1R7TA

Glycosyltransferase a in complex with 3-deoxy-acceptor analog inhibitor
Total Genus 84
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
84
sequence length
283
structure length
263
Chain Sequence
MVSLPRMVYPQPKVLTPCRKDVLVVTPWLAPIVWEGTFNIDILNEQFRLQNTTIGLTVFAIKKYVAFLKLFLETAEKHFMVGHRVHYYVFTDQPAAVPRVTLGTGRQLSVLEVCERRFLSEVDYLVCVDVDMEFRDHVGVEILTPLFGTLHPGFYGSSREAFTYERRPQSQAYIPKDEGDFYYLGGFFGGSVQEVQRLTRACHQAMMVDQANGIEAVWHDESHLNKYLLRHKPTKVLSPEYLWDQQLLGWPAVLRKLRFTAVP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Glycoprotein-fucosylgalactoside alpha-N-acetylgalactosaminyl
publication title The influence of an intramolecular hydrogen bond in differential recognition of inhibitory acceptor analogs by human ABO(H) blood group A and B glycosyltransferases
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 84
structure length 263
sequence length 283
ec nomenclature ec 2.4.1.37: Fucosylgalactoside 3-alpha-galactosyltransferase.
pdb deposition date 2003-10-22
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.550.10 Alpha Beta Alpha-Beta Complex Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A 1r7tA00
1ZJ3A 1HM0A 3Q7UA 1FR9A 5CMFX 3OH3A 2VXLA 3SXEA 1H7QA 2QH5A 2PX7A 2YQSA 2OI7A 1EZIA 3QVBA 3SPTA 4Y62A 2V0LA 1NHEB 4FRDA 2X5ZA 3HL3A 1VH1A 1H5TA 2JCKA 2V0KA 1ZJ0A 3ZGGA 1JV3A 3OGZA 3ZF8A 1ZJ2A 5CQPA 1MP4A 3FWWA 4YS8A 4G3QA 2OI6A 1ZDGA 4MNDA 4FRHA 2D7IA 5L6SA 1GWVA 2I5EA 5CMGX 3U2WA 2UX8A 2RJ5A 4FRLA 2D7RA 3FOQA 2RJ4A 1H3MA 1WSZA 4M4KA 2PGYA 2JCOA 1FGGA 3ZLKA 1YP4A 4P00A 2YCMA 3SXAA 1HM9A 1E5KA 1R80A 3I0KA 4G87A 5CMJA 1O23B 3CKQA 4LW6A 4HO9A 4KT7A 4B4MA 2BO8A 1VICA 2VS4A 1EYRA 1ZI3A 4E1KA 2YQJA 4HO8A 4C2SA 3V8YA 2ZU7A 3RMVA 3OH4A 4MYBA 2OEGA 1LL0A 1IIMA 4KQLA 1VGWA 1VZUA 3D98A 3U2TA 5C3AA 1ZDFA 4KC1A 4B2XA 5C1LA 1W77A 3BRKX 2RJ9A 2WE9A 3PKPA 3SX8A 4FCEA 2W0VA 3E25A 3IOHA 3K8DA 1R7YA 2CU2A 1LZJA 4IRPA 5EJZA 4DDZA 3OAMA 1W57A 5HS2A 3PNNA 1LZ7A 4KPZA 4P02A 4J18A 4Y7TA 1H7HA 2AESA 3OKRA 1XHBA 2RJ7A 2RJ6A 3V0NA 4G3PA 2Y7AA 1NF5B 1WVCA 3V90A 1G0RA 1R81A 2WVMA 2APCA 4ZDQA 2QGIA 4Y6NA 1O7QA 4AYLA 3SXDA 4EE3A 4D0ZA 1MP5A 3OC9A 4Y6UA 1FOAA 1FXOA 3V0QA 3V0OA 1IINA 4EVWA 1FO8A 1QGSA 1JV1A 4M2BA 4B2WA 3I0FA 1OQMB 2JCJA 1G3LA 2E8BA 1VGTA 1ZJPA 3I0IX 1XZ6A 1ZIZA 1YROB 2AM5A 3K8EA 4DECA 5C47A 2RJ0A 5I1FA 3CKNA 2P72A 1FO9A 4Y7UA 2I5KA 3I0HA 4FRPA 1I52A 2A8UA 2RJ8A 2I7BA 3SXCA 1SS9A 1W55A 2RITA 4DE7A 3E26A 1VH3A 3KIAA 2A8WA 4D48A 1H7FA 5CQNX 2MZBA 4HO0A 1ZCYA 2Y4KA 2XMHA 3USRA 5C1HA 4D0TA 4EEGA 2P73A 4FCUA 5CMIA 1H5RA 3F1YA 4Y63A 1PZTA 2VS3A 4HOCA 4Y9XA 1KWSA 3ST8A 2Q4JA 3I0EA 1INIA 2P6WA 4BMAA 5CQOA 2AM3A 1H5SB 1S4NA 2RJ1A 4IRQA 2OEFA 1LL2A 2BO7A 4ECMA 5FU0A 5IDSA 2PA4A 4KC2A 5IFYA 1VGUA 1GA8A 1H4DA 5JQQA 2YESA 5FTVA 4ASYA 1VZXA 2Y6PA 3SX3A 1GWWA 3D5NA 4XWIA 3R2WA 2FYBA 3V8ZA 3U0YA 3T7MA 3T7OA 3POLA 5DDVA 2Y4LA 4B3UA 4CJ8A 3CKVA 1TW5A 2O1GA 1FXJA 4UEGA 4NAKA 1JVDA 2WVLA 2W0WA 4BQHA 1JVGA 2OI5A 1LZIA 3I0CA 2X5SA 5C8RA 5C4FA 4KPXA 4R7PA 4EE4A 1V83A 1G2VA 1FGXA 3SX7A 4ASJA 1HV9A 1TW1A 2JCLA 5C4CA 1PZYB 1R82A 2V0JA 5AJNA 3RMWA 1GQCA 1YP3A 1VZTA 3V0MA 4KXOA 1NWGB 3TZTA 2VSHA 2O1HA 1QWJA 1TVYA 1R7UA 2GGQA 4JISA 1O0RA 5AJOA 1INJA 1ZJOA 1NKHB 2X60A 1OMZA 2FYCB 3Q4SA 1ON8A 3DJ4A 5FTSA 3IOJA 1ON6A 1VM8A 1NMMB 5FV9A 2E3DA 5IDTA 2XWLA 5C4BA 4AC3A 1ZJ1A 3PKQA 1VPAA 4M28A 4JD0A 2YQHA 4HO2A 4NAIA 5C36A 2VFZA 5FU8A 1G23A 1HJJA 1G1LA 4NANA 4HO4A 1TZFA 4EEAA 2Z87A 2PGVA 3F1CA 4B4BA 1G8OA 4M2AA 2ZU9A 1YP2A 1ZCUA 2FFUA 5FUHA 3V0LA 2FYDB 2V0HA 2XMEA 4AAWA 3OH0A 3Q80A 2RIYA 1OMXA 4EEOA 2RIXA 3O3PA 3IOIA 4Y7VA 2YC5A 4L41C 5L6VA 2VS5A 1H4EA 3V91A 4AYJA 4EEMA 3U2UA 1LL3A 1VGZA 1H5TB 1H7GA 1WT1A 2VSIA 1V82A 2WVKA 4FROA 4K6RA 4CVHA 1R7XA 5J49A 4NALA 4KNRA 4B5BA 2VXMA 1FR8A 3SXBA 1GX0A 2WEEA 5CQLX 2AECA 1FG5N 5EIYA 1H5SD 2D0JA 1ZHJA 3LW6A 4EE5A 1H5SA 1H5RB 1G97A 2FFVA 3OH1A 1G93A 4HO5A 3CU0A 1O7OA 2DPWA 1H7EA 3OH2A 3JTJA 4GBPA 3V0PA 1FRWA 1HM8A 1Z90A 2YC3A 4B42A 3NGWA 4ARWA 2FYAA 2YQCA 5BXCA 1NQIB 1WT0A 3T7NA 3CGXA 1S4OA 2AGDA 1LZ0A 2Y4MA 4KRVA 5C3BA 2AH9A 2BO4A 3TQDA 3I0DA 4HG6A 3N9WA 2VD4A 1ZI1A 3ZLLA 3I0JA 5CQMX 4CJCA 4HCQA 4D11A 1GQ9A 4KC4A 1K4VA 2QKXA 1ZCVA 2FY7A 4FRQA 3SX5A 1H5SC 1MC3A 2BO6A 1FWYA 4HO3A 1R7VA 1FZWA 2Y4JA 3BCVA 3DK5A 3I0LA 2NXVA 1S4PA 4G3SA 5CMHA 4Y7GA 2O1FA 2V0IA 3USQA 5EJ1A 2XWNA 3U2XA 3U2VA 1H7LA 1LVWA 5C38A 1WT3A 5C4DA 4LW3A 1ZI5A 1H7TA 2AE7A 1HJLA 3GUEA 5DDTA 1QG8A 4FQWA 3JUJA 2RIZA 1H4CA 1G9RA 5C3DA 1JYKA 2XWMA 4D11C 2Z86A 2ZU8A 4FRMA 5C4EA 3RSBA 2ICXA 2WAWA 4B4GA 2X65A 5AJPA 2WGZA 1GX4A 4FRBA 1G95A 4FREA 4Y64A 4FRAA 5FYEA 3I0GA 3CKOA 3EE5A 5C1GA 3D8VA 4Y7FA 1ZCTA 3ZGFA 1MP3A 1ZI4A 3R3IA 4CJBA 5C49A 3DUVA 1R7TA 3SXGA 1V84A 2GGOA 4HO6A 4KNXA 3JUKA 1WT2A 1JYLA 2AM4A 1QGQA 3CKJA 2ICYA 5C48A 3U0XA
chains in the Genus database with same CATH superfamily
1ZJ3A 1HM0A 3Q7UA 1FR9A 5CMFX 3OH3A 2VXLA 3SXEA 1H7QA 2QH5A 2PX7A 2YQSA 2OI7A 1EZIA 3QVBA 3SPTA 4Y62A 2V0LA 1NHEB 4FRDA 2X5ZA 3HL3A 1VH1A 1H5TA 2JCKA 2V0KA 1ZJ0A 3ZGGA 1JV3A 3OGZA 3ZF8A 1ZJ2A 5CQPA 1MP4A 3FWWA 4YS8A 4G3QA 2OI6A 1ZDGA 4MNDA 4FRHA 2D7IA 5L6SA 1GWVA 2I5EA 5CMGX 3U2WA 2UX8A 2RJ5A 4FRLA 2D7RA 3FOQA 2RJ4A 1H3MA 1WSZA 4M4KA 2PGYA 2JCOA 1FGGA 3ZLKA 1YP4A 4P00A 2YCMA 3SXAA 1HM9A 1E5KA 1R80A 3I0KA 4G87A 5CMJA 1O23B 3CKQA 4LW6A 4HO9A 4KT7A 4B4MA 2BO8A 1VICA 2VS4A 1EYRA 1ZI3A 4E1KA 2YQJA 4HO8A 4C2SA 3V8YA 2ZU7A 3RMVA 3OH4A 4MYBA 2OEGA 1LL0A 1IIMA 4KQLA 1VGWA 1VZUA 4Q7CA 3D98A 3U2TA 5C3AA 1ZDFA 4KC1A 4B2XA 4FIXA 5C1LA 1W77A 3BRKX 2RJ9A 2WE9A 3PKPA 3SX8A 4FCEA 2W0VA 3E25A 3IOHA 3K8DA 1R7YA 2CU2A 1LZJA 4IRPA 5EJZA 4DDZA 3OAMA 1W57A 5HS2A 3PNNA 1LZ7A 4KPZA 4P02A 4J18A 4Y7TA 1H7HA 2AESA 3OKRA 1XHBA 2RJ7A 2RJ6A 3V0NA 4G3PA 2Y7AA 1NF5B 1WVCA 3V90A 1G0RA 1R81A 2WVMA 2APCA 4ZDQA 2QGIA 4Y6NA 1O7QA 4AYLA 3SXDA 4EE3A 4D0ZA 1MP5A 3OC9A 4Y6UA 1FOAA 1FXOA 3V0QA 3V0OA 1IINA 4EVWA 1FO8A 1QGSA 1JV1A 4M2BA 4B2WA 3I0FA 1OQMB 2JCJA 1G3LA 2E8BA 1VGTA 1ZJPA 3I0IX 1XZ6A 1ZIZA 1YROB 2AM5A 2C0NA 3K8EA 4DECA 5C47A 2RJ0A 5I1FA 3CKNA 2P72A 1FO9A 4Y7UA 2I5KA 3I0HA 4FRPA 1I52A 2A8UA 2VK9A 2RJ8A 2I7BA 3SXCA 1SS9A 1W55A 2RITA 4DE7A 3E26A 1VH3A 3KIAA 2A8WA 4D48A 1H7FA 5CQNX 2MZBA 4HO0A 1ZCYA 2Y4KA 2XMHA 3USRA 5C1HA 4D0TA 4EEGA 2P73A 4FCUA 5CMIA 1H5RA 3F1YA 4Y63A 1PZTA 2VS3A 4HOCA 4Y9XA 1KWSA 3ST8A 2Q4JA 3I0EA 1INIA 2P6WA 4BMAA 5CQOA 2AM3A 1H5SB 1S4NA 2RJ1A 4IRQA 2OEFA 1LL2A 2BO7A 4ECMA 5FU0A 5IDSA 2PA4A 4KC2A 5IFYA 1VGUA 5D91A 1GA8A 1H4DA 5JQQA 2YESA 5FTVA 4ASYA 1VZXA 2Y6PA 3SX3A 1GWWA 3D5NA 4XWIA 3R2WA 2FYBA 3V8ZA 3U0YA 3T7MA 3T7OA 3POLA 5DDVA 2Y4LA 4B3UA 4CJ8A 3CKVA 1TW5A 2O1GA 1FXJA 4UEGA 4NAKA 1JVDA 2WVLA 2W0WA 4BQHA 1JVGA 2OI5A 1LZIA 3I0CA 2X5SA 5C8RA 5C4FA 4KPXA 4R7PA 4EE4A 1V83A 4FIYA 1G2VA 1FGXA 3SX7A 4ASJA 1HV9A 1TW1A 2JCLA 5C4CA 1PZYB 1R82A 4O6MA 2V0JA 5AJNA 3RMWA 1GQCA 1YP3A 1VZTA 3V0MA 4KXOA 1NWGB 3TZTA 2VSHA 2O1HA 1QWJA 1TVYA 1R7UA 2GGQA 4JISA 1O0RA 5AJOA 1INJA 1ZJOA 1NKHB 2X60A 1OMZA 2FYCB 3Q4SA 2J0AA 1ON8A 3DJ4A 5FTSA 3IOJA 1ON6A 1VM8A 1NMMB 5FV9A 2E3DA 5IDTA 2XWLA 5C4BA 4AC3A 1ZJ1A 3PKQA 1VPAA 4M28A 4JD0A 2YQHA 4HO2A 4NAIA 5C36A 2VFZA 5FU8A 1G23A 4O6NA 1HJJA 1G1LA 4NANA 4HO4A 1TZFA 4EEAA 2Z87A 2PGVA 3F1CA 4B4BA 1G8OA 4M2AA 2ZU9A 1YP2A 1ZCUA 2FFUA 2J0BA 5FUHA 3V0LA 2FYDB 2V0HA 2XMEA 4AAWA 3OH0A 3Q80A 2RIYA 1OMXA 4EEOA 2RIXA 3O3PA 3IOIA 4Y7VA 2YC5A 4L41C 5L6VA 2VS5A 1H4EA 3V91A 4AYJA 4EEMA 3U2UA 1LL3A 1VGZA 1H5TB 1H7GA 1WT1A 2VSIA 1V82A 2WVKA 4FROA 4K6RA 4CVHA 1R7XA 5J49A 4NALA 4KNRA 4B5BA 2VXMA 1FR8A 3SXBA 1GX0A 2WEEA 5CQLX 2AECA 1FG5N 5EIYA 1H5SD 2D0JA 1ZHJA 3LW6A 4EE5A 1H5SA 1H5RB 1G97A 2FFVA 3OH1A 1G93A 4HO5A 3CU0A 1O7OA 2DPWA 1H7EA 3OH2A 3JTJA 4GBPA 3V0PA 1FRWA 1HM8A 1Z90A 2YC3A 4B42A 3NGWA 4ARWA 2FYAA 2YQCA 5BXCA 1NQIB 1WT0A 3T7NA 3CGXA 1S4OA 2AGDA 1LZ0A 2Y4MA 4KRVA 5C3BA 2AH9A 2BO4A 3TQDA 3I0DA 4HG6A 3N9WA 5D92A 2VD4A 1ZI1A 3ZLLA 3I0JA 5CQMX 4CJCA 4HCQA 4D11A 1GQ9A 4KC4A 1K4VA 2QKXA 1ZCVA 2FY7A 4FRQA 3SX5A 1H5SC 1MC3A 2BO6A 1FWYA 4HO3A 1R7VA 1FZWA 2Y4JA 3BCVA 3DK5A 3I0LA 2NXVA 1S4PA 4G3SA 5CMHA 4Y7GA 2O1FA 2V0IA 3USQA 5EJ1A 2XWNA 3U2XA 3U2VA 1H7LA 1LVWA 5C38A 1WT3A 5C4DA 4LW3A 1ZI5A 1H7TA 2AE7A 1HJLA 3GUEA 5DDTA 1QG8A 4FQWA 3JUJA 2RIZA 1H4CA 1G9RA 5C3DA 1JYKA 2XWMA 4D11C 2Z86A 2ZU8A 4FRMA 5C4EA 3RSBA 2ICXA 2WAWA 4B4GA 2X65A 5AJPA 2WGZA 1GX4A 4FRBA 1G95A 4FREA 4Y64A 4FRAA 5FYEA 3I0GA 3CKOA 3EE5A 5C1GA 3D8VA 4Y7FA 1ZCTA 3ZGFA 1MP3A 1ZI4A 3R3IA 4CJBA 5C49A 3DUVA 1R7TA 3SXGA 1V84A 2GGOA 4HO6A 4KNXA 3JUKA 1WT2A 1JYLA 2AM4A 1QGQA 3CKJA 2ICYA 5C48A 3U0XA 4MIXA
chains in the Genus database with same CATH topology
1ZJ3A 1HM0A 3Q7UA 1FR9A 5CMFX 3OH3A 2VXLA 3SXEA 1H7QA 2QH5A 2PX7A 2YQSA 2OI7A 1EZIA 3QVBA 3SPTA 4Y62A 2V0LA 1NHEB 4FRDA 2X5ZA 3HL3A 1VH1A 1H5TA 2JCKA 2V0KA 1ZJ0A 3ZGGA 1JV3A 3OGZA 3ZF8A 1ZJ2A 5CQPA 1MP4A 3FWWA 4YS8A 4G3QA 2OI6A 1ZDGA 4MNDA 4FRHA 2D7IA 5L6SA 1GWVA 2I5EA 5CMGX 3U2WA 2UX8A 2RJ5A 4FRLA 2D7RA 3FOQA 2RJ4A 1H3MA 1WSZA 4M4KA 2PGYA 2JCOA 1FGGA 3ZLKA 1YP4A 4P00A 2YCMA 3SXAA 1HM9A 1E5KA 1R80A 3I0KA 4G87A 5CMJA 1O23B 3CKQA 4LW6A 4HO9A 4KT7A 4B4MA 2BO8A 1VICA 2VS4A 1EYRA 1ZI3A 4E1KA 2YQJA 4HO8A 4C2SA 3V8YA 2ZU7A 3RMVA 3OH4A 4MYBA 2OEGA 1LL0A 1IIMA 4KQLA 1VGWA 1VZUA 4Q7CA 3D98A 3U2TA 5C3AA 1ZDFA 4KC1A 4B2XA 4FIXA 5C1LA 1W77A 3BRKX 2RJ9A 2WE9A 3PKPA 3SX8A 4FCEA 2W0VA 3E25A 3IOHA 3K8DA 1R7YA 2CU2A 1LZJA 4IRPA 5EJZA 4DDZA 3OAMA 1W57A 5HS2A 3PNNA 1LZ7A 4KPZA 4P02A 4J18A 4Y7TA 1H7HA 2AESA 3OKRA 1XHBA 2RJ7A 2RJ6A 3V0NA 4G3PA 2Y7AA 1NF5B 1WVCA 3V90A 1G0RA 1R81A 2WVMA 2APCA 4ZDQA 2QGIA 4Y6NA 1O7QA 4AYLA 3SXDA 4EE3A 4D0ZA 1MP5A 3OC9A 4Y6UA 1FOAA 1FXOA 3V0QA 3V0OA 1IINA 4EVWA 1FO8A 1QGSA 1JV1A 4M2BA 4B2WA 3I0FA 1OQMB 2JCJA 1G3LA 2E8BA 1VGTA 1ZJPA 3I0IX 1XZ6A 1ZIZA 1YROB 2AM5A 2C0NA 3K8EA 4DECA 5C47A 2RJ0A 5I1FA 3CKNA 2P72A 1FO9A 4Y7UA 2I5KA 3I0HA 4FRPA 1I52A 2A8UA 2VK9A 2RJ8A 2I7BA 3SXCA 1SS9A 1W55A 2RITA 4DE7A 3E26A 1VH3A 3KIAA 2A8WA 4D48A 1H7FA 5CQNX 2MZBA 4HO0A 1ZCYA 2Y4KA 2XMHA 3USRA 5C1HA 4D0TA 4EEGA 2P73A 4FCUA 5CMIA 1H5RA 3F1YA 4Y63A 1PZTA 2VS3A 4HOCA 4Y9XA 1KWSA 3ST8A 2Q4JA 3I0EA 1INIA 2P6WA 4BMAA 5CQOA 2AM3A 1H5SB 1S4NA 2RJ1A 4IRQA 2OEFA 1LL2A 2BO7A 4ECMA 5FU0A 5IDSA 2PA4A 4KC2A 5IFYA 1VGUA 5D91A 1GA8A 1H4DA 5JQQA 2YESA 5FTVA 4ASYA 1VZXA 2Y6PA 3SX3A 1GWWA 3D5NA 4XWIA 3R2WA 2FYBA 3V8ZA 3U0YA 3T7MA 3T7OA 3POLA 5DDVA 2Y4LA 4B3UA 4CJ8A 3CKVA 1TW5A 2O1GA 1FXJA 4UEGA 4NAKA 1JVDA 2WVLA 2W0WA 4BQHA 1JVGA 2OI5A 1LZIA 3I0CA 2X5SA 5C8RA 5C4FA 4KPXA 4R7PA 4EE4A 1V83A 4FIYA 1G2VA 1FGXA 3SX7A 4ASJA 1HV9A 1TW1A 2JCLA 5C4CA 1PZYB 1R82A 4O6MA 2V0JA 5AJNA 3RMWA 1GQCA 1YP3A 1VZTA 3V0MA 4KXOA 1NWGB 3TZTA 2VSHA 2O1HA 1QWJA 1TVYA 1R7UA 2GGQA 4JISA 1O0RA 5AJOA 1INJA 1ZJOA 1NKHB 2X60A 1OMZA 2FYCB 3Q4SA 2J0AA 1ON8A 3DJ4A 5FTSA 3IOJA 1ON6A 1VM8A 1NMMB 5FV9A 2E3DA 5IDTA 2XWLA 5C4BA 4AC3A 1ZJ1A 3PKQA 1VPAA 4M28A 4JD0A 2YQHA 4HO2A 4NAIA 5C36A 2VFZA 5FU8A 1G23A 4O6NA 1HJJA 1G1LA 4NANA 4HO4A 1TZFA 4EEAA 2Z87A 2PGVA 3F1CA 4B4BA 1G8OA 4M2AA 2ZU9A 1YP2A 1ZCUA 2FFUA 2J0BA 5FUHA 3V0LA 2FYDB 2V0HA 2XMEA 4AAWA 3OH0A 3Q80A 2RIYA 1OMXA 4EEOA 2RIXA 3O3PA 3IOIA 4Y7VA 2YC5A 4L41C 5L6VA 2VS5A 1H4EA 3V91A 4AYJA 4EEMA 3U2UA 1LL3A 1VGZA 1H5TB 1H7GA 1WT1A 2VSIA 1V82A 2WVKA 4FROA 4K6RA 4CVHA 1R7XA 5J49A 4NALA 4KNRA 4B5BA 2VXMA 1FR8A 3SXBA 1GX0A 2WEEA 5CQLX 2AECA 1FG5N 5EIYA 1H5SD 2D0JA 1ZHJA 3LW6A 4EE5A 1H5SA 1H5RB 1G97A 2FFVA 3OH1A 1G93A 4HO5A 3CU0A 1O7OA 2DPWA 1H7EA 3OH2A 3JTJA 4GBPA 3V0PA 1FRWA 1HM8A 1Z90A 2YC3A 4B42A 3NGWA 4ARWA 2FYAA 2YQCA 5BXCA 1NQIB 1WT0A 3T7NA 3CGXA 1S4OA 2AGDA 1LZ0A 2Y4MA 4KRVA 5C3BA 2AH9A 2BO4A 3TQDA 3I0DA 4HG6A 3N9WA 5D92A 2VD4A 1ZI1A 3ZLLA 3I0JA 5CQMX 4CJCA 4HCQA 4D11A 1GQ9A 4KC4A 1K4VA 2QKXA 1ZCVA 2FY7A 4FRQA 3SX5A 1H5SC 1MC3A 2BO6A 1FWYA 4HO3A 1R7VA 1FZWA 2Y4JA 3BCVA 3DK5A 3I0LA 2NXVA 1S4PA 4G3SA 5CMHA 4Y7GA 2O1FA 2V0IA 3USQA 5EJ1A 2XWNA 3U2XA 3U2VA 1H7LA 1LVWA 5C38A 1WT3A 5C4DA 4LW3A 1ZI5A 1H7TA 2AE7A 1HJLA 3GUEA 5DDTA 1QG8A 4FQWA 3JUJA 2RIZA 1H4CA 1G9RA 5C3DA 1JYKA 2XWMA 4D11C 2Z86A 2ZU8A 4FRMA 5C4EA 3RSBA 2ICXA 2WAWA 4B4GA 2X65A 5AJPA 2WGZA 1GX4A 4FRBA 1G95A 4FREA 4Y64A 4FRAA 5FYEA 3I0GA 3CKOA 3EE5A 5C1GA 3D8VA 4Y7FA 1ZCTA 3ZGFA 1MP3A 1ZI4A 3R3IA 4CJBA 5C49A 3DUVA 1R7TA 3SXGA 1V84A 2GGOA 4HO6A 4KNXA 3JUKA 1WT2A 1JYLA 2AM4A 1QGQA 3CKJA 2ICYA 5C48A 3U0XA 4MIXA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1ZJ3 A;  1HM0 A;  3Q7U A;  1FR9 A;  5CMF X;  3OH3 A;  2VXL A;  3SXE A;  1H7Q A;  2QH5 A;  2PX7 A;  2YQS A;  2OI7 A;  1EZI A;  3QVB A;  3SPT A;  4Y62 A;  2V0L A;  1NHE B;  4FRD A;  2X5Z A;  3HL3 A;  1VH1 A;  1H5T A;  2JCK A;  2V0K A;  1ZJ0 A;  3ZGG A;  1JV3 A;  3OGZ A;  3ZF8 A;  1ZJ2 A;  5CQP A;  1MP4 A;  3FWW A;  4YS8 A;  4G3Q A;  2OI6 A;  1ZDG A;  4MND A;  4FRH A;  2D7I A;  5L6S A;  1GWV A;  2I5E A;  5CMG X;  3U2W A;  2UX8 A;  2RJ5 A;  4FRL A;  2D7R A;  3FOQ A;  2RJ4 A;  1H3M A;  1WSZ A;  4M4K A;  2PGY A;  2JCO A;  1FGG A;  3ZLK A;  1YP4 A;  4P00 A;  2YCM A;  3SXA A;  1HM9 A;  1E5K A;  1R80 A;  3I0K A;  4G87 A;  5CMJ A;  1O23 B;  3CKQ A;  4LW6 A;  4HO9 A;  4KT7 A;  4B4M A;  2BO8 A;  1VIC A;  2VS4 A;  1EYR A;  1ZI3 A;  4E1K A;  2YQJ A;  4HO8 A;  4C2S A;  3V8Y A;  2ZU7 A;  3RMV A;  3OH4 A;  4MYB A;  2OEG A;  1LL0 A;  1IIM A;  4KQL A;  1VGW A;  1VZU A;  3D98 A;  3U2T A;  5C3A A;  1ZDF A;  4KC1 A;  4B2X A;  5C1L A;  1W77 A;  3BRK X;  2RJ9 A;  2WE9 A;  3PKP A;  3SX8 A;  4FCE A;  2W0V A;  3E25 A;  3IOH A;  3K8D A;  1R7Y A;  2CU2 A;  1LZJ A;  4IRP A;  5EJZ A;  4DDZ A;  3OAM A;  1W57 A;  5HS2 A;  3PNN A;  1LZ7 A;  4KPZ A;  4P02 A;  4J18 A;  4Y7T A;  1H7H A;  2AES A;  3OKR A;  1XHB A;  2RJ7 A;  2RJ6 A;  3V0N A;  4G3P A;  2Y7A A;  1NF5 B;  1WVC A;  3V90 A;  1G0R A;  1R81 A;  2WVM A;  2APC A;  4ZDQ A;  2QGI A;  4Y6N A;  1O7Q A;  4AYL A;  3SXD A;  4EE3 A;  4D0Z A;  1MP5 A;  3OC9 A;  4Y6U A;  1FOA A;  1FXO A;  3V0Q A;  3V0O A;  1IIN A;  4EVW A;  1FO8 A;  1QGS A;  1JV1 A;  4M2B A;  4B2W A;  3I0F A;  1OQM B;  2JCJ A;  1G3L A;  2E8B A;  1VGT A;  1ZJP A;  3I0I X;  1XZ6 A;  1ZIZ A;  1YRO B;  2AM5 A;  3K8E A;  4DEC A;  5C47 A;  2RJ0 A;  5I1F A;  3CKN A;  2P72 A;  1FO9 A;  4Y7U A;  2I5K A;  3I0H A;  4FRP A;  1I52 A;  2A8U A;  2RJ8 A;  2I7B A;  3SXC A;  1SS9 A;  1W55 A;  2RIT A;  4DE7 A;  3E26 A;  1VH3 A;  3KIA A;  2A8W A;  4D48 A;  1H7F A;  5CQN X;  2MZB A;  4HO0 A;  1ZCY A;  2Y4K A;  2XMH A;  3USR A;  5C1H A;  4D0T A;  4EEG A;  2P73 A;  4FCU A;  5CMI A;  1H5R A;  3F1Y A;  4Y63 A;  1PZT A;  2VS3 A;  4HOC A;  4Y9X A;  1KWS A;  3ST8 A;  2Q4J A;  3I0E A;  1INI A;  2P6W A;  4BMA A;  5CQO A;  2AM3 A;  1H5S B;  1S4N A;  2RJ1 A;  4IRQ A;  2OEF A;  1LL2 A;  2BO7 A;  4ECM A;  5FU0 A;  5IDS A;  2PA4 A;  4KC2 A;  5IFY A;  1VGU A;  1GA8 A;  1H4D A;  5JQQ A;  2YES A;  5FTV A;  4ASY A;  1VZX A;  2Y6P A;  3SX3 A;  1GWW A;  3D5N A;  4XWI A;  3R2W A;  2FYB A;  3V8Z A;  3U0Y A;  3T7M A;  3T7O A;  3POL A;  5DDV A;  2Y4L A;  4B3U A;  4CJ8 A;  3CKV A;  1TW5 A;  2O1G A;  1FXJ A;  4UEG A;  4NAK A;  1JVD A;  2WVL A;  2W0W A;  4BQH A;  1JVG A;  2OI5 A;  1LZI A;  3I0C A;  2X5S A;  5C8R A;  5C4F A;  4KPX A;  4R7P A;  4EE4 A;  1V83 A;  1G2V A;  1FGX A;  3SX7 A;  4ASJ A;  1HV9 A;  1TW1 A;  2JCL A;  5C4C A;  1PZY B;  1R82 A;  2V0J A;  5AJN A;  3RMW A;  1GQC A;  1YP3 A;  1VZT A;  3V0M A;  4KXO A;  1NWG B;  3TZT A;  2VSH A;  2O1H A;  1QWJ A;  1TVY A;  1R7U A;  2GGQ A;  4JIS A;  1O0R A;  5AJO A;  1INJ A;  1ZJO A;  1NKH B;  2X60 A;  1OMZ A;  2FYC B;  3Q4S A;  1ON8 A;  3DJ4 A;  5FTS A;  3IOJ A;  1ON6 A;  1VM8 A;  1NMM B;  5FV9 A;  2E3D A;  5IDT A;  2XWL A;  5C4B A;  4AC3 A;  1ZJ1 A;  3PKQ A;  1VPA A;  4M28 A;  4JD0 A;  2YQH A;  4HO2 A;  4NAI A;  5C36 A;  2VFZ A;  5FU8 A;  1G23 A;  1HJJ A;  1G1L A;  4NAN A;  4HO4 A;  1TZF A;  4EEA A;  2Z87 A;  2PGV A;  3F1C A;  4B4B A;  1G8O A;  4M2A A;  2ZU9 A;  1YP2 A;  1ZCU A;  2FFU A;  5FUH A;  3V0L A;  2FYD B;  2V0H A;  2XME A;  4AAW A;  3OH0 A;  3Q80 A;  2RIY A;  1OMX A;  4EEO A;  2RIX A;  3O3P A;  3IOI A;  4Y7V A;  2YC5 A;  4L41 C;  5L6V A;  2VS5 A;  1H4E A;  3V91 A;  4AYJ A;  4EEM A;  3U2U A;  1LL3 A;  1VGZ A;  1H5T B;  1H7G A;  1WT1 A;  2VSI A;  1V82 A;  2WVK A;  4FRO A;  4K6R A;  4CVH A;  1R7X A;  5J49 A;  4NAL A;  4KNR A;  4B5B A;  2VXM A;  1FR8 A;  3SXB A;  1GX0 A;  2WEE A;  5CQL X;  2AEC A;  1FG5 N;  5EIY A;  1H5S D;  2D0J A;  1ZHJ A;  3LW6 A;  4EE5 A;  1H5S A;  1H5R B;  1G97 A;  2FFV A;  3OH1 A;  1G93 A;  4HO5 A;  3CU0 A;  1O7O A;  2DPW A;  1H7E A;  3OH2 A;  3JTJ A;  4GBP A;  3V0P A;  1FRW A;  1HM8 A;  1Z90 A;  2YC3 A;  4B42 A;  3NGW A;  4ARW A;  2FYA A;  2YQC A;  5BXC A;  1NQI B;  1WT0 A;  3T7N A;  3CGX A;  1S4O A;  2AGD A;  1LZ0 A;  2Y4M A;  4KRV A;  5C3B A;  2AH9 A;  2BO4 A;  3TQD A;  3I0D A;  4HG6 A;  3N9W A;  2VD4 A;  1ZI1 A;  3ZLL A;  3I0J A;  5CQM X;  4CJC A;  4HCQ A;  4D11 A;  1GQ9 A;  4KC4 A;  1K4V A;  2QKX A;  1ZCV A;  2FY7 A;  4FRQ A;  3SX5 A;  1H5S C;  1MC3 A;  2BO6 A;  1FWY A;  4HO3 A;  1R7V A;  1FZW A;  2Y4J A;  3BCV A;  3DK5 A;  3I0L A;  2NXV A;  1S4P A;  4G3S A;  5CMH A;  4Y7G A;  2O1F A;  2V0I A;  3USQ A;  5EJ1 A;  2XWN A;  3U2X A;  3U2V A;  1H7L A;  1LVW A;  5C38 A;  1WT3 A;  5C4D A;  4LW3 A;  1ZI5 A;  1H7T A;  2AE7 A;  1HJL A;  3GUE A;  5DDT A;  1QG8 A;  4FQW A;  3JUJ A;  2RIZ A;  1H4C A;  1G9R A;  5C3D A;  1JYK A;  2XWM A;  4D11 C;  2Z86 A;  2ZU8 A;  4FRM A;  5C4E A;  3RSB A;  2ICX A;  2WAW A;  4B4G A;  2X65 A;  5AJP A;  2WGZ A;  1GX4 A;  4FRB A;  1G95 A;  4FRE A;  4Y64 A;  4FRA A;  5FYE A;  3I0G A;  3CKO A;  3EE5 A;  5C1G A;  3D8V A;  4Y7F A;  1ZCT A;  3ZGF A;  1MP3 A;  1ZI4 A;  3R3I A;  4CJB A;  5C49 A;  3DUV A;  1R7T A;  3SXG A;  1V84 A;  2GGO A;  4HO6 A;  4KNX A;  3JUK A;  1WT2 A;  1JYL A;  2AM4 A;  1QGQ A;  3CKJ A;  2ICY A;  5C48 A;  3U0X A; 
#chains in the Genus database with same CATH topology
 1ZJ3 A;  1HM0 A;  3Q7U A;  1FR9 A;  5CMF X;  3OH3 A;  2VXL A;  3SXE A;  1H7Q A;  2QH5 A;  2PX7 A;  2YQS A;  2OI7 A;  1EZI A;  3QVB A;  3SPT A;  4Y62 A;  2V0L A;  1NHE B;  4FRD A;  2X5Z A;  3HL3 A;  1VH1 A;  1H5T A;  2JCK A;  2V0K A;  1ZJ0 A;  3ZGG A;  1JV3 A;  3OGZ A;  3ZF8 A;  1ZJ2 A;  5CQP A;  1MP4 A;  3FWW A;  4YS8 A;  4G3Q A;  2OI6 A;  1ZDG A;  4MND A;  4FRH A;  2D7I A;  5L6S A;  1GWV A;  2I5E A;  5CMG X;  3U2W A;  2UX8 A;  2RJ5 A;  4FRL A;  2D7R A;  3FOQ A;  2RJ4 A;  1H3M A;  1WSZ A;  4M4K A;  2PGY A;  2JCO A;  1FGG A;  3ZLK A;  1YP4 A;  4P00 A;  2YCM A;  3SXA A;  1HM9 A;  1E5K A;  1R80 A;  3I0K A;  4G87 A;  5CMJ A;  1O23 B;  3CKQ A;  4LW6 A;  4HO9 A;  4KT7 A;  4B4M A;  2BO8 A;  1VIC A;  2VS4 A;  1EYR A;  1ZI3 A;  4E1K A;  2YQJ A;  4HO8 A;  4C2S A;  3V8Y A;  2ZU7 A;  3RMV A;  3OH4 A;  4MYB A;  2OEG A;  1LL0 A;  1IIM A;  4KQL A;  1VGW A;  1VZU A;  4Q7C A;  3D98 A;  3U2T A;  5C3A A;  1ZDF A;  4KC1 A;  4B2X A;  4FIX A;  5C1L A;  1W77 A;  3BRK X;  2RJ9 A;  2WE9 A;  3PKP A;  3SX8 A;  4FCE A;  2W0V A;  3E25 A;  3IOH A;  3K8D A;  1R7Y A;  2CU2 A;  1LZJ A;  4IRP A;  5EJZ A;  4DDZ A;  3OAM A;  1W57 A;  5HS2 A;  3PNN A;  1LZ7 A;  4KPZ A;  4P02 A;  4J18 A;  4Y7T A;  1H7H A;  2AES A;  3OKR A;  1XHB A;  2RJ7 A;  2RJ6 A;  3V0N A;  4G3P A;  2Y7A A;  1NF5 B;  1WVC A;  3V90 A;  1G0R A;  1R81 A;  2WVM A;  2APC A;  4ZDQ A;  2QGI A;  4Y6N A;  1O7Q A;  4AYL A;  3SXD A;  4EE3 A;  4D0Z A;  1MP5 A;  3OC9 A;  4Y6U A;  1FOA A;  1FXO A;  3V0Q A;  3V0O A;  1IIN A;  4EVW A;  1FO8 A;  1QGS A;  1JV1 A;  4M2B A;  4B2W A;  3I0F A;  1OQM B;  2JCJ A;  1G3L A;  2E8B A;  1VGT A;  1ZJP A;  3I0I X;  1XZ6 A;  1ZIZ A;  1YRO B;  2AM5 A;  2C0N A;  3K8E A;  4DEC A;  5C47 A;  2RJ0 A;  5I1F A;  3CKN A;  2P72 A;  1FO9 A;  4Y7U A;  2I5K A;  3I0H A;  4FRP A;  1I52 A;  2A8U A;  2VK9 A;  2RJ8 A;  2I7B A;  3SXC A;  1SS9 A;  1W55 A;  2RIT A;  4DE7 A;  3E26 A;  1VH3 A;  3KIA A;  2A8W A;  4D48 A;  1H7F A;  5CQN X;  2MZB A;  4HO0 A;  1ZCY A;  2Y4K A;  2XMH A;  3USR A;  5C1H A;  4D0T A;  4EEG A;  2P73 A;  4FCU A;  5CMI A;  1H5R A;  3F1Y A;  4Y63 A;  1PZT A;  2VS3 A;  4HOC A;  4Y9X A;  1KWS A;  3ST8 A;  2Q4J A;  3I0E A;  1INI A;  2P6W A;  4BMA A;  5CQO A;  2AM3 A;  1H5S B;  1S4N A;  2RJ1 A;  4IRQ A;  2OEF A;  1LL2 A;  2BO7 A;  4ECM A;  5FU0 A;  5IDS A;  2PA4 A;  4KC2 A;  5IFY A;  1VGU A;  5D91 A;  1GA8 A;  1H4D A;  5JQQ A;  2YES A;  5FTV A;  4ASY A;  1VZX A;  2Y6P A;  3SX3 A;  1GWW A;  3D5N A;  4XWI A;  3R2W A;  2FYB A;  3V8Z A;  3U0Y A;  3T7M A;  3T7O A;  3POL A;  5DDV A;  2Y4L A;  4B3U A;  4CJ8 A;  3CKV A;  1TW5 A;  2O1G A;  1FXJ A;  4UEG A;  4NAK A;  1JVD A;  2WVL A;  2W0W A;  4BQH A;  1JVG A;  2OI5 A;  1LZI A;  3I0C A;  2X5S A;  5C8R A;  5C4F A;  4KPX A;  4R7P A;  4EE4 A;  1V83 A;  4FIY A;  1G2V A;  1FGX A;  3SX7 A;  4ASJ A;  1HV9 A;  1TW1 A;  2JCL A;  5C4C A;  1PZY B;  1R82 A;  4O6M A;  2V0J A;  5AJN A;  3RMW A;  1GQC A;  1YP3 A;  1VZT A;  3V0M A;  4KXO A;  1NWG B;  3TZT A;  2VSH A;  2O1H A;  1QWJ A;  1TVY A;  1R7U A;  2GGQ A;  4JIS A;  1O0R A;  5AJO A;  1INJ A;  1ZJO A;  1NKH B;  2X60 A;  1OMZ A;  2FYC B;  3Q4S A;  2J0A A;  1ON8 A;  3DJ4 A;  5FTS A;  3IOJ A;  1ON6 A;  1VM8 A;  1NMM B;  5FV9 A;  2E3D A;  5IDT A;  2XWL A;  5C4B A;  4AC3 A;  1ZJ1 A;  3PKQ A;  1VPA A;  4M28 A;  4JD0 A;  2YQH A;  4HO2 A;  4NAI A;  5C36 A;  2VFZ A;  5FU8 A;  1G23 A;  4O6N A;  1HJJ A;  1G1L A;  4NAN A;  4HO4 A;  1TZF A;  4EEA A;  2Z87 A;  2PGV A;  3F1C A;  4B4B A;  1G8O A;  4M2A A;  2ZU9 A;  1YP2 A;  1ZCU A;  2FFU A;  2J0B A;  5FUH A;  3V0L A;  2FYD B;  2V0H A;  2XME A;  4AAW A;  3OH0 A;  3Q80 A;  2RIY A;  1OMX A;  4EEO A;  2RIX A;  3O3P A;  3IOI A;  4Y7V A;  2YC5 A;  4L41 C;  5L6V A;  2VS5 A;  1H4E A;  3V91 A;  4AYJ A;  4EEM A;  3U2U A;  1LL3 A;  1VGZ A;  1H5T B;  1H7G A;  1WT1 A;  2VSI A;  1V82 A;  2WVK A;  4FRO A;  4K6R A;  4CVH A;  1R7X A;  5J49 A;  4NAL A;  4KNR A;  4B5B A;  2VXM A;  1FR8 A;  3SXB A;  1GX0 A;  2WEE A;  5CQL X;  2AEC A;  1FG5 N;  5EIY A;  1H5S D;  2D0J A;  1ZHJ A;  3LW6 A;  4EE5 A;  1H5S A;  1H5R B;  1G97 A;  2FFV A;  3OH1 A;  1G93 A;  4HO5 A;  3CU0 A;  1O7O A;  2DPW A;  1H7E A;  3OH2 A;  3JTJ A;  4GBP A;  3V0P A;  1FRW A;  1HM8 A;  1Z90 A;  2YC3 A;  4B42 A;  3NGW A;  4ARW A;  2FYA A;  2YQC A;  5BXC A;  1NQI B;  1WT0 A;  3T7N A;  3CGX A;  1S4O A;  2AGD A;  1LZ0 A;  2Y4M A;  4KRV A;  5C3B A;  2AH9 A;  2BO4 A;  3TQD A;  3I0D A;  4HG6 A;  3N9W A;  5D92 A;  2VD4 A;  1ZI1 A;  3ZLL A;  3I0J A;  5CQM X;  4CJC A;  4HCQ A;  4D11 A;  1GQ9 A;  4KC4 A;  1K4V A;  2QKX A;  1ZCV A;  2FY7 A;  4FRQ A;  3SX5 A;  1H5S C;  1MC3 A;  2BO6 A;  1FWY A;  4HO3 A;  1R7V A;  1FZW A;  2Y4J A;  3BCV A;  3DK5 A;  3I0L A;  2NXV A;  1S4P A;  4G3S A;  5CMH A;  4Y7G A;  2O1F A;  2V0I A;  3USQ A;  5EJ1 A;  2XWN A;  3U2X A;  3U2V A;  1H7L A;  1LVW A;  5C38 A;  1WT3 A;  5C4D A;  4LW3 A;  1ZI5 A;  1H7T A;  2AE7 A;  1HJL A;  3GUE A;  5DDT A;  1QG8 A;  4FQW A;  3JUJ A;  2RIZ A;  1H4C A;  1G9R A;  5C3D A;  1JYK A;  2XWM A;  4D11 C;  2Z86 A;  2ZU8 A;  4FRM A;  5C4E A;  3RSB A;  2ICX A;  2WAW A;  4B4G A;  2X65 A;  5AJP A;  2WGZ A;  1GX4 A;  4FRB A;  1G95 A;  4FRE A;  4Y64 A;  4FRA A;  5FYE A;  3I0G A;  3CKO A;  3EE5 A;  5C1G A;  3D8V A;  4Y7F A;  1ZCT A;  3ZGF A;  1MP3 A;  1ZI4 A;  3R3I A;  4CJB A;  5C49 A;  3DUV A;  1R7T A;  3SXG A;  1V84 A;  2GGO A;  4HO6 A;  4KNX A;  3JUK A;  1WT2 A;  1JYL A;  2AM4 A;  1QGQ A;  3CKJ A;  2ICY A;  5C48 A;  3U0X A;  4MIX A; 
#chains in the Genus database with same CATH homology
 1ZJ3 A;  1HM0 A;  3Q7U A;  1FR9 A;  5CMF X;  3OH3 A;  2VXL A;  3SXE A;  1H7Q A;  2QH5 A;  2PX7 A;  2YQS A;  2OI7 A;  1EZI A;  3QVB A;  3SPT A;  4Y62 A;  2V0L A;  1NHE B;  4FRD A;  2X5Z A;  3HL3 A;  1VH1 A;  1H5T A;  2JCK A;  2V0K A;  1ZJ0 A;  3ZGG A;  1JV3 A;  3OGZ A;  3ZF8 A;  1ZJ2 A;  5CQP A;  1MP4 A;  3FWW A;  4YS8 A;  4G3Q A;  2OI6 A;  1ZDG A;  4MND A;  4FRH A;  2D7I A;  5L6S A;  1GWV A;  2I5E A;  5CMG X;  3U2W A;  2UX8 A;  2RJ5 A;  4FRL A;  2D7R A;  3FOQ A;  2RJ4 A;  1H3M A;  1WSZ A;  4M4K A;  2PGY A;  2JCO A;  1FGG A;  3ZLK A;  1YP4 A;  4P00 A;  2YCM A;  3SXA A;  1HM9 A;  1E5K A;  1R80 A;  3I0K A;  4G87 A;  5CMJ A;  1O23 B;  3CKQ A;  4LW6 A;  4HO9 A;  4KT7 A;  4B4M A;  2BO8 A;  1VIC A;  2VS4 A;  1EYR A;  1ZI3 A;  4E1K A;  2YQJ A;  4HO8 A;  4C2S A;  3V8Y A;  2ZU7 A;  3RMV A;  3OH4 A;  4MYB A;  2OEG A;  1LL0 A;  1IIM A;  4KQL A;  1VGW A;  1VZU A;  4Q7C A;  3D98 A;  3U2T A;  5C3A A;  1ZDF A;  4KC1 A;  4B2X A;  4FIX A;  5C1L A;  1W77 A;  3BRK X;  2RJ9 A;  2WE9 A;  3PKP A;  3SX8 A;  4FCE A;  2W0V A;  3E25 A;  3IOH A;  3K8D A;  1R7Y A;  2CU2 A;  1LZJ A;  4IRP A;  5EJZ A;  4DDZ A;  3OAM A;  1W57 A;  5HS2 A;  3PNN A;  1LZ7 A;  4KPZ A;  4P02 A;  4J18 A;  4Y7T A;  1H7H A;  2AES A;  3OKR A;  1XHB A;  2RJ7 A;  2RJ6 A;  3V0N A;  4G3P A;  2Y7A A;  1NF5 B;  1WVC A;  3V90 A;  1G0R A;  1R81 A;  2WVM A;  2APC A;  4ZDQ A;  2QGI A;  4Y6N A;  1O7Q A;  4AYL A;  3SXD A;  4EE3 A;  4D0Z A;  1MP5 A;  3OC9 A;  4Y6U A;  1FOA A;  1FXO A;  3V0Q A;  3V0O A;  1IIN A;  4EVW A;  1FO8 A;  1QGS A;  1JV1 A;  4M2B A;  4B2W A;  3I0F A;  1OQM B;  2JCJ A;  1G3L A;  2E8B A;  1VGT A;  1ZJP A;  3I0I X;  1XZ6 A;  1ZIZ A;  1YRO B;  2AM5 A;  2C0N A;  3K8E A;  4DEC A;  5C47 A;  2RJ0 A;  5I1F A;  3CKN A;  2P72 A;  1FO9 A;  4Y7U A;  2I5K A;  3I0H A;  4FRP A;  1I52 A;  2A8U A;  2VK9 A;  2RJ8 A;  2I7B A;  3SXC A;  1SS9 A;  1W55 A;  2RIT A;  4DE7 A;  3E26 A;  1VH3 A;  3KIA A;  2A8W A;  4D48 A;  1H7F A;  5CQN X;  2MZB A;  4HO0 A;  1ZCY A;  2Y4K A;  2XMH A;  3USR A;  5C1H A;  4D0T A;  4EEG A;  2P73 A;  4FCU A;  5CMI A;  1H5R A;  3F1Y A;  4Y63 A;  1PZT A;  2VS3 A;  4HOC A;  4Y9X A;  1KWS A;  3ST8 A;  2Q4J A;  3I0E A;  1INI A;  2P6W A;  4BMA A;  5CQO A;  2AM3 A;  1H5S B;  1S4N A;  2RJ1 A;  4IRQ A;  2OEF A;  1LL2 A;  2BO7 A;  4ECM A;  5FU0 A;  5IDS A;  2PA4 A;  4KC2 A;  5IFY A;  1VGU A;  5D91 A;  1GA8 A;  1H4D A;  5JQQ A;  2YES A;  5FTV A;  4ASY A;  1VZX A;  2Y6P A;  3SX3 A;  1GWW A;  3D5N A;  4XWI A;  3R2W A;  2FYB A;  3V8Z A;  3U0Y A;  3T7M A;  3T7O A;  3POL A;  5DDV A;  2Y4L A;  4B3U A;  4CJ8 A;  3CKV A;  1TW5 A;  2O1G A;  1FXJ A;  4UEG A;  4NAK A;  1JVD A;  2WVL A;  2W0W A;  4BQH A;  1JVG A;  2OI5 A;  1LZI A;  3I0C A;  2X5S A;  5C8R A;  5C4F A;  4KPX A;  4R7P A;  4EE4 A;  1V83 A;  4FIY A;  1G2V A;  1FGX A;  3SX7 A;  4ASJ A;  1HV9 A;  1TW1 A;  2JCL A;  5C4C A;  1PZY B;  1R82 A;  4O6M A;  2V0J A;  5AJN A;  3RMW A;  1GQC A;  1YP3 A;  1VZT A;  3V0M A;  4KXO A;  1NWG B;  3TZT A;  2VSH A;  2O1H A;  1QWJ A;  1TVY A;  1R7U A;  2GGQ A;  4JIS A;  1O0R A;  5AJO A;  1INJ A;  1ZJO A;  1NKH B;  2X60 A;  1OMZ A;  2FYC B;  3Q4S A;  2J0A A;  1ON8 A;  3DJ4 A;  5FTS A;  3IOJ A;  1ON6 A;  1VM8 A;  1NMM B;  5FV9 A;  2E3D A;  5IDT A;  2XWL A;  5C4B A;  4AC3 A;  1ZJ1 A;  3PKQ A;  1VPA A;  4M28 A;  4JD0 A;  2YQH A;  4HO2 A;  4NAI A;  5C36 A;  2VFZ A;  5FU8 A;  1G23 A;  4O6N A;  1HJJ A;  1G1L A;  4NAN A;  4HO4 A;  1TZF A;  4EEA A;  2Z87 A;  2PGV A;  3F1C A;  4B4B A;  1G8O A;  4M2A A;  2ZU9 A;  1YP2 A;  1ZCU A;  2FFU A;  2J0B A;  5FUH A;  3V0L A;  2FYD B;  2V0H A;  2XME A;  4AAW A;  3OH0 A;  3Q80 A;  2RIY A;  1OMX A;  4EEO A;  2RIX A;  3O3P A;  3IOI A;  4Y7V A;  2YC5 A;  4L41 C;  5L6V A;  2VS5 A;  1H4E A;  3V91 A;  4AYJ A;  4EEM A;  3U2U A;  1LL3 A;  1VGZ A;  1H5T B;  1H7G A;  1WT1 A;  2VSI A;  1V82 A;  2WVK A;  4FRO A;  4K6R A;  4CVH A;  1R7X A;  5J49 A;  4NAL A;  4KNR A;  4B5B A;  2VXM A;  1FR8 A;  3SXB A;  1GX0 A;  2WEE A;  5CQL X;  2AEC A;  1FG5 N;  5EIY A;  1H5S D;  2D0J A;  1ZHJ A;  3LW6 A;  4EE5 A;  1H5S A;  1H5R B;  1G97 A;  2FFV A;  3OH1 A;  1G93 A;  4HO5 A;  3CU0 A;  1O7O A;  2DPW A;  1H7E A;  3OH2 A;  3JTJ A;  4GBP A;  3V0P A;  1FRW A;  1HM8 A;  1Z90 A;  2YC3 A;  4B42 A;  3NGW A;  4ARW A;  2FYA A;  2YQC A;  5BXC A;  1NQI B;  1WT0 A;  3T7N A;  3CGX A;  1S4O A;  2AGD A;  1LZ0 A;  2Y4M A;  4KRV A;  5C3B A;  2AH9 A;  2BO4 A;  3TQD A;  3I0D A;  4HG6 A;  3N9W A;  5D92 A;  2VD4 A;  1ZI1 A;  3ZLL A;  3I0J A;  5CQM X;  4CJC A;  4HCQ A;  4D11 A;  1GQ9 A;  4KC4 A;  1K4V A;  2QKX A;  1ZCV A;  2FY7 A;  4FRQ A;  3SX5 A;  1H5S C;  1MC3 A;  2BO6 A;  1FWY A;  4HO3 A;  1R7V A;  1FZW A;  2Y4J A;  3BCV A;  3DK5 A;  3I0L A;  2NXV A;  1S4P A;  4G3S A;  5CMH A;  4Y7G A;  2O1F A;  2V0I A;  3USQ A;  5EJ1 A;  2XWN A;  3U2X A;  3U2V A;  1H7L A;  1LVW A;  5C38 A;  1WT3 A;  5C4D A;  4LW3 A;  1ZI5 A;  1H7T A;  2AE7 A;  1HJL A;  3GUE A;  5DDT A;  1QG8 A;  4FQW A;  3JUJ A;  2RIZ A;  1H4C A;  1G9R A;  5C3D A;  1JYK A;  2XWM A;  4D11 C;  2Z86 A;  2ZU8 A;  4FRM A;  5C4E A;  3RSB A;  2ICX A;  2WAW A;  4B4G A;  2X65 A;  5AJP A;  2WGZ A;  1GX4 A;  4FRB A;  1G95 A;  4FRE A;  4Y64 A;  4FRA A;  5FYE A;  3I0G A;  3CKO A;  3EE5 A;  5C1G A;  3D8V A;  4Y7F A;  1ZCT A;  3ZGF A;  1MP3 A;  1ZI4 A;  3R3I A;  4CJB A;  5C49 A;  3DUV A;  1R7T A;  3SXG A;  1V84 A;  2GGO A;  4HO6 A;  4KNX A;  3JUK A;  1WT2 A;  1JYL A;  2AM4 A;  1QGQ A;  3CKJ A;  2ICY A;  5C48 A;  3U0X A;  4MIX A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...