4SA 3D8VA 1NWGB 3CKQA 3F1CA 5J49A 2Y4LA 2NXVA 4IRQA 4ASJA 5C4FA 4KRVA 5C47A 3V0OA 2AESA 1G3LA 1ZI5A 4ARWA 4JD0A 3OAMA 5EJ1A 2O1HA 4K6RA 1GWVA 4M2AA 4FIYA 3T7OA 1H4DA 3JUKA 2RJ7A 4O6NA 4HO6A 1SS9A 4Y63A 3OC9A 1G97A 2AECA 2W0VA 1QGQA 3I0JA 5AJPA 3JTJA 4MNDA 3V91A 1ZI1A 2ICYA 5CQOA 3OH4A 1LZIA 4IRPA 3I0KA 2O1GA 1R81A 5L6VA 1GA8A 3IOJA 2OI5A 3SPTA 2VS5A 4FRPA 3E26A 1NF5B 1LVWA 1WVCA 3U2VA 4HO4A 1VZUA 4P02A 2WVMA 5C1HA 4L41C 1LL2A 1H7HA 3SX7A 4EEMA 3Q80A 1GWWA 1WSZA 5C4CA 1H7EA 3U2TA 2BO8A 2X65A 4EEOA 1ZI3A 1FXJA 1NKHB 2VD4A 4BMAA 5IDTA 1H5TA 4P00A 2RJ0A 2JCJA 1FWYA 2Y4KA 5DDTA 1LZ7A 5CMFX 1G23A 1H7TA 1ZHJA 4AYJA 2Z87A 2V0HA 4HG6A 4XWIA 1VPAA 4Y7VA 1H5SC 4EEAA 2OI6A 1H5RB 4D11C 2P6WA 3TQDA 4B3UA 2YCMA 2RJ9A 2OEFA 3F1YA 1LZJA 2ZU7A 3HL3A 1O7OA 4NANA 2RIYA 5C4EA 1FR9A 3U2XA 4B4GA 1H7QA 5CMGX 3ZLLA 1WT2A 3PKQA 3FWWA
chains in the Genus database with same CATH topology
1EZIA 2PA4A 1WT3A 1LL3A 2BO7A 5CMJA 2XWNA 4G3SA 4CJCA 3ZGGA 2BO6A 5FU0A 4KC2A 2A8WA 3V8ZA 3V8YA 1HM9A 3USQA 3SX8A 2D0JA 5FTSA 3PNNA 2P73A 2VK9A 5FYEA 2Y7AA 4CVHA 4YS8A 1VGZA 1V83A 3I0HA 1FZWA 1JVGA 3I0IX 1YP2A 3I0CA 1V82A 1V84A 3CKNA 1R7YA 2D7IA 1FO8A 2XMEA 1S4PA 5L6SA 5CQLX 1INJA 2AH9A 3RMVA 1XZ6A 2MZBA 1TVYA 2VXLA 3U0XA 4Y7GA 2Z86A 2DPWA 1FR8A 3V90A 3D98A 2FYDB 4B42A 1ZJ1A 4BQHA 5C49A 4ZDQA 4FRLA 5C1GA 1QGSA 1JYKA 1ZCUA 1HV9A 1HJJA 4Y7UA 2WAWA 2P72A 5CMHA 3ST8A 3Q7UA 2J0BA 2GGQA 3USRA 4LW3A 4FRHA 4FROA 1I52A 2O1FA 3ZF8A 3U0YA 2XWMA 4M2BA 2WE9A 5AJOA 2FY7A 4HO2A 4JISA 1JV3A 1MP4A 1NHEB 2WVKA 2X5SA 1NMMB 1VM8A 3K8DA 5D92A 4G87A 4KXOA 1ZJ0A 1ZJOA 1ZCYA 1GQCA 3IOIA 4Y6NA 5BXCA 1ZCTA 2AM3A 4HOCA 4EE5A 2RJ4A 5D91A 4CJBA 2FYBA 1O7QA 4NAIA 5FU8A 2FYCB 2RIZA 3POLA 4FQWA 1H5SA 2OI7A 1FXOA 4D11A 2YQSA 2WGZA 1VGUA 1HM0A 1MP3A 3R2WA 3SXEA 4MIXA 1FOAA 1EYRA 2VSIA 3DUVA 2GGOA 1LL0A 3SXGA 4UEGA 5C3DA 4M28A 1VZTA 2E3DA 4B5BA 5I1FA 1H5RA 1Z90A 4DECA 4HCQA 1K4VA 3EE5A 1H4CA 1W77A 1ON6A 4B4MA 3DJ4A 1G9RA 3T7MA 4DE7A 4B4BA 5C48A 3CGXA 1ON8A 2ZU9A 2Y4MA 1WT1A 3T7NA 1TW5A 4C2SA 2JCKA 3LW6A 4EVWA 2V0KA 1FGGA 2XWLA 1ZCVA 1OMXA 3OH3A 5AJNA 2V0LA 4FRQA 4AYLA 4FRBA 1QWJA 3N9WA 2ZU8A 4O6MA 2YQHA 5JQQA 2V0IA 3CKVA 1R7XA 2AE7A 3I0EA 1G93A 5C4DA 1ZJPA 2VS4A 3I0FA 5C36A 4ASYA 2E8BA 3U2UA 5C4BA 4KNRA 2YQCA 4KPZA 4Y9XA 1FG5N 2PGVA 4FREA 1R82A 2I5KA 4B2XA 4DDZA 3CKJA 1PZYB 4FIXA 4E1KA 1MC3A 4HO9A 1H3MA 2X5ZA 3NGWA 3IOHA 4D0ZA 2RITA 1FGXA 5FV9A 3V0NA 4D0TA 2J0AA 1JYLA 1R7TA 4KC4A 4FCEA 1GX4A 1OMZA 4KNXA 1G95A 1INIA 3SXDA 2JCLA 3SXAA 5C3BA 3E25A 2YESA 2PGYA 3FOQA 3U2WA 4AC3A 1VICA 2RJ1A 3O3PA 2YC5A 5IFYA 4NALA 1WT0A 3OH2A 4EEGA 3SX5A 2A8UA 2AM4A 3OKRA 2ICXA 3K8EA 4HO0A 1VZXA 2FFVA 3V0PA 2I5EA 4KQLA 3RMWA 1QG8A 3V0LA 4M4KA 4KC1A 2Y6PA 4KPXA 1JVDA 5C1LA 2YC3A 4HO8A 1HJLA 4FRAA 1G2VA 2RIXA 1VGTA 1R80A 1YROB 1R7UA 5HS2A 2QGIA 3CU0A 3PKPA 1TZFA 4CJ8A 1FO9A 2OEGA 1MP5A 3ZLKA 4D48A 4HO5A 5FUHA 3GUEA 5EIYA 2C0NA 1H7FA 2D7RA 2CU2A 3BCVA 4FRMA 4Y6UA 4Y64A 1KWSA 3RSBA 2QKXA 1GX0A 3ZGFA 2Q4JA 3JUJA 2AM5A 3OGZA 1H7GA 2WEEA 1XHBA 1FRWA 3OH0A 1W55A 4J18A 1IINA 4Y62A 1JV1A 5C38A 1S4NA 2VS3A 3TZTA 1VGWA 5DDVA 4AAWA 5CQNX 1ZIZA 1W57A 2X60A 2XMHA 1H5SB 1O0RA 2FYAA 1GQ9A 2W0WA 4FRDA 4G3QA 2AGDA 2V0JA 5C8RA 3QVBA 1ZDGA 2YQJA 3I0GA 4G3PA 5IDSA 5CMIA 4GBPA 1ZI4A 4Y7TA 1H4EA 4Y7FA 2Y4JA 4NAKA 5C3AA 2WVLA 1H5TB 3SX3A 1S4OA 1ZJ3A 2RJ6A 2RJ5A 3KIAA 4Q7CA 2APCA 4ECMA 5EJZA 2UX8A 4LW6A 1YP3A 1LZ0A 1E5KA 5CQPA 1G1LA 2PX7A 3D5NA 2I7BA 2VXMA 1VH1A 1HM8A 1PZTA 2FFUA 4EE3A 1R7VA 1H5SD 1YP4A 1OQMB 3SXCA 1G0RA 2RJ8A 2VSHA 3R3IA 5CQMX 3CKOA 3SXBA 5FTVA 3V0MA 1VH3A 3V0QA 3I0LA 1TW1A 3DK5A 2QH5A 4B2WA 4HO3A 1O23B 1ZDFA 3OH1A 4R7PA 1G8OA 2VFZA 2JCOA 3I0DA 1H7LA 4EE4A 2BO4A 4MYBA 1IIMA 1NQIB 3BRKX 4KT7A 4FCUA 1ZJ2A 3Q4SA 3D8VA 1NWGB 3CKQA 3F1CA 5J49A 2Y4LA 2NXVA 4IRQA 4ASJA 5C4FA 4KRVA 5C47A 3V0OA 2AESA 1G3LA 1ZI5A 4ARWA 4JD0A 3OAMA 5EJ1A 2O1HA 4K6RA 1GWVA 4M2AA 4FIYA 3T7OA 1H4DA 3JUKA 2RJ7A 4O6NA 4HO6A 1SS9A 4Y63A 3OC9A 1G97A 2AECA 2W0VA 1QGQA 3I0JA 5AJPA 3JTJA 4MNDA 3V91A 1ZI1A 2ICYA 5CQOA 3OH4A 1LZIA 4IRPA 3I0KA 2O1GA 1R81A 5L6VA 1GA8A 3IOJA 2OI5A 3SPTA 2VS5A 4FRPA 3E26A 1NF5B 1LVWA 1WVCA 3U2VA 4HO4A 1VZUA 4P02A 2WVMA 5C1HA 4L41C 1LL2A 1H7HA 3SX7A 4EEMA 3Q80A 1GWWA 1WSZA 5C4CA 1H7EA 3U2TA 2BO8A 2X65A 4EEOA 1ZI3A 1FXJA 1NKHB 2VD4A 4BMAA 5IDTA 1H5TA 4P00A 2RJ0A 2JCJA 1FWYA 2Y4KA 5DDTA 1LZ7A 5CMFX 1G23A 1H7TA 1ZHJA 4AYJA 2Z87A 2V0HA 4HG6A 4XWIA 1VPAA 4Y7VA 1H5SC 4EEAA 2OI6A 1H5RB 4D11C 2P6WA 3TQDA 4B3UA 2YCMA 2RJ9A 2OEFA 3F1YA 1LZJA 2ZU7A 3HL3A 1O7OA 4NANA 2RIYA 5C4EA 1FR9A 3U2XA 4B4GA 1H7QA 5CMGX 3ZLLA 1WT2A 3PKQA 3FWWA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1EZI A;  2PA4 A;  1WT3 A;  1LL3 A;  2BO7 A;  5CMJ A;  2XWN A;  4G3S A;  4CJC A;  3ZGG A;  2BO6 A;  5FU0 A;  4KC2 A;  2A8W A;  3V8Z A;  3V8Y A;  1HM9 A;  3USQ A;  3SX8 A;  2D0J A;  5FTS A;  3PNN A;  2P73 A;  5FYE A;  2Y7A A;  4CVH A;  4YS8 A;  1VGZ A;  1V83 A;  3I0H A;  1FZW A;  1JVG A;  3I0I X;  1YP2 A;  3I0C A;  1V82 A;  1V84 A;  3CKN A;  1R7Y A;  2D7I A;  1FO8 A;  2XME A;  1S4P A;  5L6S A;  5CQL X;  1INJ A;  2AH9 A;  3RMV A;  1XZ6 A;  2MZB A;  1TVY A;  2VXL A;  3U0X A;  4Y7G A;  2Z86 A;  2DPW A;  1FR8 A;  3V90 A;  3D98 A;  2FYD B;  4B42 A;  1ZJ1 A;  4BQH A;  5C49 A;  4ZDQ A;  4FRL A;  5C1G A;  1QGS A;  1JYK A;  1ZCU A;  1HV9 A;  1HJJ A;  4Y7U A;  2WAW A;  2P72 A;  5CMH A;  3ST8 A;  3Q7U A;  2GGQ A;  3USR A;  4LW3 A;  4FRH A;  4FRO A;  1I52 A;  2O1F A;  3ZF8 A;  3U0Y A;  2XWM A;  4M2B A;  2WE9 A;  5AJO A;  2FY7 A;  4HO2 A;  4JIS A;  1JV3 A;  1MP4 A;  1NHE B;  2WVK A;  2X5S A;  1NMM B;  1VM8 A;  3K8D A;  4G87 A;  4KXO A;  1ZJ0 A;  1ZJO A;  1ZCY A;  1GQC A;  3IOI A;  4Y6N A;  5BXC A;  1ZCT A;  2AM3 A;  4HOC A;  4EE5 A;  2RJ4 A;  4CJB A;  2FYB A;  1O7Q A;  4NAI A;  5FU8 A;  2FYC B;  2RIZ A;  3POL A;  4FQW A;  1H5S A;  2OI7 A;  1FXO A;  4D11 A;  2YQS A;  2WGZ A;  1VGU A;  1HM0 A;  1MP3 A;  3R2W A;  3SXE A;  1FOA A;  1EYR A;  2VSI A;  3DUV A;  2GGO A;  1LL0 A;  3SXG A;  4UEG A;  5C3D A;  4M28 A;  1VZT A;  2E3D A;  4B5B A;  5I1F A;  1H5R A;  1Z90 A;  4DEC A;  4HCQ A;  1K4V A;  3EE5 A;  1H4C A;  1W77 A;  1ON6 A;  4B4M A;  3DJ4 A;  1G9R A;  3T7M A;  4DE7 A;  4B4B A;  5C48 A;  3CGX A;  1ON8 A;  2ZU9 A;  2Y4M A;  1WT1 A;  3T7N A;  1TW5 A;  4C2S A;  2JCK A;  3LW6 A;  4EVW A;  2V0K A;  1FGG A;  2XWL A;  1ZCV A;  1OMX A;  3OH3 A;  5AJN A;  2V0L A;  4FRQ A;  4AYL A;  4FRB A;  1QWJ A;  3N9W A;  2ZU8 A;  2YQH A;  5JQQ A;  2V0I A;  3CKV A;  1R7X A;  2AE7 A;  3I0E A;  1G93 A;  5C4D A;  1ZJP A;  2VS4 A;  3I0F A;  5C36 A;  4ASY A;  2E8B A;  3U2U A;  5C4B A;  4KNR A;  2YQC A;  4KPZ A;  4Y9X A;  1FG5 N;  2PGV A;  4FRE A;  1R82 A;  2I5K A;  4B2X A;  4DDZ A;  3CKJ A;  1PZY B;  4E1K A;  1MC3 A;  4HO9 A;  1H3M A;  2X5Z A;  3NGW A;  3IOH A;  4D0Z A;  2RIT A;  1FGX A;  5FV9 A;  3V0N A;  4D0T A;  1JYL A;  1R7T A;  4KC4 A;  4FCE A;  1GX4 A;  1OMZ A;  4KNX A;  1G95 A;  1INI A;  3SXD A;  2JCL A;  3SXA A;  5C3B A;  3E25 A;  2YES A;  2PGY A;  3FOQ A;  3U2W A;  4AC3 A;  1VIC A;  2RJ1 A;  3O3P A;  2YC5 A;  5IFY A;  4NAL A;  1WT0 A;  3OH2 A;  4EEG A;  3SX5 A;  2A8U A;  2AM4 A;  3OKR A;  2ICX A;  3K8E A;  4HO0 A;  1VZX A;  2FFV A;  3V0P A;  2I5E A;  4KQL A;  3RMW A;  1QG8 A;  3V0L A;  4M4K A;  4KC1 A;  2Y6P A;  4KPX A;  1JVD A;  5C1L A;  2YC3 A;  4HO8 A;  1HJL A;  4FRA A;  1G2V A;  2RIX A;  1VGT A;  1R80 A;  1YRO B;  1R7U A;  5HS2 A;  2QGI A;  3CU0 A;  3PKP A;  1TZF A;  4CJ8 A;  1FO9 A;  2OEG A;  1MP5 A;  3ZLK A;  4D48 A;  4HO5 A;  5FUH A;  3GUE A;  5EIY A;  1H7F A;  2D7R A;  2CU2 A;  3BCV A;  4FRM A;  4Y6U A;  4Y64 A;  1KWS A;  3RSB A;  2QKX A;  1GX0 A;  3ZGF A;  2Q4J A;  3JUJ A;  2AM5 A;  3OGZ A;  1H7G A;  2WEE A;  1XHB A;  1FRW A;  3OH0 A;  1W55 A;  4J18 A;  1IIN A;  4Y62 A;  1JV1 A;  5C38 A;  1S4N A;  2VS3 A;  3TZT A;  1VGW A;  5DDV A;  4AAW A;  5CQN X;  1ZIZ A;  1W57 A;  2X60 A;  2XMH A;  1H5S B;  1O0R A;  2FYA A;  1GQ9 A;  2W0W A;  4FRD A;  4G3Q A;  2AGD A;  2V0J A;  5C8R A;  3QVB A;  1ZDG A;  2YQJ A;  3I0G A;  4G3P A;  5IDS A;  5CMI A;  4GBP A;  1ZI4 A;  4Y7T A;  1H4E A;  4Y7F A;  2Y4J A;  4NAK A;  5C3A A;  2WVL A;  1H5T B;  3SX3 A;  1S4O A;  1ZJ3 A;  2RJ6 A;  2RJ5 A;  3KIA A;  2APC A;  4ECM A;  5EJZ A;  2UX8 A;  4LW6 A;  1YP3 A;  1LZ0 A;  1E5K A;  5CQP A;  1G1L A;  2PX7 A;  3D5N A;  2I7B A;  2VXM A;  1VH1 A;  1HM8 A;  1PZT A;  2FFU A;  4EE3 A;  1R7V A;  1H5S D;  1YP4 A;  1OQM B;  3SXC A;  1G0R A;  2RJ8 A;  2VSH A;  3R3I A;  5CQM X;  3CKO A;  3SXB A;  5FTV A;  3V0M A;  1VH3 A;  3V0Q A;  3I0L A;  1TW1 A;  3DK5 A;  2QH5 A;  4B2W A;  4HO3 A;  1O23 B;  1ZDF A;  3OH1 A;  4R7P A;  1G8O A;  2VFZ A;  2JCO A;  3I0D A;  1H7L A;  4EE4 A;  2BO4 A;  4MYB A;  1IIM A;  1NQI B;  3BRK X;  4KT7 A;  4FCU A;  1ZJ2 A;  3Q4S A;  3D8V A;  1NWG B;  3CKQ A;  3F1C A;  5J49 A;  2Y4L A;  2NXV A;  4IRQ A;  4ASJ A;  5C4F A;  4KRV A;  5C47 A;  3V0O A;  2AES A;  1G3L A;  1ZI5 A;  4ARW A;  4JD0 A;  3OAM A;  5EJ1 A;  2O1H A;  4K6R A;  1GWV A;  4M2A A;  3T7O A;  1H4D A;  3JUK A;  2RJ7 A;  4HO6 A;  1SS9 A;  4Y63 A;  3OC9 A;  1G97 A;  2AEC A;  2W0V A;  1QGQ A;  3I0J A;  5AJP A;  3JTJ A;  4MND A;  3V91 A;  1ZI1 A;  2ICY A;  5CQO A;  3OH4 A;  1LZI A;  4IRP A;  3I0K A;  2O1G A;  1R81 A;  5L6V A;  1GA8 A;  3IOJ A;  2OI5 A;  3SPT A;  2VS5 A;  4FRP A;  3E26 A;  1NF5 B;  1LVW A;  1WVC A;  3U2V A;  4HO4 A;  1VZU A;  4P02 A;  2WVM A;  5C1H A;  4L41 C;  1LL2 A;  1H7H A;  3SX7 A;  4EEM A;  3Q80 A;  1GWW A;  1WSZ A;  5C4C A;  1H7E A;  3U2T A;  2BO8 A;  2X65 A;  4EEO A;  1ZI3 A;  1FXJ A;  1NKH B;  2VD4 A;  4BMA A;  5IDT A;  1H5T A;  4P00 A;  2RJ0 A;  2JCJ A;  1FWY A;  2Y4K A;  5DDT A;  1LZ7 A;  5CMF X;  1G23 A;  1H7T A;  1ZHJ A;  4AYJ A;  2Z87 A;  2V0H A;  4HG6 A;  4XWI A;  1VPA A;  4Y7V A;  1H5S C;  4EEA A;  2OI6 A;  1H5R B;  4D11 C;  2P6W A;  3TQD A;  4B3U A;  2YCM A;  2RJ9 A;  2OEF A;  3F1Y A;  1LZJ A;  2ZU7 A;  3HL3 A;  1O7O A;  4NAN A;  2RIY A;  5C4E A;  1FR9 A;  3U2X A;  4B4G A;  1H7Q A;  5CMG X;  3ZLL A;  1WT2 A;  3PKQ A;  3FWW A; 
#chains in the Genus database with same CATH topology
 1EZI A;  2PA4 A;  1WT3 A;  1LL3 A;  2BO7 A;  5CMJ A;  2XWN A;  4G3S A;  4CJC A;  3ZGG A;  2BO6 A;  5FU0 A;  4KC2 A;  2A8W A;  3V8Z A;  3V8Y A;  1HM9 A;  3USQ A;  3SX8 A;  2D0J A;  5FTS A;  3PNN A;  2P73 A;  2VK9 A;  5FYE A;  2Y7A A;  4CVH A;  4YS8 A;  1VGZ A;  1V83 A;  3I0H A;  1FZW A;  1JVG A;  3I0I X;  1YP2 A;  3I0C A;  1V82 A;  1V84 A;  3CKN A;  1R7Y A;  2D7I A;  1FO8 A;  2XME A;  1S4P A;  5L6S A;  5CQL X;  1INJ A;  2AH9 A;  3RMV A;  1XZ6 A;  2MZB A;  1TVY A;  2VXL A;  3U0X A;  4Y7G A;  2Z86 A;  2DPW A;  1FR8 A;  3V90 A;  3D98 A;  2FYD B;  4B42 A;  1ZJ1 A;  4BQH A;  5C49 A;  4ZDQ A;  4FRL A;  5C1G A;  1QGS A;  1JYK A;  1ZCU A;  1HV9 A;  1HJJ A;  4Y7U A;  2WAW A;  2P72 A;  5CMH A;  3ST8 A;  3Q7U A;  2J0B A;  2GGQ A;  3USR A;  4LW3 A;  4FRH A;  4FRO A;  1I52 A;  2O1F A;  3ZF8 A;  3U0Y A;  2XWM A;  4M2B A;  2WE9 A;  5AJO A;  2FY7 A;  4HO2 A;  4JIS A;  1JV3 A;  1MP4 A;  1NHE B;  2WVK A;  2X5S A;  1NMM B;  1VM8 A;  3K8D A;  5D92 A;  4G87 A;  4KXO A;  1ZJ0 A;  1ZJO A;  1ZCY A;  1GQC A;  3IOI A;  4Y6N A;  5BXC A;  1ZCT A;  2AM3 A;  4HOC A;  4EE5 A;  2RJ4 A;  5D91 A;  4CJB A;  2FYB A;  1O7Q A;  4NAI A;  5FU8 A;  2FYC B;  2RIZ A;  3POL A;  4FQW A;  1H5S A;  2OI7 A;  1FXO A;  4D11 A;  2YQS A;  2WGZ A;  1VGU A;  1HM0 A;  1MP3 A;  3R2W A;  3SXE A;  4MIX A;  1FOA A;  1EYR A;  2VSI A;  3DUV A;  2GGO A;  1LL0 A;  3SXG A;  4UEG A;  5C3D A;  4M28 A;  1VZT A;  2E3D A;  4B5B A;  5I1F A;  1H5R A;  1Z90 A;  4DEC A;  4HCQ A;  1K4V A;  3EE5 A;  1H4C A;  1W77 A;  1ON6 A;  4B4M A;  3DJ4 A;  1G9R A;  3T7M A;  4DE7 A;  4B4B A;  5C48 A;  3CGX A;  1ON8 A;  2ZU9 A;  2Y4M A;  1WT1 A;  3T7N A;  1TW5 A;  4C2S A;  2JCK A;  3LW6 A;  4EVW A;  2V0K A;  1FGG A;  2XWL A;  1ZCV A;  1OMX A;  3OH3 A;  5AJN A;  2V0L A;  4FRQ A;  4AYL A;  4FRB A;  1QWJ A;  3N9W A;  2ZU8 A;  4O6M A;  2YQH A;  5JQQ A;  2V0I A;  3CKV A;  1R7X A;  2AE7 A;  3I0E A;  1G93 A;  5C4D A;  1ZJP A;  2VS4 A;  3I0F A;  5C36 A;  4ASY A;  2E8B A;  3U2U A;  5C4B A;  4KNR A;  2YQC A;  4KPZ A;  4Y9X A;  1FG5 N;  2PGV A;  4FRE A;  1R82 A;  2I5K A;  4B2X A;  4DDZ A;  3CKJ A;  1PZY B;  4FIX A;  4E1K A;  1MC3 A;  4HO9 A;  1H3M A;  2X5Z A;  3NGW A;  3IOH A;  4D0Z A;  2RIT A;  1FGX A;  5FV9 A;  3V0N A;  4D0T A;  2J0A A;  1JYL A;  1R7T A;  4KC4 A;  4FCE A;  1GX4 A;  1OMZ A;  4KNX A;  1G95 A;  1INI A;  3SXD A;  2JCL A;  3SXA A;  5C3B A;  3E25 A;  2YES A;  2PGY A;  3FOQ A;  3U2W A;  4AC3 A;  1VIC A;  2RJ1 A;  3O3P A;  2YC5 A;  5IFY A;  4NAL A;  1WT0 A;  3OH2 A;  4EEG A;  3SX5 A;  2A8U A;  2AM4 A;  3OKR A;  2ICX A;  3K8E A;  4HO0 A;  1VZX A;  2FFV A;  3V0P A;  2I5E A;  4KQL A;  3RMW A;  1QG8 A;  3V0L A;  4M4K A;  4KC1 A;  2Y6P A;  4KPX A;  1JVD A;  5C1L A;  2YC3 A;  4HO8 A;  1HJL A;  4FRA A;  1G2V A;  2RIX A;  1VGT A;  1R80 A;  1YRO B;  1R7U A;  5HS2 A;  2QGI A;  3CU0 A;  3PKP A;  1TZF A;  4CJ8 A;  1FO9 A;  2OEG A;  1MP5 A;  3ZLK A;  4D48 A;  4HO5 A;  5FUH A;  3GUE A;  5EIY A;  2C0N A;  1H7F A;  2D7R A;  2CU2 A;  3BCV A;  4FRM A;  4Y6U A;  4Y64 A;  1KWS A;  3RSB A;  2QKX A;  1GX0 A;  3ZGF A;  2Q4J A;  3JUJ A;  2AM5 A;  3OGZ A;  1H7G A;  2WEE A;  1XHB A;  1FRW A;  3OH0 A;  1W55 A;  4J18 A;  1IIN A;  4Y62 A;  1JV1 A;  5C38 A;  1S4N A;  2VS3 A;  3TZT A;  1VGW A;  5DDV A;  4AAW A;  5CQN X;  1ZIZ A;  1W57 A;  2X60 A;  2XMH A;  1H5S B;  1O0R A;  2FYA A;  1GQ9 A;  2W0W A;  4FRD A;  4G3Q A;  2AGD A;  2V0J A;  5C8R A;  3QVB A;  1ZDG A;  2YQJ A;  3I0G A;  4G3P A;  5IDS A;  5CMI A;  4GBP A;  1ZI4 A;  4Y7T A;  1H4E A;  4Y7F A;  2Y4J A;  4NAK A;  5C3A A;  2WVL A;  1H5T B;  3SX3 A;  1S4O A;  1ZJ3 A;  2RJ6 A;  2RJ5 A;  3KIA A;  4Q7C A;  2APC A;  4ECM A;  5EJZ A;  2UX8 A;  4LW6 A;  1YP3 A;  1LZ0 A;  1E5K A;  5CQP A;  1G1L A;  2PX7 A;  3D5N A;  2I7B A;  2VXM A;  1VH1 A;  1HM8 A;  1PZT A;  2FFU A;  4EE3 A;  1R7V A;  1H5S D;  1YP4 A;  1OQM B;  3SXC A;  1G0R A;  2RJ8 A;  2VSH A;  3R3I A;  5CQM X;  3CKO A;  3SXB A;  5FTV A;  3V0M A;  1VH3 A;  3V0Q A;  3I0L A;  1TW1 A;  3DK5 A;  2QH5 A;  4B2W A;  4HO3 A;  1O23 B;  1ZDF A;  3OH1 A;  4R7P A;  1G8O A;  2VFZ A;  2JCO A;  3I0D A;  1H7L A;  4EE4 A;  2BO4 A;  4MYB A;  1IIM A;  1NQI B;  3BRK X;  4KT7 A;  4FCU A;  1ZJ2 A;  3Q4S A;  3D8V A;  1NWG B;  3CKQ A;  3F1C A;  5J49 A;  2Y4L A;  2NXV A;  4IRQ A;  4ASJ A;  5C4F A;  4KRV A;  5C47 A;  3V0O A;  2AES A;  1G3L A;  1ZI5 A;  4ARW A;  4JD0 A;  3OAM A;  5EJ1 A;  2O1H A;  4K6R A;  1GWV A;  4M2A A;  4FIY A;  3T7O A;  1H4D A;  3JUK A;  2RJ7 A;  4O6N A;  4HO6 A;  1SS9 A;  4Y63 A;  3OC9 A;  1G97 A;  2AEC A;  2W0V A;  1QGQ A;  3I0J A;  5AJP A;  3JTJ A;  4MND A;  3V91 A;  1ZI1 A;  2ICY A;  5CQO A;  3OH4 A;  1LZI A;  4IRP A;  3I0K A;  2O1G A;  1R81 A;  5L6V A;  1GA8 A;  3IOJ A;  2OI5 A;  3SPT A;  2VS5 A;  4FRP A;  3E26 A;  1NF5 B;  1LVW A;  1WVC A;  3U2V A;  4HO4 A;  1VZU A;  4P02 A;  2WVM A;  5C1H A;  4L41 C;  1LL2 A;  1H7H A;  3SX7 A;  4EEM A;  3Q80 A;  1GWW A;  1WSZ A;  5C4C A;  1H7E A;  3U2T A;  2BO8 A;  2X65 A;  4EEO A;  1ZI3 A;  1FXJ A;  1NKH B;  2VD4 A;  4BMA A;  5IDT A;  1H5T A;  4P00 A;  2RJ0 A;  2JCJ A;  1FWY A;  2Y4K A;  5DDT A;  1LZ7 A;  5CMF X;  1G23 A;  1H7T A;  1ZHJ A;  4AYJ A;  2Z87 A;  2V0H A;  4HG6 A;  4XWI A;  1VPA A;  4Y7V A;  1H5S C;  4EEA A;  2OI6 A;  1H5R B;  4D11 C;  2P6W A;  3TQD A;  4B3U A;  2YCM A;  2RJ9 A;  2OEF A;  3F1Y A;  1LZJ A;  2ZU7 A;  3HL3 A;  1O7O A;  4NAN A;  2RIY A;  5C4E A;  1FR9 A;  3U2X A;  4B4G A;  1H7Q A;  5CMG X;  3ZLL A;  1WT2 A;  3PKQ A;  3FWW A; 
#chains in the Genus database with same CATH homology
 1EZI A;  2PA4 A;  1WT3 A;  1LL3 A;  2BO7 A;  5CMJ A;  2XWN A;  4G3S A;  4CJC A;  3ZGG A;  2BO6 A;  5FU0 A;  4KC2 A;  2A8W A;  3V8Z A;  3V8Y A;  1HM9 A;  3USQ A;  3SX8 A;  2D0J A;  5FTS A;  3PNN A;  2P73 A;  2VK9 A;  5FYE A;  2Y7A A;  4CVH A;  4YS8 A;  1VGZ A;  1V83 A;  3I0H A;  1FZW A;  1JVG A;  3I0I X;  1YP2 A;  3I0C A;  1V82 A;  1V84 A;  3CKN A;  1R7Y A;  2D7I A;  1FO8 A;  2XME A;  1S4P A;  5L6S A;  5CQL X;  1INJ A;  2AH9 A;  3RMV A;  1XZ6 A;  2MZB A;  1TVY A;  2VXL A;  3U0X A;  4Y7G A;  2Z86 A;  2DPW A;  1FR8 A;  3V90 A;  3D98 A;  2FYD B;  4B42 A;  1ZJ1 A;  4BQH A;  5C49 A;  4ZDQ A;  4FRL A;  5C1G A;  1QGS A;  1JYK A;  1ZCU A;  1HV9 A;  1HJJ A;  4Y7U A;  2WAW A;  2P72 A;  5CMH A;  3ST8 A;  3Q7U A;  2J0B A;  2GGQ A;  3USR A;  4LW3 A;  4FRH A;  4FRO A;  1I52 A;  2O1F A;  3ZF8 A;  3U0Y A;  2XWM A;  4M2B A;  2WE9 A;  5AJO A;  2FY7 A;  4HO2 A;  4JIS A;  1JV3 A;  1MP4 A;  1NHE B;  2WVK A;  2X5S A;  1NMM B;  1VM8 A;  3K8D A;  5D92 A;  4G87 A;  4KXO A;  1ZJ0 A;  1ZJO A;  1ZCY A;  1GQC A;  3IOI A;  4Y6N A;  5BXC A;  1ZCT A;  2AM3 A;  4HOC A;  4EE5 A;  2RJ4 A;  5D91 A;  4CJB A;  2FYB A;  1O7Q A;  4NAI A;  5FU8 A;  2FYC B;  2RIZ A;  3POL A;  4FQW A;  1H5S A;  2OI7 A;  1FXO A;  4D11 A;  2YQS A;  2WGZ A;  1VGU A;  1HM0 A;  1MP3 A;  3R2W A;  3SXE A;  4MIX A;  1FOA A;  1EYR A;  2VSI A;  3DUV A;  2GGO A;  1LL0 A;  3SXG A;  4UEG A;  5C3D A;  4M28 A;  1VZT A;  2E3D A;  4B5B A;  5I1F A;  1H5R A;  1Z90 A;  4DEC A;  4HCQ A;  1K4V A;  3EE5 A;  1H4C A;  1W77 A;  1ON6 A;  4B4M A;  3DJ4 A;  1G9R A;  3T7M A;  4DE7 A;  4B4B A;  5C48 A;  3CGX A;  1ON8 A;  2ZU9 A;  2Y4M A;  1WT1 A;  3T7N A;  1TW5 A;  4C2S A;  2JCK A;  3LW6 A;  4EVW A;  2V0K A;  1FGG A;  2XWL A;  1ZCV A;  1OMX A;  3OH3 A;  5AJN A;  2V0L A;  4FRQ A;  4AYL A;  4FRB A;  1QWJ A;  3N9W A;  2ZU8 A;  4O6M A;  2YQH A;  5JQQ A;  2V0I A;  3CKV A;  1R7X A;  2AE7 A;  3I0E A;  1G93 A;  5C4D A;  1ZJP A;  2VS4 A;  3I0F A;  5C36 A;  4ASY A;  2E8B A;  3U2U A;  5C4B A;  4KNR A;  2YQC A;  4KPZ A;  4Y9X A;  1FG5 N;  2PGV A;  4FRE A;  1R82 A;  2I5K A;  4B2X A;  4DDZ A;  3CKJ A;  1PZY B;  4FIX A;  4E1K A;  1MC3 A;  4HO9 A;  1H3M A;  2X5Z A;  3NGW A;  3IOH A;  4D0Z A;  2RIT A;  1FGX A;  5FV9 A;  3V0N A;  4D0T A;  2J0A A;  1JYL A;  1R7T A;  4KC4 A;  4FCE A;  1GX4 A;  1OMZ A;  4KNX A;  1G95 A;  1INI A;  3SXD A;  2JCL A;  3SXA A;  5C3B A;  3E25 A;  2YES A;  2PGY A;  3FOQ A;  3U2W A;  4AC3 A;  1VIC A;  2RJ1 A;  3O3P A;  2YC5 A;  5IFY A;  4NAL A;  1WT0 A;  3OH2 A;  4EEG A;  3SX5 A;  2A8U A;  2AM4 A;  3OKR A;  2ICX A;  3K8E A;  4HO0 A;  1VZX A;  2FFV A;  3V0P A;  2I5E A;  4KQL A;  3RMW A;  1QG8 A;  3V0L A;  4M4K A;  4KC1 A;  2Y6P A;  4KPX A;  1JVD A;  5C1L A;  2YC3 A;  4HO8 A;  1HJL A;  4FRA A;  1G2V A;  2RIX A;  1VGT A;  1R80 A;  1YRO B;  1R7U A;  5HS2 A;  2QGI A;  3CU0 A;  3PKP A;  1TZF A;  4CJ8 A;  1FO9 A;  2OEG A;  1MP5 A;  3ZLK A;  4D48 A;  4HO5 A;  5FUH A;  3GUE A;  5EIY A;  2C0N A;  1H7F A;  2D7R A;  2CU2 A;  3BCV A;  4FRM A;  4Y6U A;  4Y64 A;  1KWS A;  3RSB A;  2QKX A;  1GX0 A;  3ZGF A;  2Q4J A;  3JUJ A;  2AM5 A;  3OGZ A;  1H7G A;  2WEE A;  1XHB A;  1FRW A;  3OH0 A;  1W55 A;  4J18 A;  1IIN A;  4Y62 A;  1JV1 A;  5C38 A;  1S4N A;  2VS3 A;  3TZT A;  1VGW A;  5DDV A;  4AAW A;  5CQN X;  1ZIZ A;  1W57 A;  2X60 A;  2XMH A;  1H5S B;  1O0R A;  2FYA A;  1GQ9 A;  2W0W A;  4FRD A;  4G3Q A;  2AGD A;  2V0J A;  5C8R A;  3QVB A;  1ZDG A;  2YQJ A;  3I0G A;  4G3P A;  5IDS A;  5CMI A;  4GBP A;  1ZI4 A;  4Y7T A;  1H4E A;  4Y7F A;  2Y4J A;  4NAK A;  5C3A A;  2WVL A;  1H5T B;  3SX3 A;  1S4O A;  1ZJ3 A;  2RJ6 A;  2RJ5 A;  3KIA A;  4Q7C A;  2APC A;  4ECM A;  5EJZ A;  2UX8 A;  4LW6 A;  1YP3 A;  1LZ0 A;  1E5K A;  5CQP A;  1G1L A;  2PX7 A;  3D5N A;  2I7B A;  2VXM A;  1VH1 A;  1HM8 A;  1PZT A;  2FFU A;  4EE3 A;  1R7V A;  1H5S D;  1YP4 A;  1OQM B;  3SXC A;  1G0R A;  2RJ8 A;  2VSH A;  3R3I A;  5CQM X;  3CKO A;  3SXB A;  5FTV A;  3V0M A;  1VH3 A;  3V0Q A;  3I0L A;  1TW1 A;  3DK5 A;  2QH5 A;  4B2W A;  4HO3 A;  1O23 B;  1ZDF A;  3OH1 A;  4R7P A;  1G8O A;  2VFZ A;  2JCO A;  3I0D A;  1H7L A;  4EE4 A;  2BO4 A;  4MYB A;  1IIM A;  1NQI B;  3BRK X;  4KT7 A;  4FCU A;  1ZJ2 A;  3Q4S A;  3D8V A;  1NWG B;  3CKQ A;  3F1C A;  5J49 A;  2Y4L A;  2NXV A;  4IRQ A;  4ASJ A;  5C4F A;  4KRV A;  5C47 A;  3V0O A;  2AES A;  1G3L A;  1ZI5 A;  4ARW A;  4JD0 A;  3OAM A;  5EJ1 A;  2O1H A;  4K6R A;  1GWV A;  4M2A A;  4FIY A;  3T7O A;  1H4D A;  3JUK A;  2RJ7 A;  4O6N A;  4HO6 A;  1SS9 A;  4Y63 A;  3OC9 A;  1G97 A;  2AEC A;  2W0V A;  1QGQ A;  3I0J A;  5AJP A;  3JTJ A;  4MND A;  3V91 A;  1ZI1 A;  2ICY A;  5CQO A;  3OH4 A;  1LZI A;  4IRP A;  3I0K A;  2O1G A;  1R81 A;  5L6V A;  1GA8 A;  3IOJ A;  2OI5 A;  3SPT A;  2VS5 A;  4FRP A;  3E26 A;  1NF5 B;  1LVW A;  1WVC A;  3U2V A;  4HO4 A;  1VZU A;  4P02 A;  2WVM A;  5C1H A;  4L41 C;  1LL2 A;  1H7H A;  3SX7 A;  4EEM A;  3Q80 A;  1GWW A;  1WSZ A;  5C4C A;  1H7E A;  3U2T A;  2BO8 A;  2X65 A;  4EEO A;  1ZI3 A;  1FXJ A;  1NKH B;  2VD4 A;  4BMA A;  5IDT A;  1H5T A;  4P00 A;  2RJ0 A;  2JCJ A;  1FWY A;  2Y4K A;  5DDT A;  1LZ7 A;  5CMF X;  1G23 A;  1H7T A;  1ZHJ A;  4AYJ A;  2Z87 A;  2V0H A;  4HG6 A;  4XWI A;  1VPA A;  4Y7V A;  1H5S C;  4EEA A;  2OI6 A;  1H5R B;  4D11 C;  2P6W A;  3TQD A;  4B3U A;  2YCM A;  2RJ9 A;  2OEF A;  3F1Y A;  1LZJ A;  2ZU7 A;  3HL3 A;  1O7O A;  4NAN A;  2RIY A;  5C4E A;  1FR9 A;  3U2X A;  4B4G A;  1H7Q A;  5CMG X;  3ZLL A;  1WT2 A;  3PKQ A;  3FWW A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...