3ZLKA

Pseudomonas aeruginosa rmla in complex with allosteric inhibitor
Total Genus 95
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
95
sequence length
302
structure length
297
Chain Sequence
HHHHHKRKGIILAGGSGTRLHPATLAISKQLLPVYDKPMIYYPLSTLMLAGIREILIISTPQDTPRFQQLLGDGSNWGLDLQYAVQPSPDGLAQAFLIGESFIGNDLSALVLGDNLYYGHDFHELLGSASQRQTGASVFAYHVLDPERYGVVEFDQGGKAISLEEKPLEPKSNYAVTGLYFYDQQVVDIARDLKPSPRGELEITDVNRAYLERGQLSVEIMGRGYAWLDTGTHDSLLEAGQFIATLENRQGLKVACPEEIAYRQKWIDAAQLEKLAAPLAKNGYGQYLKRLLTETVY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords GLUCOSE-1-PHOSPHATE THYMIDYLYLTRANSFERASE
publication title Allosteric competitive inhibitors of the glucose-1-phosphate thymidylyltransferase (RmlA) from Pseudomonas aeruginosa.
pubmed doi rcsb
source organism Pseudomonas aeruginosa pao1
molecule tags Transferase
total genus 95
structure length 297
sequence length 302
chains with identical sequence B, C, D
ec nomenclature ec 2.7.7.74: 1L-myo-inositol 1-phosphate cytidylyltransferase.
pdb deposition date 2013-02-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00483 NTP_transferase Nucleotidyl transferase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.550.10 Alpha Beta Alpha-Beta Complex Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A 3zlkA00
5FU0A 1H5SC 3T7NA 1TW5A 5CQLX 3RSBA 2PGYA 1GQ9A 2YQSA 2RIZA 2RITA 2JCLA 4EE3A 3F1CA 2WE9A 4HO4A 2JCKA 1W55A 2AESA 1H5SB 3ZLLA 3USRA 1FGXA 2XMHA 1H7TA 1ZDFA 1H5RA 5CQPA 4NALA 3E25A 1QGQA 4KNRA 2YESA 4LW6A 1O7OA 3OC9A 3DJ4A 2I5KA 3LW6A 4FROA 3CKQA 3SPTA 3NGWA 4AC3A 5C3AA 2RJ7A 3KIAA 4EEOA 1ZDGA 2D0JA 2I5EA 4Y9XA 4Y6UA 2RJ8A 1FR8A 2QGIA 2VS3A 4EVWA 1LZIA 4DDZA 2ICYA 1ZI1A 2Q4JA 5CMGX 2YQHA 4B2WA 4HO2A 4ZDQA 5C4EA 3PKQA 1JYLA 2P6WA 1H3MA 1NF5B 1JVDA 2AE7A 4Y7FA 5C1HA 1G97A 4B5BA 4CJCA 1H7GA 4KPXA 5CMJA 4DE7A 1S4OA 4K6RA 3I0GA 3RMVA 1Z90A 1WSZA 4HO3A 4B2XA 3V0PA 4AAWA 4EE4A 1EZIA 3V0MA 4FRBA 5EJ1A 2PGVA 2YCMA 3ST8A 1JVGA 2YC3A 4M2AA 1H5SD 1ZCUA 4DECA 1G23A 4B4GA 3OH1A 1WT3A 3I0EA 1ZI3A 3OGZA 4FRPA 1ZI4A 1YP2A 3E26A 3HL3A 3T7MA 4KT7A 4FREA 4NAKA 3I0DA 4GBPA 1HV9A 4MNDA 5J49A 4FRHA 5C38A 2P72A 3I0LA 4FRQA 4KQLA 4EEMA 4HG6A 5IFYA 5L6SA 5L6VA 4YS8A 1FO9A 1K4VA 4XWIA 2Y4JA 3CKVA 1V82A 2RJ5A 1H5SA 1G8OA 4FCEA 3V8ZA 1NWGB 3T7OA 2VS4A 3V0QA 4AYJA 3I0FA 2OEFA 2RIXA 3Q7UA 3IOJA 4FQWA 1ZIZA 1MP3A 3OH2A 1VH3A 2BO7A 2E8BA 4CVHA 1WT0A 1FR9A 4Y7VA 4FRLA 3SX5A 2XWMA 2V0HA 2AM4A 1QG8A 3V0LA 2P73A 2PA4A 3CGXA 2ZU9A 2VXMA 4B42A 1V83A 4CJ8A 2BO8A 1MP4A 1R7XA 1WVCA 1SS9A 5DDTA 2ZU8A 5CMHA 3I0CA 1HM8A 3Q80A 2RIYA 4B4BA 4L41C 1QWJA 4FRDA 1YROB 5AJPA 4NANA 4BQHA 5CQOA 3N9WA 1LL3A 2YC5A 3Q4SA 4Y64A 1G9RA 2Y4MA 4NAIA 1S4PA 2X60A 5C47A 1G93A 1VGWA 4FRAA 1S4NA 2XMEA 5CQNX 1PZYB 1FWYA 1MC3A 1IINA 3ZF8A 3SXBA 5CQMX 2W0VA 3U2WA 2JCOA 2RJ9A 4ASYA 2VS5A 1G95A 2AH9A 2FYBA 2ZU7A 1LL2A 4E1KA 1ZJPA 4C2SA 3FWWA 2O1GA 3I0KA 3U2TA 3ZLKA 1NKHB 3PNNA 4D0ZA 2APCA 2GGQA 1XHBA 1XZ6A 3ZGFA 2WVKA 1HJJA 1NQIB 1VICA 3U2XA 1YP3A 1H5TA 1R82A 3CKOA 2RJ6A 3U2UA 4D0TA 3OH3A 2VSHA 4G87A 1VGTA 2VSIA 4G3QA 5CMFX 4HO6A 1VGZA 2UX8A 2Y7AA 4B3UA 1ZJ1A 3D8VA 1ZJ2A 1H4CA 3JUKA 3IOIA 5FTVA 3I0JA 3CU0A 5C36A 1O7QA 5FTSA 2Y4LA 4Y7GA 4KRVA 1JV3A 1FRWA 4R7PA 5FV9A 4IRPA 3D98A 1R7UA 3O3PA 1PZTA 5C1LA 1H5RB 1V84A 1WT1A 1GX4A 2MZBA 3U0YA 2V0IA 3I0IX 1H7FA 2XWLA 1ZCVA 3DK5A 1ZCYA 5C4DA 4HO8A 2AECA 1VPAA 1H7HA 1LZ7A 3K8EA 2VD4A 1ZJ3A 1YP4A 1H7LA 3SX8A 5C4CA 4KPZA 1G1LA 5FUHA 3F1YA 1OMZA 3SXCA 1HM9A 1FOAA 2BO6A 2I7BA 4Y6NA 4Y62A 4KC2A 3OH4A 2Y6PA 2VXLA 1VH1A 1FZWA 3SXGA 2W0WA 4CJBA 2RJ1A 2NXVA 2E3DA 2JCJA 2PX7A 5EIYA 1INJA 1GWVA 1GWWA 1H4DA 3EE5A 3V0OA 5BXCA 2AGDA 5I1FA 4Y63A 3ZGGA 3RMWA 1G3LA 4HCQA 4D48A 2OI5A 5HS2A 1I52A 2FYDB 1LL0A 3R3IA 4D11C 1GQCA 3JUJA 2QH5A 1JYKA 4HOCA 2VFZA 2WAWA 2X5ZA 1W57A 2YQCA 1FXJA 4BMAA 2XWNA 1R7VA 4P00A 1R80A 2QKXA 1OMXA 3V0NA 1G2VA 5C3DA 3POLA 4ASJA 2AM5A 5AJOA 3DUVA 3D5NA 5C1GA 2OI7A 3BCVA 4D11A 2WEEA 2V0JA 1ZHJA 1O23B 2FYAA 1NHEB 2O1FA 2WVMA 1GA8A 3QVBA 1INIA 1TZFA 2WVLA 4HO0A 4M28A 1H4EA 1FXOA 4Y7UA 2X5SA 1GX0A 4IRQA 1R81A 2O1HA 3OKRA 3PKPA 1EYRA 1VZTA 2A8WA 1ZI5A 3R2WA 3V90A 1FG5N 4EEGA 5CMIA 5JQQA 2OI6A 4G3PA 5DDVA 1LVWA 3JTJA 5C3BA 4MYBA 2CU2A 1JV1A 5FU8A 2WGZA 1O0RA 4M2BA 4P02A 1WT2A 4G3SA 5IDSA 2A8UA 3FOQA 3IOHA 5C48A 3SXAA 4EE5A 2GGOA 4JISA 3SXDA 5C8RA 5C4BA 2FFVA 1QGSA 3CKNA 2D7RA 3TZTA 3OAMA 3U0XA 4LW3A 4HO9A 1ON8A 4FCUA 1G0RA 1NMMB 3U2VA 1TW1A 4KC4A 2YQJA 1MP5A 2DPWA 4ECMA 5IDTA 1LZ0A 1VGUA 4Y7TA 4FRMA 2OEGA 5EJZA 3SX3A 1HJLA 5C4FA 4KNXA 4ARWA 1TVYA 3V91A 1H7EA 5FYEA 3CKJA 2V0KA 3BRKX 4KXOA 2FY7A 2ICXA 1HM0A 1R7YA 2BO4A 1E5KA 4UEGA 1R7TA 4J18A 1H5TB 1ZCTA 2D7IA 3SX7A 2Z86A 5C49A 1H7QA 3K8DA 1KWSA 4KC1A 1IIMA 2FFUA 4AYLA 3TQDA 4M4KA 1VZXA 3USQA 2RJ0A 2RJ4A 1VZUA 1ON6A 2AM3A 3GUEA 2Z87A 5AJNA 1VM8A 3I0HA 4JD0A 1FO8A 1W77A 4B4MA 1ZJOA 2V0LA 1LZJA 2FYCB 3OH0A 4EEAA 2Y4KA 1FGGA 1ZJ0A 3SXEA 3V8YA 2X65A 1OQMB 4HO5A
chains in the Genus database with same CATH superfamily
5FU0A 1H5SC 3T7NA 1TW5A 5CQLX 3RSBA 2PGYA 1GQ9A 2YQSA 2RIZA 2RITA 2JCLA 4EE3A 3F1CA 2WE9A 4HO4A 2JCKA 1W55A 2AESA 1H5SB 3ZLLA 3USRA 1FGXA 2XMHA 1H7TA 1ZDFA 1H5RA 5CQPA 4NALA 3E25A 1QGQA 4KNRA 2YESA 4LW6A 1O7OA 3OC9A 3DJ4A 2I5KA 3LW6A 4FROA 3CKQA 3SPTA 3NGWA 4AC3A 5C3AA 2RJ7A 3KIAA 2J0BA 4EEOA 1ZDGA 2D0JA 2I5EA 4Y9XA 4Y6UA 2RJ8A 1FR8A 2QGIA 2VS3A 4EVWA 1LZIA 4DDZA 2ICYA 2VK9A 1ZI1A 2Q4JA 5CMGX 2YQHA 4B2WA 4HO2A 4ZDQA 5C4EA 3PKQA 1JYLA 2P6WA 1H3MA 1NF5B 1JVDA 2AE7A 4Y7FA 5C1HA 1G97A 4B5BA 4CJCA 1H7GA 4KPXA 5CMJA 4DE7A 1S4OA 4K6RA 3I0GA 3RMVA 1Z90A 1WSZA 4HO3A 4B2XA 3V0PA 4AAWA 4EE4A 1EZIA 3V0MA 4FRBA 5EJ1A 2PGVA 4O6NA 2YCMA 3ST8A 1JVGA 2YC3A 4M2AA 1H5SD 1ZCUA 4DECA 1G23A 4B4GA 3OH1A 1WT3A 3I0EA 1ZI3A 3OGZA 4FRPA 1ZI4A 1YP2A 3E26A 3HL3A 3T7MA 4KT7A 4FREA 4NAKA 3I0DA 4GBPA 1HV9A 4MNDA 5J49A 4FRHA 5C38A 2P72A 3I0LA 4FRQA 4FIYA 4KQLA 4EEMA 4HG6A 5IFYA 5L6SA 5L6VA 4YS8A 1FO9A 1K4VA 4XWIA 2Y4JA 3CKVA 1V82A 5D91A 2RJ5A 1H5SA 1G8OA 4FCEA 3V8ZA 1NWGB 3T7OA 2VS4A 3V0QA 4AYJA 3I0FA 2OEFA 2RIXA 2J0AA 3Q7UA 3IOJA 4FQWA 1ZIZA 1MP3A 3OH2A 1VH3A 2BO7A 2E8BA 4CVHA 1WT0A 1FR9A 4Y7VA 4FRLA 3SX5A 2XWMA 2V0HA 2AM4A 1QG8A 3V0LA 2P73A 2PA4A 3CGXA 2ZU9A 2VXMA 4B42A 1V83A 4CJ8A 2BO8A 1MP4A 1R7XA 1WVCA 1SS9A 5DDTA 2ZU8A 5CMHA 3I0CA 1HM8A 3Q80A 2RIYA 4B4BA 4L41C 1QWJA 4FRDA 1YROB 5AJPA 4NANA 4BQHA 5CQOA 3N9WA 1LL3A 2YC5A 3Q4SA 4Y64A 1G9RA 2Y4MA 4NAIA 1S4PA 2X60A 5C47A 1G93A 1VGWA 4O6MA 4FRAA 1S4NA 2XMEA 5CQNX 1PZYB 1FWYA 1MC3A 1IINA 3ZF8A 3SXBA 5CQMX 2W0VA 3U2WA 2JCOA 2RJ9A 4ASYA 2VS5A 4Q7CA 1G95A 2AH9A 2FYBA 2ZU7A 1LL2A 4E1KA 1ZJPA 4C2SA 3FWWA 2O1GA 3I0KA 3U2TA 3ZLKA 1NKHB 3PNNA 4D0ZA 2APCA 2GGQA 1XHBA 1XZ6A 3ZGFA 2WVKA 1HJJA 1NQIB 1VICA 3U2XA 1YP3A 1H5TA 1R82A 3CKOA 2RJ6A 3U2UA 4D0TA 3OH3A 2VSHA 4G87A 1VGTA 2VSIA 4G3QA 5CMFX 4HO6A 1VGZA 2UX8A 2Y7AA 4FIXA 4B3UA 1ZJ1A 3D8VA 1ZJ2A 1H4CA 3JUKA 3IOIA 5FTVA 3I0JA 3CU0A 5C36A 1O7QA 5FTSA 2Y4LA 4Y7GA 4KRVA 1JV3A 1FRWA 4R7PA 5FV9A 4IRPA 3D98A 1R7UA 3O3PA 1PZTA 5C1LA 1H5RB 1V84A 1WT1A 1GX4A 2MZBA 3U0YA 2V0IA 3I0IX 1H7FA 2XWLA 1ZCVA 3DK5A 1ZCYA 5C4DA 4HO8A 2AECA 1VPAA 1H7HA 1LZ7A 3K8EA 2VD4A 1ZJ3A 1YP4A 1H7LA 3SX8A 5C4CA 4KPZA 1G1LA 5FUHA 3F1YA 1OMZA 3SXCA 1HM9A 1FOAA 2BO6A 2I7BA 4Y6NA 4Y62A 4KC2A 3OH4A 2Y6PA 2VXLA 1VH1A 1FZWA 3SXGA 2W0WA 4CJBA 2RJ1A 2NXVA 2E3DA 2JCJA 2PX7A 5EIYA 1INJA 1GWVA 1GWWA 1H4DA 3EE5A 3V0OA 5BXCA 2AGDA 5I1FA 4Y63A 3ZGGA 3RMWA 1G3LA 4HCQA 4D48A 2OI5A 5HS2A 1I52A 2FYDB 1LL0A 3R3IA 4D11C 1GQCA 3JUJA 2QH5A 1JYKA 4HOCA 2VFZA 2WAWA 2X5ZA 1W57A 2YQCA 1FXJA 4BMAA 2XWNA 1R7VA 4P00A 1R80A 2QKXA 1OMXA 3V0NA 1G2VA 5C3DA 3POLA 4ASJA 2AM5A 5AJOA 3DUVA 3D5NA 5C1GA 2OI7A 3BCVA 4D11A 2WEEA 2V0JA 1ZHJA 1O23B 2FYAA 1NHEB 2O1FA 2WVMA 1GA8A 3QVBA 1INIA 1TZFA 2WVLA 4HO0A 4M28A 1H4EA 1FXOA 4Y7UA 2X5SA 1GX0A 4IRQA 1R81A 2O1HA 3OKRA 3PKPA 1EYRA 1VZTA 2A8WA 1ZI5A 3R2WA 3V90A 1FG5N 4EEGA 5CMIA 5JQQA 2OI6A 4G3PA 5DDVA 1LVWA 3JTJA 5C3BA 4MYBA 2CU2A 1JV1A 5FU8A 2WGZA 1O0RA 4M2BA 4P02A 1WT2A 4G3SA 5IDSA 2A8UA 3FOQA 3IOHA 5C48A 3SXAA 4EE5A 2GGOA 4JISA 3SXDA 5C8RA 5C4BA 2FFVA 1QGSA 3CKNA 2D7RA 3TZTA 3OAMA 3U0XA 4LW3A 4HO9A 1ON8A 4FCUA 1G0RA 1NMMB 3U2VA 1TW1A 4KC4A 2C0NA 2YQJA 1MP5A 2DPWA 4ECMA 5IDTA 1LZ0A 1VGUA 4Y7TA 4FRMA 2OEGA 5EJZA 3SX3A 1HJLA 5C4FA 4KNXA 4ARWA 1TVYA 3V91A 1H7EA 5FYEA 3CKJA 2V0KA 3BRKX 4KXOA 2FY7A 2ICXA 1HM0A 1R7YA 2BO4A 1E5KA 4UEGA 1R7TA 4J18A 1H5TB 1ZCTA 2D7IA 3SX7A 2Z86A 5C49A 1H7QA 3K8DA 1KWSA 4KC1A 1IIMA 2FFUA 4MIXA 4AYLA 3TQDA 4M4KA 1VZXA 3USQA 2RJ0A 2RJ4A 1VZUA 1ON6A 2AM3A 3GUEA 2Z87A 5AJNA 1VM8A 3I0HA 4JD0A 1FO8A 1W77A 4B4MA 5D92A 1ZJOA 2V0LA 1LZJA 2FYCB 3OH0A 4EEAA 2Y4KA 1FGGA 1ZJ0A 3SXEA 3V8YA 2X65A 1OQMB 4HO5A
chains in the Genus database with same CATH topology
5FU0A 1H5SC 3T7NA 1TW5A 5CQLX 3RSBA 2PGYA 1GQ9A 2YQSA 2RIZA 2RITA 2JCLA 4EE3A 3F1CA 2WE9A 4HO4A 2JCKA 1W55A 2AESA 1H5SB 3ZLLA 3USRA 1FGXA 2XMHA 1H7TA 1ZDFA 1H5RA 5CQPA 4NALA 3E25A 1QGQA 4KNRA 2YESA 4LW6A 1O7OA 3OC9A 3DJ4A 2I5KA 3LW6A 4FROA 3CKQA 3SPTA 3NGWA 4AC3A 5C3AA 2RJ7A 3KIAA 2J0BA 4EEOA 1ZDGA 2D0JA 2I5EA 4Y9XA 4Y6UA 2RJ8A 1FR8A 2QGIA 2VS3A 4EVWA 1LZIA 4DDZA 2ICYA 2VK9A 1ZI1A 2Q4JA 5CMGX 2YQHA 4B2WA 4HO2A 4ZDQA 5C4EA 3PKQA 1JYLA 2P6WA 1H3MA 1NF5B 1JVDA 2AE7A 4Y7FA 5C1HA 1G97A 4B5BA 4CJCA 1H7GA 4KPXA 5CMJA 4DE7A 1S4OA 4K6RA 3I0GA 3RMVA 1Z90A 1WSZA 4HO3A 4B2XA 3V0PA 4AAWA 4EE4A 1EZIA 3V0MA 4FRBA 5EJ1A 2PGVA 4O6NA 2YCMA 3ST8A 1JVGA 2YC3A 4M2AA 1H5SD 1ZCUA 4DECA 1G23A 4B4GA 3OH1A 1WT3A 3I0EA 1ZI3A 3OGZA 4FRPA 1ZI4A 1YP2A 3E26A 3HL3A 3T7MA 4KT7A 4FREA 4NAKA 3I0DA 4GBPA 1HV9A 4MNDA 5J49A 4FRHA 5C38A 2P72A 3I0LA 4FRQA 4FIYA 4KQLA 4EEMA 4HG6A 5IFYA 5L6SA 5L6VA 4YS8A 1FO9A 1K4VA 4XWIA 2Y4JA 3CKVA 1V82A 5D91A 2RJ5A 1H5SA 1G8OA 4FCEA 3V8ZA 1NWGB 3T7OA 2VS4A 3V0QA 4AYJA 3I0FA 2OEFA 2RIXA 2J0AA 3Q7UA 3IOJA 4FQWA 1ZIZA 1MP3A 3OH2A 1VH3A 2BO7A 2E8BA 4CVHA 1WT0A 1FR9A 4Y7VA 4FRLA 3SX5A 2XWMA 2V0HA 2AM4A 1QG8A 3V0LA 2P73A 2PA4A 3CGXA 2ZU9A 2VXMA 4B42A 1V83A 4CJ8A 2BO8A 1MP4A 1R7XA 1WVCA 1SS9A 5DDTA 2ZU8A 5CMHA 3I0CA 1HM8A 3Q80A 2RIYA 4B4BA 4L41C 1QWJA 4FRDA 1YROB 5AJPA 4NANA 4BQHA 5CQOA 3N9WA 1LL3A 2YC5A 3Q4SA 4Y64A 1G9RA 2Y4MA 4NAIA 1S4PA 2X60A 5C47A 1G93A 1VGWA 4O6MA 4FRAA 1S4NA 2XMEA 5CQNX 1PZYB 1FWYA 1MC3A 1IINA 3ZF8A 3SXBA 5CQMX 2W0VA 3U2WA 2JCOA 2RJ9A 4ASYA 2VS5A 4Q7CA 1G95A 2AH9A 2FYBA 2ZU7A 1LL2A 4E1KA 1ZJPA 4C2SA 3FWWA 2O1GA 3I0KA 3U2TA 3ZLKA 1NKHB 3PNNA 4D0ZA 2APCA 2GGQA 1XHBA 1XZ6A 3ZGFA 2WVKA 1HJJA 1NQIB 1VICA 3U2XA 1YP3A 1H5TA 1R82A 3CKOA 2RJ6A 3U2UA 4D0TA 3OH3A 2VSHA 4G87A 1VGTA 2VSIA 4G3QA 5CMFX 4HO6A 1VGZA 2UX8A 2Y7AA 4FIXA 4B3UA 1ZJ1A 3D8VA 1ZJ2A 1H4CA 3JUKA 3IOIA 5FTVA 3I0JA 3CU0A 5C36A 1O7QA 5FTSA 2Y4LA 4Y7GA 4KRVA 1JV3A 1FRWA 4R7PA 5FV9A 4IRPA 3D98A 1R7UA 3O3PA 1PZTA 5C1LA 1H5RB 1V84A 1WT1A 1GX4A 2MZBA 3U0YA 2V0IA 3I0IX 1H7FA 2XWLA 1ZCVA 3DK5A 1ZCYA 5C4DA 4HO8A 2AECA 1VPAA 1H7HA 1LZ7A 3K8EA 2VD4A 1ZJ3A 1YP4A 1H7LA 3SX8A 5C4CA 4KPZA 1G1LA 5FUHA 3F1YA 1OMZA 3SXCA 1HM9A 1FOAA 2BO6A 2I7BA 4Y6NA 4Y62A 4KC2A 3OH4A 2Y6PA 2VXLA 1VH1A 1FZWA 3SXGA 2W0WA 4CJBA 2RJ1A 2NXVA 2E3DA 2JCJA 2PX7A 5EIYA 1INJA 1GWVA 1GWWA 1H4DA 3EE5A 3V0OA 5BXCA 2AGDA 5I1FA 4Y63A 3ZGGA 3RMWA 1G3LA 4HCQA 4D48A 2OI5A 5HS2A 1I52A 2FYDB 1LL0A 3R3IA 4D11C 1GQCA 3JUJA 2QH5A 1JYKA 4HOCA 2VFZA 2WAWA 2X5ZA 1W57A 2YQCA 1FXJA 4BMAA 2XWNA 1R7VA 4P00A 1R80A 2QKXA 1OMXA 3V0NA 1G2VA 5C3DA 3POLA 4ASJA 2AM5A 5AJOA 3DUVA 3D5NA 5C1GA 2OI7A 3BCVA 4D11A 2WEEA 2V0JA 1ZHJA 1O23B 2FYAA 1NHEB 2O1FA 2WVMA 1GA8A 3QVBA 1INIA 1TZFA 2WVLA 4HO0A 4M28A 1H4EA 1FXOA 4Y7UA 2X5SA 1GX0A 4IRQA 1R81A 2O1HA 3OKRA 3PKPA 1EYRA 1VZTA 2A8WA 1ZI5A 3R2WA 3V90A 1FG5N 4EEGA 5CMIA 5JQQA 2OI6A 4G3PA 5DDVA 1LVWA 3JTJA 5C3BA 4MYBA 2CU2A 1JV1A 5FU8A 2WGZA 1O0RA 4M2BA 4P02A 1WT2A 4G3SA 5IDSA 2A8UA 3FOQA 3IOHA 5C48A 3SXAA 4EE5A 2GGOA 4JISA 3SXDA 5C8RA 5C4BA 2FFVA 1QGSA 3CKNA 2D7RA 3TZTA 3OAMA 3U0XA 4LW3A 4HO9A 1ON8A 4FCUA 1G0RA 1NMMB 3U2VA 1TW1A 4KC4A 2C0NA 2YQJA 1MP5A 2DPWA 4ECMA 5IDTA 1LZ0A 1VGUA 4Y7TA 4FRMA 2OEGA 5EJZA 3SX3A 1HJLA 5C4FA 4KNXA 4ARWA 1TVYA 3V91A 1H7EA 5FYEA 3CKJA 2V0KA 3BRKX 4KXOA 2FY7A 2ICXA 1HM0A 1R7YA 2BO4A 1E5KA 4UEGA 1R7TA 4J18A 1H5TB 1ZCTA 2D7IA 3SX7A 2Z86A 5C49A 1H7QA 3K8DA 1KWSA 4KC1A 1IIMA 2FFUA 4MIXA 4AYLA 3TQDA 4M4KA 1VZXA 3USQA 2RJ0A 2RJ4A 1VZUA 1ON6A 2AM3A 3GUEA 2Z87A 5AJNA 1VM8A 3I0HA 4JD0A 1FO8A 1W77A 4B4MA 5D92A 1ZJOA 2V0LA 1LZJA 2FYCB 3OH0A 4EEAA 2Y4KA 1FGGA 1ZJ0A 3SXEA 3V8YA 2X65A 1OQMB 4HO5A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5FU0 A;  1H5S C;  3T7N A;  1TW5 A;  5CQL X;  3RSB A;  2PGY A;  1GQ9 A;  2YQS A;  2RIZ A;  2RIT A;  2JCL A;  4EE3 A;  3F1C A;  2WE9 A;  4HO4 A;  2JCK A;  1W55 A;  2AES A;  1H5S B;  3ZLL A;  3USR A;  1FGX A;  2XMH A;  1H7T A;  1ZDF A;  1H5R A;  5CQP A;  4NAL A;  3E25 A;  1QGQ A;  4KNR A;  2YES A;  4LW6 A;  1O7O A;  3OC9 A;  3DJ4 A;  2I5K A;  3LW6 A;  4FRO A;  3CKQ A;  3SPT A;  3NGW A;  4AC3 A;  5C3A A;  2RJ7 A;  3KIA A;  4EEO A;  1ZDG A;  2D0J A;  2I5E A;  4Y9X A;  4Y6U A;  2RJ8 A;  1FR8 A;  2QGI A;  2VS3 A;  4EVW A;  1LZI A;  4DDZ A;  2ICY A;  1ZI1 A;  2Q4J A;  5CMG X;  2YQH A;  4B2W A;  4HO2 A;  4ZDQ A;  5C4E A;  3PKQ A;  1JYL A;  2P6W A;  1H3M A;  1NF5 B;  1JVD A;  2AE7 A;  4Y7F A;  5C1H A;  1G97 A;  4B5B A;  4CJC A;  1H7G A;  4KPX A;  5CMJ A;  4DE7 A;  1S4O A;  4K6R A;  3I0G A;  3RMV A;  1Z90 A;  1WSZ A;  4HO3 A;  4B2X A;  3V0P A;  4AAW A;  4EE4 A;  1EZI A;  3V0M A;  4FRB A;  5EJ1 A;  2PGV A;  2YCM A;  3ST8 A;  1JVG A;  2YC3 A;  4M2A A;  1H5S D;  1ZCU A;  4DEC A;  1G23 A;  4B4G A;  3OH1 A;  1WT3 A;  3I0E A;  1ZI3 A;  3OGZ A;  4FRP A;  1ZI4 A;  1YP2 A;  3E26 A;  3HL3 A;  3T7M A;  4KT7 A;  4FRE A;  4NAK A;  3I0D A;  4GBP A;  1HV9 A;  4MND A;  5J49 A;  4FRH A;  5C38 A;  2P72 A;  3I0L A;  4FRQ A;  4KQL A;  4EEM A;  4HG6 A;  5IFY A;  5L6S A;  5L6V A;  4YS8 A;  1FO9 A;  1K4V A;  4XWI A;  2Y4J A;  3CKV A;  1V82 A;  2RJ5 A;  1H5S A;  1G8O A;  4FCE A;  3V8Z A;  1NWG B;  3T7O A;  2VS4 A;  3V0Q A;  4AYJ A;  3I0F A;  2OEF A;  2RIX A;  3Q7U A;  3IOJ A;  4FQW A;  1ZIZ A;  1MP3 A;  3OH2 A;  1VH3 A;  2BO7 A;  2E8B A;  4CVH A;  1WT0 A;  1FR9 A;  4Y7V A;  4FRL A;  3SX5 A;  2XWM A;  2V0H A;  2AM4 A;  1QG8 A;  3V0L A;  2P73 A;  2PA4 A;  3CGX A;  2ZU9 A;  2VXM A;  4B42 A;  1V83 A;  4CJ8 A;  2BO8 A;  1MP4 A;  1R7X A;  1WVC A;  1SS9 A;  5DDT A;  2ZU8 A;  5CMH A;  3I0C A;  1HM8 A;  3Q80 A;  2RIY A;  4B4B A;  4L41 C;  1QWJ A;  4FRD A;  1YRO B;  5AJP A;  4NAN A;  4BQH A;  5CQO A;  3N9W A;  1LL3 A;  2YC5 A;  3Q4S A;  4Y64 A;  1G9R A;  2Y4M A;  4NAI A;  1S4P A;  2X60 A;  5C47 A;  1G93 A;  1VGW A;  4FRA A;  1S4N A;  2XME A;  5CQN X;  1PZY B;  1FWY A;  1MC3 A;  1IIN A;  3ZF8 A;  3SXB A;  5CQM X;  2W0V A;  3U2W A;  2JCO A;  2RJ9 A;  4ASY A;  2VS5 A;  1G95 A;  2AH9 A;  2FYB A;  2ZU7 A;  1LL2 A;  4E1K A;  1ZJP A;  4C2S A;  3FWW A;  2O1G A;  3I0K A;  3U2T A;  3ZLK A;  1NKH B;  3PNN A;  4D0Z A;  2APC A;  2GGQ A;  1XHB A;  1XZ6 A;  3ZGF A;  2WVK A;  1HJJ A;  1NQI B;  1VIC A;  3U2X A;  1YP3 A;  1H5T A;  1R82 A;  3CKO A;  2RJ6 A;  3U2U A;  4D0T A;  3OH3 A;  2VSH A;  4G87 A;  1VGT A;  2VSI A;  4G3Q A;  5CMF X;  4HO6 A;  1VGZ A;  2UX8 A;  2Y7A A;  4B3U A;  1ZJ1 A;  3D8V A;  1ZJ2 A;  1H4C A;  3JUK A;  3IOI A;  5FTV A;  3I0J A;  3CU0 A;  5C36 A;  1O7Q A;  5FTS A;  2Y4L A;  4Y7G A;  4KRV A;  1JV3 A;  1FRW A;  4R7P A;  5FV9 A;  4IRP A;  3D98 A;  1R7U A;  3O3P A;  1PZT A;  5C1L A;  1H5R B;  1V84 A;  1WT1 A;  1GX4 A;  2MZB A;  3U0Y A;  2V0I A;  3I0I X;  1H7F A;  2XWL A;  1ZCV A;  3DK5 A;  1ZCY A;  5C4D A;  4HO8 A;  2AEC A;  1VPA A;  1H7H A;  1LZ7 A;  3K8E A;  2VD4 A;  1ZJ3 A;  1YP4 A;  1H7L A;  3SX8 A;  5C4C A;  4KPZ A;  1G1L A;  5FUH A;  3F1Y A;  1OMZ A;  3SXC A;  1HM9 A;  1FOA A;  2BO6 A;  2I7B A;  4Y6N A;  4Y62 A;  4KC2 A;  3OH4 A;  2Y6P A;  2VXL A;  1VH1 A;  1FZW A;  3SXG A;  2W0W A;  4CJB A;  2RJ1 A;  2NXV A;  2E3D A;  2JCJ A;  2PX7 A;  5EIY A;  1INJ A;  1GWV A;  1GWW A;  1H4D A;  3EE5 A;  3V0O A;  5BXC A;  2AGD A;  5I1F A;  4Y63 A;  3ZGG A;  3RMW A;  1G3L A;  4HCQ A;  4D48 A;  2OI5 A;  5HS2 A;  1I52 A;  2FYD B;  1LL0 A;  3R3I A;  4D11 C;  1GQC A;  3JUJ A;  2QH5 A;  1JYK A;  4HOC A;  2VFZ A;  2WAW A;  2X5Z A;  1W57 A;  2YQC A;  1FXJ A;  4BMA A;  2XWN A;  1R7V A;  4P00 A;  1R80 A;  2QKX A;  1OMX A;  3V0N A;  1G2V A;  5C3D A;  3POL A;  4ASJ A;  2AM5 A;  5AJO A;  3DUV A;  3D5N A;  5C1G A;  2OI7 A;  3BCV A;  4D11 A;  2WEE A;  2V0J A;  1ZHJ A;  1O23 B;  2FYA A;  1NHE B;  2O1F A;  2WVM A;  1GA8 A;  3QVB A;  1INI A;  1TZF A;  2WVL A;  4HO0 A;  4M28 A;  1H4E A;  1FXO A;  4Y7U A;  2X5S A;  1GX0 A;  4IRQ A;  1R81 A;  2O1H A;  3OKR A;  3PKP A;  1EYR A;  1VZT A;  2A8W A;  1ZI5 A;  3R2W A;  3V90 A;  1FG5 N;  4EEG A;  5CMI A;  5JQQ A;  2OI6 A;  4G3P A;  5DDV A;  1LVW A;  3JTJ A;  5C3B A;  4MYB A;  2CU2 A;  1JV1 A;  5FU8 A;  2WGZ A;  1O0R A;  4M2B A;  4P02 A;  1WT2 A;  4G3S A;  5IDS A;  2A8U A;  3FOQ A;  3IOH A;  5C48 A;  3SXA A;  4EE5 A;  2GGO A;  4JIS A;  3SXD A;  5C8R A;  5C4B A;  2FFV A;  1QGS A;  3CKN A;  2D7R A;  3TZT A;  3OAM A;  3U0X A;  4LW3 A;  4HO9 A;  1ON8 A;  4FCU A;  1G0R A;  1NMM B;  3U2V A;  1TW1 A;  4KC4 A;  2YQJ A;  1MP5 A;  2DPW A;  4ECM A;  5IDT A;  1LZ0 A;  1VGU A;  4Y7T A;  4FRM A;  2OEG A;  5EJZ A;  3SX3 A;  1HJL A;  5C4F A;  4KNX A;  4ARW A;  1TVY A;  3V91 A;  1H7E A;  5FYE A;  3CKJ A;  2V0K A;  3BRK X;  4KXO A;  2FY7 A;  2ICX A;  1HM0 A;  1R7Y A;  2BO4 A;  1E5K A;  4UEG A;  1R7T A;  4J18 A;  1H5T B;  1ZCT A;  2D7I A;  3SX7 A;  2Z86 A;  5C49 A;  1H7Q A;  3K8D A;  1KWS A;  4KC1 A;  1IIM A;  2FFU A;  4AYL A;  3TQD A;  4M4K A;  1VZX A;  3USQ A;  2RJ0 A;  2RJ4 A;  1VZU A;  1ON6 A;  2AM3 A;  3GUE A;  2Z87 A;  5AJN A;  1VM8 A;  3I0H A;  4JD0 A;  1FO8 A;  1W77 A;  4B4M A;  1ZJO A;  2V0L A;  1LZJ A;  2FYC B;  3OH0 A;  4EEA A;  2Y4K A;  1FGG A;  1ZJ0 A;  3SXE A;  3V8Y A;  2X65 A;  1OQM B;  4HO5 A; 
#chains in the Genus database with same CATH topology
 5FU0 A;  1H5S C;  3T7N A;  1TW5 A;  5CQL X;  3RSB A;  2PGY A;  1GQ9 A;  2YQS A;  2RIZ A;  2RIT A;  2JCL A;  4EE3 A;  3F1C A;  2WE9 A;  4HO4 A;  2JCK A;  1W55 A;  2AES A;  1H5S B;  3ZLL A;  3USR A;  1FGX A;  2XMH A;  1H7T A;  1ZDF A;  1H5R A;  5CQP A;  4NAL A;  3E25 A;  1QGQ A;  4KNR A;  2YES A;  4LW6 A;  1O7O A;  3OC9 A;  3DJ4 A;  2I5K A;  3LW6 A;  4FRO A;  3CKQ A;  3SPT A;  3NGW A;  4AC3 A;  5C3A A;  2RJ7 A;  3KIA A;  2J0B A;  4EEO A;  1ZDG A;  2D0J A;  2I5E A;  4Y9X A;  4Y6U A;  2RJ8 A;  1FR8 A;  2QGI A;  2VS3 A;  4EVW A;  1LZI A;  4DDZ A;  2ICY A;  2VK9 A;  1ZI1 A;  2Q4J A;  5CMG X;  2YQH A;  4B2W A;  4HO2 A;  4ZDQ A;  5C4E A;  3PKQ A;  1JYL A;  2P6W A;  1H3M A;  1NF5 B;  1JVD A;  2AE7 A;  4Y7F A;  5C1H A;  1G97 A;  4B5B A;  4CJC A;  1H7G A;  4KPX A;  5CMJ A;  4DE7 A;  1S4O A;  4K6R A;  3I0G A;  3RMV A;  1Z90 A;  1WSZ A;  4HO3 A;  4B2X A;  3V0P A;  4AAW A;  4EE4 A;  1EZI A;  3V0M A;  4FRB A;  5EJ1 A;  2PGV A;  4O6N A;  2YCM A;  3ST8 A;  1JVG A;  2YC3 A;  4M2A A;  1H5S D;  1ZCU A;  4DEC A;  1G23 A;  4B4G A;  3OH1 A;  1WT3 A;  3I0E A;  1ZI3 A;  3OGZ A;  4FRP A;  1ZI4 A;  1YP2 A;  3E26 A;  3HL3 A;  3T7M A;  4KT7 A;  4FRE A;  4NAK A;  3I0D A;  4GBP A;  1HV9 A;  4MND A;  5J49 A;  4FRH A;  5C38 A;  2P72 A;  3I0L A;  4FRQ A;  4FIY A;  4KQL A;  4EEM A;  4HG6 A;  5IFY A;  5L6S A;  5L6V A;  4YS8 A;  1FO9 A;  1K4V A;  4XWI A;  2Y4J A;  3CKV A;  1V82 A;  5D91 A;  2RJ5 A;  1H5S A;  1G8O A;  4FCE A;  3V8Z A;  1NWG B;  3T7O A;  2VS4 A;  3V0Q A;  4AYJ A;  3I0F A;  2OEF A;  2RIX A;  2J0A A;  3Q7U A;  3IOJ A;  4FQW A;  1ZIZ A;  1MP3 A;  3OH2 A;  1VH3 A;  2BO7 A;  2E8B A;  4CVH A;  1WT0 A;  1FR9 A;  4Y7V A;  4FRL A;  3SX5 A;  2XWM A;  2V0H A;  2AM4 A;  1QG8 A;  3V0L A;  2P73 A;  2PA4 A;  3CGX A;  2ZU9 A;  2VXM A;  4B42 A;  1V83 A;  4CJ8 A;  2BO8 A;  1MP4 A;  1R7X A;  1WVC A;  1SS9 A;  5DDT A;  2ZU8 A;  5CMH A;  3I0C A;  1HM8 A;  3Q80 A;  2RIY A;  4B4B A;  4L41 C;  1QWJ A;  4FRD A;  1YRO B;  5AJP A;  4NAN A;  4BQH A;  5CQO A;  3N9W A;  1LL3 A;  2YC5 A;  3Q4S A;  4Y64 A;  1G9R A;  2Y4M A;  4NAI A;  1S4P A;  2X60 A;  5C47 A;  1G93 A;  1VGW A;  4O6M A;  4FRA A;  1S4N A;  2XME A;  5CQN X;  1PZY B;  1FWY A;  1MC3 A;  1IIN A;  3ZF8 A;  3SXB A;  5CQM X;  2W0V A;  3U2W A;  2JCO A;  2RJ9 A;  4ASY A;  2VS5 A;  4Q7C A;  1G95 A;  2AH9 A;  2FYB A;  2ZU7 A;  1LL2 A;  4E1K A;  1ZJP A;  4C2S A;  3FWW A;  2O1G A;  3I0K A;  3U2T A;  3ZLK A;  1NKH B;  3PNN A;  4D0Z A;  2APC A;  2GGQ A;  1XHB A;  1XZ6 A;  3ZGF A;  2WVK A;  1HJJ A;  1NQI B;  1VIC A;  3U2X A;  1YP3 A;  1H5T A;  1R82 A;  3CKO A;  2RJ6 A;  3U2U A;  4D0T A;  3OH3 A;  2VSH A;  4G87 A;  1VGT A;  2VSI A;  4G3Q A;  5CMF X;  4HO6 A;  1VGZ A;  2UX8 A;  2Y7A A;  4FIX A;  4B3U A;  1ZJ1 A;  3D8V A;  1ZJ2 A;  1H4C A;  3JUK A;  3IOI A;  5FTV A;  3I0J A;  3CU0 A;  5C36 A;  1O7Q A;  5FTS A;  2Y4L A;  4Y7G A;  4KRV A;  1JV3 A;  1FRW A;  4R7P A;  5FV9 A;  4IRP A;  3D98 A;  1R7U A;  3O3P A;  1PZT A;  5C1L A;  1H5R B;  1V84 A;  1WT1 A;  1GX4 A;  2MZB A;  3U0Y A;  2V0I A;  3I0I X;  1H7F A;  2XWL A;  1ZCV A;  3DK5 A;  1ZCY A;  5C4D A;  4HO8 A;  2AEC A;  1VPA A;  1H7H A;  1LZ7 A;  3K8E A;  2VD4 A;  1ZJ3 A;  1YP4 A;  1H7L A;  3SX8 A;  5C4C A;  4KPZ A;  1G1L A;  5FUH A;  3F1Y A;  1OMZ A;  3SXC A;  1HM9 A;  1FOA A;  2BO6 A;  2I7B A;  4Y6N A;  4Y62 A;  4KC2 A;  3OH4 A;  2Y6P A;  2VXL A;  1VH1 A;  1FZW A;  3SXG A;  2W0W A;  4CJB A;  2RJ1 A;  2NXV A;  2E3D A;  2JCJ A;  2PX7 A;  5EIY A;  1INJ A;  1GWV A;  1GWW A;  1H4D A;  3EE5 A;  3V0O A;  5BXC A;  2AGD A;  5I1F A;  4Y63 A;  3ZGG A;  3RMW A;  1G3L A;  4HCQ A;  4D48 A;  2OI5 A;  5HS2 A;  1I52 A;  2FYD B;  1LL0 A;  3R3I A;  4D11 C;  1GQC A;  3JUJ A;  2QH5 A;  1JYK A;  4HOC A;  2VFZ A;  2WAW A;  2X5Z A;  1W57 A;  2YQC A;  1FXJ A;  4BMA A;  2XWN A;  1R7V A;  4P00 A;  1R80 A;  2QKX A;  1OMX A;  3V0N A;  1G2V A;  5C3D A;  3POL A;  4ASJ A;  2AM5 A;  5AJO A;  3DUV A;  3D5N A;  5C1G A;  2OI7 A;  3BCV A;  4D11 A;  2WEE A;  2V0J A;  1ZHJ A;  1O23 B;  2FYA A;  1NHE B;  2O1F A;  2WVM A;  1GA8 A;  3QVB A;  1INI A;  1TZF A;  2WVL A;  4HO0 A;  4M28 A;  1H4E A;  1FXO A;  4Y7U A;  2X5S A;  1GX0 A;  4IRQ A;  1R81 A;  2O1H A;  3OKR A;  3PKP A;  1EYR A;  1VZT A;  2A8W A;  1ZI5 A;  3R2W A;  3V90 A;  1FG5 N;  4EEG A;  5CMI A;  5JQQ A;  2OI6 A;  4G3P A;  5DDV A;  1LVW A;  3JTJ A;  5C3B A;  4MYB A;  2CU2 A;  1JV1 A;  5FU8 A;  2WGZ A;  1O0R A;  4M2B A;  4P02 A;  1WT2 A;  4G3S A;  5IDS A;  2A8U A;  3FOQ A;  3IOH A;  5C48 A;  3SXA A;  4EE5 A;  2GGO A;  4JIS A;  3SXD A;  5C8R A;  5C4B A;  2FFV A;  1QGS A;  3CKN A;  2D7R A;  3TZT A;  3OAM A;  3U0X A;  4LW3 A;  4HO9 A;  1ON8 A;  4FCU A;  1G0R A;  1NMM B;  3U2V A;  1TW1 A;  4KC4 A;  2C0N A;  2YQJ A;  1MP5 A;  2DPW A;  4ECM A;  5IDT A;  1LZ0 A;  1VGU A;  4Y7T A;  4FRM A;  2OEG A;  5EJZ A;  3SX3 A;  1HJL A;  5C4F A;  4KNX A;  4ARW A;  1TVY A;  3V91 A;  1H7E A;  5FYE A;  3CKJ A;  2V0K A;  3BRK X;  4KXO A;  2FY7 A;  2ICX A;  1HM0 A;  1R7Y A;  2BO4 A;  1E5K A;  4UEG A;  1R7T A;  4J18 A;  1H5T B;  1ZCT A;  2D7I A;  3SX7 A;  2Z86 A;  5C49 A;  1H7Q A;  3K8D A;  1KWS A;  4KC1 A;  1IIM A;  2FFU A;  4MIX A;  4AYL A;  3TQD A;  4M4K A;  1VZX A;  3USQ A;  2RJ0 A;  2RJ4 A;  1VZU A;  1ON6 A;  2AM3 A;  3GUE A;  2Z87 A;  5AJN A;  1VM8 A;  3I0H A;  4JD0 A;  1FO8 A;  1W77 A;  4B4M A;  5D92 A;  1ZJO A;  2V0L A;  1LZJ A;  2FYC B;  3OH0 A;  4EEA A;  2Y4K A;  1FGG A;  1ZJ0 A;  3SXE A;  3V8Y A;  2X65 A;  1OQM B;  4HO5 A; 
#chains in the Genus database with same CATH homology
 5FU0 A;  1H5S C;  3T7N A;  1TW5 A;  5CQL X;  3RSB A;  2PGY A;  1GQ9 A;  2YQS A;  2RIZ A;  2RIT A;  2JCL A;  4EE3 A;  3F1C A;  2WE9 A;  4HO4 A;  2JCK A;  1W55 A;  2AES A;  1H5S B;  3ZLL A;  3USR A;  1FGX A;  2XMH A;  1H7T A;  1ZDF A;  1H5R A;  5CQP A;  4NAL A;  3E25 A;  1QGQ A;  4KNR A;  2YES A;  4LW6 A;  1O7O A;  3OC9 A;  3DJ4 A;  2I5K A;  3LW6 A;  4FRO A;  3CKQ A;  3SPT A;  3NGW A;  4AC3 A;  5C3A A;  2RJ7 A;  3KIA A;  2J0B A;  4EEO A;  1ZDG A;  2D0J A;  2I5E A;  4Y9X A;  4Y6U A;  2RJ8 A;  1FR8 A;  2QGI A;  2VS3 A;  4EVW A;  1LZI A;  4DDZ A;  2ICY A;  2VK9 A;  1ZI1 A;  2Q4J A;  5CMG X;  2YQH A;  4B2W A;  4HO2 A;  4ZDQ A;  5C4E A;  3PKQ A;  1JYL A;  2P6W A;  1H3M A;  1NF5 B;  1JVD A;  2AE7 A;  4Y7F A;  5C1H A;  1G97 A;  4B5B A;  4CJC A;  1H7G A;  4KPX A;  5CMJ A;  4DE7 A;  1S4O A;  4K6R A;  3I0G A;  3RMV A;  1Z90 A;  1WSZ A;  4HO3 A;  4B2X A;  3V0P A;  4AAW A;  4EE4 A;  1EZI A;  3V0M A;  4FRB A;  5EJ1 A;  2PGV A;  4O6N A;  2YCM A;  3ST8 A;  1JVG A;  2YC3 A;  4M2A A;  1H5S D;  1ZCU A;  4DEC A;  1G23 A;  4B4G A;  3OH1 A;  1WT3 A;  3I0E A;  1ZI3 A;  3OGZ A;  4FRP A;  1ZI4 A;  1YP2 A;  3E26 A;  3HL3 A;  3T7M A;  4KT7 A;  4FRE A;  4NAK A;  3I0D A;  4GBP A;  1HV9 A;  4MND A;  5J49 A;  4FRH A;  5C38 A;  2P72 A;  3I0L A;  4FRQ A;  4FIY A;  4KQL A;  4EEM A;  4HG6 A;  5IFY A;  5L6S A;  5L6V A;  4YS8 A;  1FO9 A;  1K4V A;  4XWI A;  2Y4J A;  3CKV A;  1V82 A;  5D91 A;  2RJ5 A;  1H5S A;  1G8O A;  4FCE A;  3V8Z A;  1NWG B;  3T7O A;  2VS4 A;  3V0Q A;  4AYJ A;  3I0F A;  2OEF A;  2RIX A;  2J0A A;  3Q7U A;  3IOJ A;  4FQW A;  1ZIZ A;  1MP3 A;  3OH2 A;  1VH3 A;  2BO7 A;  2E8B A;  4CVH A;  1WT0 A;  1FR9 A;  4Y7V A;  4FRL A;  3SX5 A;  2XWM A;  2V0H A;  2AM4 A;  1QG8 A;  3V0L A;  2P73 A;  2PA4 A;  3CGX A;  2ZU9 A;  2VXM A;  4B42 A;  1V83 A;  4CJ8 A;  2BO8 A;  1MP4 A;  1R7X A;  1WVC A;  1SS9 A;  5DDT A;  2ZU8 A;  5CMH A;  3I0C A;  1HM8 A;  3Q80 A;  2RIY A;  4B4B A;  4L41 C;  1QWJ A;  4FRD A;  1YRO B;  5AJP A;  4NAN A;  4BQH A;  5CQO A;  3N9W A;  1LL3 A;  2YC5 A;  3Q4S A;  4Y64 A;  1G9R A;  2Y4M A;  4NAI A;  1S4P A;  2X60 A;  5C47 A;  1G93 A;  1VGW A;  4O6M A;  4FRA A;  1S4N A;  2XME A;  5CQN X;  1PZY B;  1FWY A;  1MC3 A;  1IIN A;  3ZF8 A;  3SXB A;  5CQM X;  2W0V A;  3U2W A;  2JCO A;  2RJ9 A;  4ASY A;  2VS5 A;  4Q7C A;  1G95 A;  2AH9 A;  2FYB A;  2ZU7 A;  1LL2 A;  4E1K A;  1ZJP A;  4C2S A;  3FWW A;  2O1G A;  3I0K A;  3U2T A;  3ZLK A;  1NKH B;  3PNN A;  4D0Z A;  2APC A;  2GGQ A;  1XHB A;  1XZ6 A;  3ZGF A;  2WVK A;  1HJJ A;  1NQI B;  1VIC A;  3U2X A;  1YP3 A;  1H5T A;  1R82 A;  3CKO A;  2RJ6 A;  3U2U A;  4D0T A;  3OH3 A;  2VSH A;  4G87 A;  1VGT A;  2VSI A;  4G3Q A;  5CMF X;  4HO6 A;  1VGZ A;  2UX8 A;  2Y7A A;  4FIX A;  4B3U A;  1ZJ1 A;  3D8V A;  1ZJ2 A;  1H4C A;  3JUK A;  3IOI A;  5FTV A;  3I0J A;  3CU0 A;  5C36 A;  1O7Q A;  5FTS A;  2Y4L A;  4Y7G A;  4KRV A;  1JV3 A;  1FRW A;  4R7P A;  5FV9 A;  4IRP A;  3D98 A;  1R7U A;  3O3P A;  1PZT A;  5C1L A;  1H5R B;  1V84 A;  1WT1 A;  1GX4 A;  2MZB A;  3U0Y A;  2V0I A;  3I0I X;  1H7F A;  2XWL A;  1ZCV A;  3DK5 A;  1ZCY A;  5C4D A;  4HO8 A;  2AEC A;  1VPA A;  1H7H A;  1LZ7 A;  3K8E A;  2VD4 A;  1ZJ3 A;  1YP4 A;  1H7L A;  3SX8 A;  5C4C A;  4KPZ A;  1G1L A;  5FUH A;  3F1Y A;  1OMZ A;  3SXC A;  1HM9 A;  1FOA A;  2BO6 A;  2I7B A;  4Y6N A;  4Y62 A;  4KC2 A;  3OH4 A;  2Y6P A;  2VXL A;  1VH1 A;  1FZW A;  3SXG A;  2W0W A;  4CJB A;  2RJ1 A;  2NXV A;  2E3D A;  2JCJ A;  2PX7 A;  5EIY A;  1INJ A;  1GWV A;  1GWW A;  1H4D A;  3EE5 A;  3V0O A;  5BXC A;  2AGD A;  5I1F A;  4Y63 A;  3ZGG A;  3RMW A;  1G3L A;  4HCQ A;  4D48 A;  2OI5 A;  5HS2 A;  1I52 A;  2FYD B;  1LL0 A;  3R3I A;  4D11 C;  1GQC A;  3JUJ A;  2QH5 A;  1JYK A;  4HOC A;  2VFZ A;  2WAW A;  2X5Z A;  1W57 A;  2YQC A;  1FXJ A;  4BMA A;  2XWN A;  1R7V A;  4P00 A;  1R80 A;  2QKX A;  1OMX A;  3V0N A;  1G2V A;  5C3D A;  3POL A;  4ASJ A;  2AM5 A;  5AJO A;  3DUV A;  3D5N A;  5C1G A;  2OI7 A;  3BCV A;  4D11 A;  2WEE A;  2V0J A;  1ZHJ A;  1O23 B;  2FYA A;  1NHE B;  2O1F A;  2WVM A;  1GA8 A;  3QVB A;  1INI A;  1TZF A;  2WVL A;  4HO0 A;  4M28 A;  1H4E A;  1FXO A;  4Y7U A;  2X5S A;  1GX0 A;  4IRQ A;  1R81 A;  2O1H A;  3OKR A;  3PKP A;  1EYR A;  1VZT A;  2A8W A;  1ZI5 A;  3R2W A;  3V90 A;  1FG5 N;  4EEG A;  5CMI A;  5JQQ A;  2OI6 A;  4G3P A;  5DDV A;  1LVW A;  3JTJ A;  5C3B A;  4MYB A;  2CU2 A;  1JV1 A;  5FU8 A;  2WGZ A;  1O0R A;  4M2B A;  4P02 A;  1WT2 A;  4G3S A;  5IDS A;  2A8U A;  3FOQ A;  3IOH A;  5C48 A;  3SXA A;  4EE5 A;  2GGO A;  4JIS A;  3SXD A;  5C8R A;  5C4B A;  2FFV A;  1QGS A;  3CKN A;  2D7R A;  3TZT A;  3OAM A;  3U0X A;  4LW3 A;  4HO9 A;  1ON8 A;  4FCU A;  1G0R A;  1NMM B;  3U2V A;  1TW1 A;  4KC4 A;  2C0N A;  2YQJ A;  1MP5 A;  2DPW A;  4ECM A;  5IDT A;  1LZ0 A;  1VGU A;  4Y7T A;  4FRM A;  2OEG A;  5EJZ A;  3SX3 A;  1HJL A;  5C4F A;  4KNX A;  4ARW A;  1TVY A;  3V91 A;  1H7E A;  5FYE A;  3CKJ A;  2V0K A;  3BRK X;  4KXO A;  2FY7 A;  2ICX A;  1HM0 A;  1R7Y A;  2BO4 A;  1E5K A;  4UEG A;  1R7T A;  4J18 A;  1H5T B;  1ZCT A;  2D7I A;  3SX7 A;  2Z86 A;  5C49 A;  1H7Q A;  3K8D A;  1KWS A;  4KC1 A;  1IIM A;  2FFU A;  4MIX A;  4AYL A;  3TQD A;  4M4K A;  1VZX A;  3USQ A;  2RJ0 A;  2RJ4 A;  1VZU A;  1ON6 A;  2AM3 A;  3GUE A;  2Z87 A;  5AJN A;  1VM8 A;  3I0H A;  4JD0 A;  1FO8 A;  1W77 A;  4B4M A;  5D92 A;  1ZJO A;  2V0L A;  1LZJ A;  2FYC B;  3OH0 A;  4EEA A;  2Y4K A;  1FGG A;  1ZJ0 A;  3SXE A;  3V8Y A;  2X65 A;  1OQM B;  4HO5 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...