1R7TA

Glycosyltransferase a in complex with 3-deoxy-acceptor analog inhibitor
Total Genus 84
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
84
sequence length
283
structure length
263
Chain Sequence
MVSLPRMVYPQPKVLTPCRKDVLVVTPWLAPIVWEGTFNIDILNEQFRLQNTTIGLTVFAIKKYVAFLKLFLETAEKHFMVGHRVHYYVFTDQPAAVPRVTLGTGRQLSVLEVCERRFLSEVDYLVCVDVDMEFRDHVGVEILTPLFGTLHPGFYGSSREAFTYERRPQSQAYIPKDEGDFYYLGGFFGGSVQEVQRLTRACHQAMMVDQANGIEAVWHDESHLNKYLLRHKPTKVLSPEYLWDQQLLGWPAVLRKLRFTAVP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The influence of an intramolecular hydrogen bond in differential recognition of inhibitory acceptor analogs by human ABO(H) blood group A and B glycosyltransferases
pubmed doi rcsb
molecule keywords Glycoprotein-fucosylgalactoside alpha-N-acetylgalactosaminyl
molecule tags Transferase
source organism Homo sapiens
total genus 84
structure length 263
sequence length 283
ec nomenclature ec 2.4.1.37: Fucosylgalactoside 3-alpha-galactosyltransferase.
pdb deposition date 2003-10-22
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.550.10 Alpha Beta Alpha-Beta Complex Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A 1r7tA00
1GX0A 4ASYA 4ARWA 1EYRA 2APCA 3OH1A 3GUEA 5C1GA 3PKQA 3I0LA 2AE7A 3OH0A 1G23A 4KRVA 1LL2A 3POLA 1O23B 1QG8A 3CU0A 1QGSA 1TW1A 5C4BA 1ZJPA 2V0JA 5JQQA 1H7GA 3I0DA 1VH1A 2RJ7A 2OEFA 2UX8A 1WT1A 4KXOA 1G93A 4R7PA 1G9RA 2ICXA 4EEMA 3SXBA 3K8EA 1MP5A 4CJ8A 3ST8A 1ZCYA 2OI5A 5C1HA 3T7NA 4Y6UA 4EEGA 2YCMA 2ZU8A 1E5KA 1YROB 2DPWA 1R82A 1TW5A 2VFZA 2Y4MA 5EIYA 3T7MA 1OQMB 1FR8A 3DJ4A 5FV9A 4G3PA 1ZIZA 2FYBA 2JCJA 1HJLA 3JUJA 3SX7A 4EEOA 2QH5A 5CMJA 1ZI4A 4FRAA 2ZU7A 3I0CA 3V8YA 2RIXA 2D7IA 2X60A 4NAKA 1H5SA 3ZGGA 5CQMX 1NQIB 2O1FA 4FCUA 2YC3A 4IRQA 1ZDFA 2Y4JA 5C4DA 3OKRA 3E25A 3Q7UA 1FR9A 2VSHA 2X5SA 4HO9A 5AJNA 1ZI1A 2WEEA 4B42A 4D11A 2RJ6A 2VS4A 3HL3A 4MYBA 1GX4A 4AAWA 2WE9A 1FOAA 5C3AA 4KT7A 1WT3A 1INIA 4KQLA 4J18A 4M2BA 2Y7AA 1MP4A 4CJBA 4DECA 1FRWA 3SXEA 2YQSA 3JTJA 1H7TA 4LW3A 4XWIA 4M2AA 4AYLA 1H7HA 3I0HA 1MP3A 2D7RA 3U0YA 4FRLA 5C49A 5L6VA 1NHEB 3D8VA 4KNXA 2YESA 1W57A 1R7YA 3F1YA 4B2XA 5IFYA 2X5ZA 3ZGFA 3FWWA 2W0WA 5C48A 1TVYA 3E26A 3OH4A 3U2VA 2QGIA 2NXVA 3V90A 2XWMA 2AH9A 3DUVA 4MNDA 1H7LA 1LZJA 1FWYA 1I52A 2YQJA 4G87A 2RJ0A 4IRPA 3IOJA 3NGWA 3USQA 2WVMA 1O0RA 1W77A 2RITA 1PZYB 4L41C 4M28A 1EZIA 1H5RA 1LVWA 2A8WA 4G3QA 2YC5A 4Y6NA 5J49A 3I0KA 4Y7FA 5AJOA 4B2WA 2AM5A 1ON8A 1QGQA 4KPZA 3U2WA 4D11C 2A8UA 5CQLX 5DDTA 5C4CA 4FRPA 4NANA 3ZF8A 4B4GA 4D0TA 2ICYA 1S4NA 3CKNA 5DDVA 4EEAA 2CU2A 5C47A 4EE4A 1H4CA 3EE5A 4HO8A 1O7OA 2AM4A 1H5SD 1R7VA 1ZJ1A 2V0HA 1VGZA 2VXLA 4FROA 2I5KA 4BQHA 5FUHA 1VGTA 1G1LA 2WAWA 1ZJ0A 2ZU9A 3RSBA 5FU8A 3CKOA 3OGZA 1LZ0A 3SPTA 3V0OA 4NAIA 4HOCA 2Y4KA 3F1CA 1ZI5A 3CKJA 1H5SB 3OC9A 4FREA 3V0LA 4FRBA 1TZFA 1ZCVA 1FZWA 1S4OA 4M4KA 3SX3A 3T7OA 4DE7A 1H4DA 1YP2A 5CMGX 1VGUA 2FFUA 4HO6A 4EE3A 4Y64A 2WVKA 1S4PA 2RJ9A 1G3LA 1GWWA 4P00A 2BO6A 1GQ9A 2GGOA 4FRHA 1ZJ2A 1XHBA 2Q4JA 2VD4A 3U2TA 3R3IA 4HO5A 3TZTA 3OH2A 1ZCUA 4Y7TA 3JUKA 2AM3A 4D0ZA 2RIZA 2RJ5A 1K4VA 2RIYA 3ZLLA 2GGQA 1JYLA 5FTVA 3V0NA 2OEGA 1W55A 5FTSA 5CQPA 1LL3A 2YQCA 3V0PA 1R7TA 1WSZA 1WT0A 3Q4SA 1H5TB 3QVBA 4B4BA 4JISA 1FO8A 1GWVA 1FXJA 1VZTA 2XMHA 5FYEA 1JV1A 3V91A 4HO3A 4FQWA 3I0GA 1VGWA 3SX5A 1VH3A 1R80A 1FGXA 4KC4A 4CVHA 2I5EA 1GA8A 4FRMA 1GQCA 3D98A 2Z87A 2VS5A 2RJ1A 2OI6A 3U0XA 3V0QA 2W0VA 3I0EA 3D5NA 3O3PA 2P6WA 3ZLKA 5BXCA 4CJCA 2XWLA 2PGVA 2AESA 3V0MA 4P02A 2XMEA 3CKQA 2WGZA 1Z90A 2YQHA 1R7UA 4K6RA 1FXOA 1OMZA 4Y7GA 1NWGB 2O1GA 1ZHJA 4FCEA 4DDZA 5L6SA 5C1LA 4B3UA 1OMXA 2PX7A 4NALA 1HV9A 2BO4A 1G0RA 2V0LA 1H7EA 2V0KA 4BMAA 3Q80A 2QKXA 4FRQA 5FU0A 2BO7A 3SX8A 1VZUA 1LZ7A 4HO2A 4YS8A 3SXGA 4G3SA 2AGDA 2Z86A 1ON6A 4Y63A 5IDSA 5CQNX 1V83A 3LW6A 2RJ4A 1WT2A 1LZIA 3IOIA 2JCLA 3PNNA 2V0IA 2BO8A 1NMMB 2FFVA 5C38A 3DK5A 1FO9A 1ZI3A 1FG5N 1H4EA 4GBPA 3I0JA 5CMIA 1INJA 1R7XA 1H7FA 4LW6A 1V84A 3V8ZA 2JCOA 4ASJA 4EE5A 1FGGA 2FYAA 4EVWA 4FRDA 4KC1A 4B5BA 5C36A 5C3DA 3TQDA 4JD0A 2VXMA 3BCVA 2I7BA 5C4EA 1HJJA 1NF5B 4C2SA 2X65A 3U2XA 4E1KA 1PZTA 3OH3A 3R2WA 2VSIA 2RJ8A 1ZCTA 3CGXA 2E8BA 3U2UA 2PA4A 4Y7VA 4D48A 1IINA 1XZ6A 5CMHA 4ECMA 2P72A 5C4FA 1G95A 3K8DA 3KIAA 2XWNA 1G97A 1QWJA 1JV3A 2WVLA 3USRA 5AJPA 2FYDB 4HG6A 1KWSA 4KC2A 1V82A 4AC3A 5C8RA 5CQOA 1YP3A 1ZJOA 1JYKA 3FOQA 3SXCA 1G8OA 3RMWA 4Y7UA 2JCKA 4HO0A 1O7QA 4KPXA 3I0IX 5C3BA 1H3MA 1HM9A 1VICA 5EJZA 4AYJA 1JVGA 2PGYA 3PKPA 4UEGA 2FYCB 1JVDA 2O1HA 5EJ1A 1H5TA 1SS9A 1VPAA 3N9WA 3I0FA 2OI7A 1VZXA 1R81A 1YP4A 2Y6PA 4HCQA 4Y9XA 3CKVA 1G2VA 3OAMA 1H7QA 1IIMA 2VS3A 3SXAA 1HM0A 1ZJ3A 3BRKX 5IDTA 1MC3A 3IOHA 4ZDQA 2D0JA 2AECA 3RMVA 5CMFX 2FY7A 1WVCA 4KNRA 1ZDGA 4B4MA 1H5RB 2E3DA 1HM8A 4HO4A 2P73A 2Y4LA 4Y62A 3SXDA 1H5SC 1LL0A 1VM8A 5I1FA 5HS2A 2MZBA 1NKHB
chains in the Genus database with same CATH superfamily
1GX0A 4ASYA 4ARWA 1EYRA 2APCA 3OH1A 3GUEA 5C1GA 3PKQA 3I0LA 2AE7A 3OH0A 1G23A 4KRVA 1LL2A 3POLA 1O23B 1QG8A 3CU0A 1QGSA 1TW1A 5C4BA 1ZJPA 2V0JA 5JQQA 1H7GA 3I0DA 1VH1A 2RJ7A 2OEFA 2UX8A 1WT1A 4KXOA 1G93A 4R7PA 1G9RA 2ICXA 4EEMA 3SXBA 3K8EA 1MP5A 4CJ8A 3ST8A 1ZCYA 2OI5A 5C1HA 3T7NA 4Y6UA 4EEGA 2YCMA 2ZU8A 1E5KA 1YROB 2DPWA 1R82A 1TW5A 2VFZA 2Y4MA 5EIYA 3T7MA 1OQMB 1FR8A 3DJ4A 5FV9A 4G3PA 1ZIZA 2FYBA 2JCJA 1HJLA 3JUJA 3SX7A 4EEOA 2QH5A 5CMJA 1ZI4A 4FRAA 2ZU7A 3I0CA 3V8YA 2RIXA 2D7IA 2X60A 4NAKA 1H5SA 3ZGGA 5CQMX 1NQIB 2O1FA 4FCUA 2YC3A 4IRQA 1ZDFA 2Y4JA 5C4DA 3OKRA 3E25A 3Q7UA 1FR9A 2VSHA 2X5SA 4HO9A 5AJNA 1ZI1A 2WEEA 4B42A 4D11A 2RJ6A 2VS4A 3HL3A 4MYBA 1GX4A 4AAWA 2WE9A 1FOAA 5C3AA 4KT7A 1WT3A 1INIA 4KQLA 4J18A 4M2BA 2Y7AA 1MP4A 4O6MA 4CJBA 4DECA 1FRWA 3SXEA 2YQSA 3JTJA 1H7TA 4LW3A 4XWIA 4M2AA 4AYLA 1H7HA 3I0HA 1MP3A 2D7RA 3U0YA 4FRLA 5C49A 5L6VA 1NHEB 3D8VA 4KNXA 2YESA 1W57A 1R7YA 3F1YA 4B2XA 5IFYA 2X5ZA 2J0AA 3ZGFA 3FWWA 2W0WA 5D91A 5C48A 1TVYA 3E26A 3OH4A 3U2VA 2QGIA 2NXVA 3V90A 2XWMA 2AH9A 3DUVA 4MNDA 1H7LA 1LZJA 1FWYA 1I52A 2YQJA 4G87A 2RJ0A 4IRPA 3IOJA 3NGWA 3USQA 2WVMA 1O0RA 1W77A 2RITA 1PZYB 4L41C 4M28A 1EZIA 1H5RA 1LVWA 2A8WA 4G3QA 2YC5A 4Y6NA 5J49A 3I0KA 4Y7FA 5AJOA 4B2WA 2AM5A 1ON8A 1QGQA 4KPZA 3U2WA 4O6NA 4D11C 2A8UA 5CQLX 5DDTA 5C4CA 4FRPA 4NANA 3ZF8A 4B4GA 4D0TA 4FIXA 2ICYA 1S4NA 3CKNA 5DDVA 4EEAA 2CU2A 5C47A 4EE4A 1H4CA 3EE5A 4HO8A 1O7OA 2AM4A 1H5SD 1R7VA 1ZJ1A 2V0HA 1VGZA 2VXLA 4FROA 2I5KA 4BQHA 5FUHA 1VGTA 1G1LA 2WAWA 1ZJ0A 2ZU9A 3RSBA 5FU8A 3CKOA 3OGZA 1LZ0A 3SPTA 3V0OA 4NAIA 4HOCA 2Y4KA 3F1CA 1ZI5A 3CKJA 1H5SB 3OC9A 4FREA 3V0LA 4FRBA 1TZFA 1ZCVA 1FZWA 1S4OA 4M4KA 3SX3A 3T7OA 4DE7A 1H4DA 1YP2A 5CMGX 1VGUA 2FFUA 4HO6A 4EE3A 4Y64A 2WVKA 1S4PA 2RJ9A 1G3LA 1GWWA 4P00A 2BO6A 1GQ9A 2GGOA 4FRHA 1ZJ2A 1XHBA 2Q4JA 2VD4A 3U2TA 3R3IA 4HO5A 3TZTA 3OH2A 1ZCUA 4Y7TA 3JUKA 2AM3A 4D0ZA 2RIZA 2RJ5A 1K4VA 2RIYA 3ZLLA 2GGQA 1JYLA 5FTVA 3V0NA 2OEGA 1W55A 5FTSA 5CQPA 1LL3A 2YQCA 3V0PA 1R7TA 1WSZA 1WT0A 3Q4SA 1H5TB 3QVBA 4B4BA 4JISA 1FO8A 5D92A 1GWVA 1FXJA 4MIXA 1VZTA 2XMHA 5FYEA 1JV1A 3V91A 4HO3A 4FQWA 3I0GA 1VGWA 3SX5A 1VH3A 1R80A 1FGXA 4KC4A 4CVHA 2I5EA 1GA8A 4FIYA 4FRMA 1GQCA 3D98A 2Z87A 2VS5A 2RJ1A 2OI6A 3U0XA 3V0QA 2W0VA 3I0EA 3D5NA 3O3PA 2P6WA 3ZLKA 5BXCA 4CJCA 2XWLA 2PGVA 2AESA 3V0MA 4P02A 2XMEA 3CKQA 2WGZA 1Z90A 2YQHA 1R7UA 4K6RA 1FXOA 1OMZA 4Y7GA 1NWGB 2O1GA 1ZHJA 4FCEA 4DDZA 5L6SA 5C1LA 4B3UA 1OMXA 2PX7A 4NALA 1HV9A 2BO4A 1G0RA 2V0LA 1H7EA 2V0KA 4BMAA 3Q80A 2C0NA 2QKXA 4FRQA 5FU0A 2BO7A 3SX8A 1VZUA 1LZ7A 4HO2A 4YS8A 3SXGA 4G3SA 2AGDA 2Z86A 1ON6A 4Y63A 5IDSA 5CQNX 1V83A 3LW6A 2RJ4A 1WT2A 1LZIA 3IOIA 2JCLA 3PNNA 2V0IA 2BO8A 1NMMB 2FFVA 5C38A 3DK5A 1FO9A 1ZI3A 1FG5N 1H4EA 4GBPA 3I0JA 5CMIA 1INJA 1R7XA 1H7FA 4LW6A 1V84A 3V8ZA 2JCOA 4ASJA 4EE5A 1FGGA 2FYAA 4EVWA 4FRDA 4KC1A 4B5BA 5C36A 5C3DA 3TQDA 4JD0A 2VXMA 3BCVA 2I7BA 5C4EA 1HJJA 1NF5B 4C2SA 2X65A 3U2XA 4E1KA 1PZTA 3OH3A 3R2WA 2VSIA 2RJ8A 1ZCTA 3CGXA 2E8BA 3U2UA 2PA4A 4Y7VA 4D48A 1IINA 1XZ6A 2J0BA 5CMHA 4ECMA 2P72A 5C4FA 1G95A 3K8DA 3KIAA 2XWNA 1G97A 1QWJA 1JV3A 2WVLA 3USRA 5AJPA 2FYDB 4HG6A 1KWSA 4KC2A 1V82A 4AC3A 5C8RA 5CQOA 1YP3A 1ZJOA 1JYKA 3FOQA 4Q7CA 3SXCA 1G8OA 3RMWA 4Y7UA 2JCKA 4HO0A 1O7QA 4KPXA 3I0IX 5C3BA 1H3MA 1HM9A 1VICA 5EJZA 4AYJA 1JVGA 2PGYA 3PKPA 4UEGA 2FYCB 1JVDA 2O1HA 5EJ1A 1H5TA 1SS9A 1VPAA 3N9WA 3I0FA 2OI7A 1VZXA 1R81A 1YP4A 2Y6PA 4HCQA 4Y9XA 3CKVA 1G2VA 3OAMA 1H7QA 1IIMA 2VS3A 3SXAA 1HM0A 1ZJ3A 3BRKX 5IDTA 1MC3A 3IOHA 4ZDQA 2D0JA 2AECA 3RMVA 5CMFX 2FY7A 1WVCA 4KNRA 1ZDGA 4B4MA 1H5RB 2E3DA 1HM8A 4HO4A 2VK9A 2P73A 2Y4LA 4Y62A 3SXDA 1H5SC 1LL0A 1VM8A 5I1FA 5HS2A 2MZBA 1NKHB
chains in the Genus database with same CATH topology
1GX0A 4ASYA 4ARWA 1EYRA 2APCA 3OH1A 3GUEA 5C1GA 3PKQA 3I0LA 2AE7A 3OH0A 1G23A 4KRVA 1LL2A 3POLA 1O23B 1QG8A 3CU0A 1QGSA 1TW1A 5C4BA 1ZJPA 2V0JA 5JQQA 1H7GA 3I0DA 1VH1A 2RJ7A 2OEFA 2UX8A 1WT1A 4KXOA 1G93A 4R7PA 1G9RA 2ICXA 4EEMA 3SXBA 3K8EA 1MP5A 4CJ8A 3ST8A 1ZCYA 2OI5A 5C1HA 3T7NA 4Y6UA 4EEGA 2YCMA 2ZU8A 1E5KA 1YROB 2DPWA 1R82A 1TW5A 2VFZA 2Y4MA 5EIYA 3T7MA 1OQMB 1FR8A 3DJ4A 5FV9A 4G3PA 1ZIZA 2FYBA 2JCJA 1HJLA 3JUJA 3SX7A 4EEOA 2QH5A 5CMJA 1ZI4A 4FRAA 2ZU7A 3I0CA 3V8YA 2RIXA 2D7IA 2X60A 4NAKA 1H5SA 3ZGGA 5CQMX 1NQIB 2O1FA 4FCUA 2YC3A 4IRQA 1ZDFA 2Y4JA 5C4DA 3OKRA 3E25A 3Q7UA 1FR9A 2VSHA 2X5SA 4HO9A 5AJNA 1ZI1A 2WEEA 4B42A 4D11A 2RJ6A 2VS4A 3HL3A 4MYBA 1GX4A 4AAWA 2WE9A 1FOAA 5C3AA 4KT7A 1WT3A 1INIA 4KQLA 4J18A 4M2BA 2Y7AA 1MP4A 4O6MA 4CJBA 4DECA 1FRWA 3SXEA 2YQSA 3JTJA 1H7TA 4LW3A 4XWIA 4M2AA 4AYLA 1H7HA 3I0HA 1MP3A 2D7RA 3U0YA 4FRLA 5C49A 5L6VA 1NHEB 3D8VA 4KNXA 2YESA 1W57A 1R7YA 3F1YA 4B2XA 5IFYA 2X5ZA 2J0AA 3ZGFA 3FWWA 2W0WA 5D91A 5C48A 1TVYA 3E26A 3OH4A 3U2VA 2QGIA 2NXVA 3V90A 2XWMA 2AH9A 3DUVA 4MNDA 1H7LA 1LZJA 1FWYA 1I52A 2YQJA 4G87A 2RJ0A 4IRPA 3IOJA 3NGWA 3USQA 2WVMA 1O0RA 1W77A 2RITA 1PZYB 4L41C 4M28A 1EZIA 1H5RA 1LVWA 2A8WA 4G3QA 2YC5A 4Y6NA 5J49A 3I0KA 4Y7FA 5AJOA 4B2WA 2AM5A 1ON8A 1QGQA 4KPZA 3U2WA 4O6NA 4D11C 2A8UA 5CQLX 5DDTA 5C4CA 4FRPA 4NANA 3ZF8A 4B4GA 4D0TA 4FIXA 2ICYA 1S4NA 3CKNA 5DDVA 4EEAA 2CU2A 5C47A 4EE4A 1H4CA 3EE5A 4HO8A 1O7OA 2AM4A 1H5SD 1R7VA 1ZJ1A 2V0HA 1VGZA 2VXLA 4FROA 2I5KA 4BQHA 5FUHA 1VGTA 1G1LA 2WAWA 1ZJ0A 2ZU9A 3RSBA 5FU8A 3CKOA 3OGZA 1LZ0A 3SPTA 3V0OA 4NAIA 4HOCA 2Y4KA 3F1CA 1ZI5A 3CKJA 1H5SB 3OC9A 4FREA 3V0LA 4FRBA 1TZFA 1ZCVA 1FZWA 1S4OA 4M4KA 3SX3A 3T7OA 4DE7A 1H4DA 1YP2A 5CMGX 1VGUA 2FFUA 4HO6A 4EE3A 4Y64A 2WVKA 1S4PA 2RJ9A 1G3LA 1GWWA 4P00A 2BO6A 1GQ9A 2GGOA 4FRHA 1ZJ2A 1XHBA 2Q4JA 2VD4A 3U2TA 3R3IA 4HO5A 3TZTA 3OH2A 1ZCUA 4Y7TA 3JUKA 2AM3A 4D0ZA 2RIZA 2RJ5A 1K4VA 2RIYA 3ZLLA 2GGQA 1JYLA 5FTVA 3V0NA 2OEGA 1W55A 5FTSA 5CQPA 1LL3A 2YQCA 3V0PA 1R7TA 1WSZA 1WT0A 3Q4SA 1H5TB 3QVBA 4B4BA 4JISA 1FO8A 5D92A 1GWVA 1FXJA 4MIXA 1VZTA 2XMHA 5FYEA 1JV1A 3V91A 4HO3A 4FQWA 3I0GA 1VGWA 3SX5A 1VH3A 1R80A 1FGXA 4KC4A 4CVHA 2I5EA 1GA8A 4FIYA 4FRMA 1GQCA 3D98A 2Z87A 2VS5A 2RJ1A 2OI6A 3U0XA 3V0QA 2W0VA 3I0EA 3D5NA 3O3PA 2P6WA 3ZLKA 5BXCA 4CJCA 2XWLA 2PGVA 2AESA 3V0MA 4P02A 2XMEA 3CKQA 2WGZA 1Z90A 2YQHA 1R7UA 4K6RA 1FXOA 1OMZA 4Y7GA 1NWGB 2O1GA 1ZHJA 4FCEA 4DDZA 5L6SA 5C1LA 4B3UA 1OMXA 2PX7A 4NALA 1HV9A 2BO4A 1G0RA 2V0LA 1H7EA 2V0KA 4BMAA 3Q80A 2C0NA 2QKXA 4FRQA 5FU0A 2BO7A 3SX8A 1VZUA 1LZ7A 4HO2A 4YS8A 3SXGA 4G3SA 2AGDA 2Z86A 1ON6A 4Y63A 5IDSA 5CQNX 1V83A 3LW6A 2RJ4A 1WT2A 1LZIA 3IOIA 2JCLA 3PNNA 2V0IA 2BO8A 1NMMB 2FFVA 5C38A 3DK5A 1FO9A 1ZI3A 1FG5N 1H4EA 4GBPA 3I0JA 5CMIA 1INJA 1R7XA 1H7FA 4LW6A 1V84A 3V8ZA 2JCOA 4ASJA 4EE5A 1FGGA 2FYAA 4EVWA 4FRDA 4KC1A 4B5BA 5C36A 5C3DA 3TQDA 4JD0A 2VXMA 3BCVA 2I7BA 5C4EA 1HJJA 1NF5B 4C2SA 2X65A 3U2XA 4E1KA 1PZTA 3OH3A 3R2WA 2VSIA 2RJ8A 1ZCTA 3CGXA 2E8BA 3U2UA 2PA4A 4Y7VA 4D48A 1IINA 1XZ6A 2J0BA 5CMHA 4ECMA 2P72A 5C4FA 1G95A 3K8DA 3KIAA 2XWNA 1G97A 1QWJA 1JV3A 2WVLA 3USRA 5AJPA 2FYDB 4HG6A 1KWSA 4KC2A 1V82A 4AC3A 5C8RA 5CQOA 1YP3A 1ZJOA 1JYKA 3FOQA 4Q7CA 3SXCA 1G8OA 3RMWA 4Y7UA 2JCKA 4HO0A 1O7QA 4KPXA 3I0IX 5C3BA 1H3MA 1HM9A 1VICA 5EJZA 4AYJA 1JVGA 2PGYA 3PKPA 4UEGA 2FYCB 1JVDA 2O1HA 5EJ1A 1H5TA 1SS9A 1VPAA 3N9WA 3I0FA 2OI7A 1VZXA 1R81A 1YP4A 2Y6PA 4HCQA 4Y9XA 3CKVA 1G2VA 3OAMA 1H7QA 1IIMA 2VS3A 3SXAA 1HM0A 1ZJ3A 3BRKX 5IDTA 1MC3A 3IOHA 4ZDQA 2D0JA 2AECA 3RMVA 5CMFX 2FY7A 1WVCA 4KNRA 1ZDGA 4B4MA 1H5RB 2E3DA 1HM8A 4HO4A 2VK9A 2P73A 2Y4LA 4Y62A 3SXDA 1H5SC 1LL0A 1VM8A 5I1FA 5HS2A 2MZBA 1NKHB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1GX0 A;  4ASY A;  4ARW A;  1EYR A;  2APC A;  3OH1 A;  3GUE A;  5C1G A;  3PKQ A;  3I0L A;  2AE7 A;  3OH0 A;  1G23 A;  4KRV A;  1LL2 A;  3POL A;  1O23 B;  1QG8 A;  3CU0 A;  1QGS A;  1TW1 A;  5C4B A;  1ZJP A;  2V0J A;  5JQQ A;  1H7G A;  3I0D A;  1VH1 A;  2RJ7 A;  2OEF A;  2UX8 A;  1WT1 A;  4KXO A;  1G93 A;  4R7P A;  1G9R A;  2ICX A;  4EEM A;  3SXB A;  3K8E A;  1MP5 A;  4CJ8 A;  3ST8 A;  1ZCY A;  2OI5 A;  5C1H A;  3T7N A;  4Y6U A;  4EEG A;  2YCM A;  2ZU8 A;  1E5K A;  1YRO B;  2DPW A;  1R82 A;  1TW5 A;  2VFZ A;  2Y4M A;  5EIY A;  3T7M A;  1OQM B;  1FR8 A;  3DJ4 A;  5FV9 A;  4G3P A;  1ZIZ A;  2FYB A;  2JCJ A;  1HJL A;  3JUJ A;  3SX7 A;  4EEO A;  2QH5 A;  5CMJ A;  1ZI4 A;  4FRA A;  2ZU7 A;  3I0C A;  3V8Y A;  2RIX A;  2D7I A;  2X60 A;  4NAK A;  1H5S A;  3ZGG A;  5CQM X;  1NQI B;  2O1F A;  4FCU A;  2YC3 A;  4IRQ A;  1ZDF A;  2Y4J A;  5C4D A;  3OKR A;  3E25 A;  3Q7U A;  1FR9 A;  2VSH A;  2X5S A;  4HO9 A;  5AJN A;  1ZI1 A;  2WEE A;  4B42 A;  4D11 A;  2RJ6 A;  2VS4 A;  3HL3 A;  4MYB A;  1GX4 A;  4AAW A;  2WE9 A;  1FOA A;  5C3A A;  4KT7 A;  1WT3 A;  1INI A;  4KQL A;  4J18 A;  4M2B A;  2Y7A A;  1MP4 A;  4CJB A;  4DEC A;  1FRW A;  3SXE A;  2YQS A;  3JTJ A;  1H7T A;  4LW3 A;  4XWI A;  4M2A A;  4AYL A;  1H7H A;  3I0H A;  1MP3 A;  2D7R A;  3U0Y A;  4FRL A;  5C49 A;  5L6V A;  1NHE B;  3D8V A;  4KNX A;  2YES A;  1W57 A;  1R7Y A;  3F1Y A;  4B2X A;  5IFY A;  2X5Z A;  3ZGF A;  3FWW A;  2W0W A;  5C48 A;  1TVY A;  3E26 A;  3OH4 A;  3U2V A;  2QGI A;  2NXV A;  3V90 A;  2XWM A;  2AH9 A;  3DUV A;  4MND A;  1H7L A;  1LZJ A;  1FWY A;  1I52 A;  2YQJ A;  4G87 A;  2RJ0 A;  4IRP A;  3IOJ A;  3NGW A;  3USQ A;  2WVM A;  1O0R A;  1W77 A;  2RIT A;  1PZY B;  4L41 C;  4M28 A;  1EZI A;  1H5R A;  1LVW A;  2A8W A;  4G3Q A;  2YC5 A;  4Y6N A;  5J49 A;  3I0K A;  4Y7F A;  5AJO A;  4B2W A;  2AM5 A;  1ON8 A;  1QGQ A;  4KPZ A;  3U2W A;  4D11 C;  2A8U A;  5CQL X;  5DDT A;  5C4C A;  4FRP A;  4NAN A;  3ZF8 A;  4B4G A;  4D0T A;  2ICY A;  1S4N A;  3CKN A;  5DDV A;  4EEA A;  2CU2 A;  5C47 A;  4EE4 A;  1H4C A;  3EE5 A;  4HO8 A;  1O7O A;  2AM4 A;  1H5S D;  1R7V A;  1ZJ1 A;  2V0H A;  1VGZ A;  2VXL A;  4FRO A;  2I5K A;  4BQH A;  5FUH A;  1VGT A;  1G1L A;  2WAW A;  1ZJ0 A;  2ZU9 A;  3RSB A;  5FU8 A;  3CKO A;  3OGZ A;  1LZ0 A;  3SPT A;  3V0O A;  4NAI A;  4HOC A;  2Y4K A;  3F1C A;  1ZI5 A;  3CKJ A;  1H5S B;  3OC9 A;  4FRE A;  3V0L A;  4FRB A;  1TZF A;  1ZCV A;  1FZW A;  1S4O A;  4M4K A;  3SX3 A;  3T7O A;  4DE7 A;  1H4D A;  1YP2 A;  5CMG X;  1VGU A;  2FFU A;  4HO6 A;  4EE3 A;  4Y64 A;  2WVK A;  1S4P A;  2RJ9 A;  1G3L A;  1GWW A;  4P00 A;  2BO6 A;  1GQ9 A;  2GGO A;  4FRH A;  1ZJ2 A;  1XHB A;  2Q4J A;  2VD4 A;  3U2T A;  3R3I A;  4HO5 A;  3TZT A;  3OH2 A;  1ZCU A;  4Y7T A;  3JUK A;  2AM3 A;  4D0Z A;  2RIZ A;  2RJ5 A;  1K4V A;  2RIY A;  3ZLL A;  2GGQ A;  1JYL A;  5FTV A;  3V0N A;  2OEG A;  1W55 A;  5FTS A;  5CQP A;  1LL3 A;  2YQC A;  3V0P A;  1R7T A;  1WSZ A;  1WT0 A;  3Q4S A;  1H5T B;  3QVB A;  4B4B A;  4JIS A;  1FO8 A;  1GWV A;  1FXJ A;  1VZT A;  2XMH A;  5FYE A;  1JV1 A;  3V91 A;  4HO3 A;  4FQW A;  3I0G A;  1VGW A;  3SX5 A;  1VH3 A;  1R80 A;  1FGX A;  4KC4 A;  4CVH A;  2I5E A;  1GA8 A;  4FRM A;  1GQC A;  3D98 A;  2Z87 A;  2VS5 A;  2RJ1 A;  2OI6 A;  3U0X A;  3V0Q A;  2W0V A;  3I0E A;  3D5N A;  3O3P A;  2P6W A;  3ZLK A;  5BXC A;  4CJC A;  2XWL A;  2PGV A;  2AES A;  3V0M A;  4P02 A;  2XME A;  3CKQ A;  2WGZ A;  1Z90 A;  2YQH A;  1R7U A;  4K6R A;  1FXO A;  1OMZ A;  4Y7G A;  1NWG B;  2O1G A;  1ZHJ A;  4FCE A;  4DDZ A;  5L6S A;  5C1L A;  4B3U A;  1OMX A;  2PX7 A;  4NAL A;  1HV9 A;  2BO4 A;  1G0R A;  2V0L A;  1H7E A;  2V0K A;  4BMA A;  3Q80 A;  2QKX A;  4FRQ A;  5FU0 A;  2BO7 A;  3SX8 A;  1VZU A;  1LZ7 A;  4HO2 A;  4YS8 A;  3SXG A;  4G3S A;  2AGD A;  2Z86 A;  1ON6 A;  4Y63 A;  5IDS A;  5CQN X;  1V83 A;  3LW6 A;  2RJ4 A;  1WT2 A;  1LZI A;  3IOI A;  2JCL A;  3PNN A;  2V0I A;  2BO8 A;  1NMM B;  2FFV A;  5C38 A;  3DK5 A;  1FO9 A;  1ZI3 A;  1FG5 N;  1H4E A;  4GBP A;  3I0J A;  5CMI A;  1INJ A;  1R7X A;  1H7F A;  4LW6 A;  1V84 A;  3V8Z A;  2JCO A;  4ASJ A;  4EE5 A;  1FGG A;  2FYA A;  4EVW A;  4FRD A;  4KC1 A;  4B5B A;  5C36 A;  5C3D A;  3TQD A;  4JD0 A;  2VXM A;  3BCV A;  2I7B A;  5C4E A;  1HJJ A;  1NF5 B;  4C2S A;  2X65 A;  3U2X A;  4E1K A;  1PZT A;  3OH3 A;  3R2W A;  2VSI A;  2RJ8 A;  1ZCT A;  3CGX A;  2E8B A;  3U2U A;  2PA4 A;  4Y7V A;  4D48 A;  1IIN A;  1XZ6 A;  5CMH A;  4ECM A;  2P72 A;  5C4F A;  1G95 A;  3K8D A;  3KIA A;  2XWN A;  1G97 A;  1QWJ A;  1JV3 A;  2WVL A;  3USR A;  5AJP A;  2FYD B;  4HG6 A;  1KWS A;  4KC2 A;  1V82 A;  4AC3 A;  5C8R A;  5CQO A;  1YP3 A;  1ZJO A;  1JYK A;  3FOQ A;  3SXC A;  1G8O A;  3RMW A;  4Y7U A;  2JCK A;  4HO0 A;  1O7Q A;  4KPX A;  3I0I X;  5C3B A;  1H3M A;  1HM9 A;  1VIC A;  5EJZ A;  4AYJ A;  1JVG A;  2PGY A;  3PKP A;  4UEG A;  2FYC B;  1JVD A;  2O1H A;  5EJ1 A;  1H5T A;  1SS9 A;  1VPA A;  3N9W A;  3I0F A;  2OI7 A;  1VZX A;  1R81 A;  1YP4 A;  2Y6P A;  4HCQ A;  4Y9X A;  3CKV A;  1G2V A;  3OAM A;  1H7Q A;  1IIM A;  2VS3 A;  3SXA A;  1HM0 A;  1ZJ3 A;  3BRK X;  5IDT A;  1MC3 A;  3IOH A;  4ZDQ A;  2D0J A;  2AEC A;  3RMV A;  5CMF X;  2FY7 A;  1WVC A;  4KNR A;  1ZDG A;  4B4M A;  1H5R B;  2E3D A;  1HM8 A;  4HO4 A;  2P73 A;  2Y4L A;  4Y62 A;  3SXD A;  1H5S C;  1LL0 A;  1VM8 A;  5I1F A;  5HS2 A;  2MZB A;  1NKH B; 
#chains in the Genus database with same CATH topology
 1GX0 A;  4ASY A;  4ARW A;  1EYR A;  2APC A;  3OH1 A;  3GUE A;  5C1G A;  3PKQ A;  3I0L A;  2AE7 A;  3OH0 A;  1G23 A;  4KRV A;  1LL2 A;  3POL A;  1O23 B;  1QG8 A;  3CU0 A;  1QGS A;  1TW1 A;  5C4B A;  1ZJP A;  2V0J A;  5JQQ A;  1H7G A;  3I0D A;  1VH1 A;  2RJ7 A;  2OEF A;  2UX8 A;  1WT1 A;  4KXO A;  1G93 A;  4R7P A;  1G9R A;  2ICX A;  4EEM A;  3SXB A;  3K8E A;  1MP5 A;  4CJ8 A;  3ST8 A;  1ZCY A;  2OI5 A;  5C1H A;  3T7N A;  4Y6U A;  4EEG A;  2YCM A;  2ZU8 A;  1E5K A;  1YRO B;  2DPW A;  1R82 A;  1TW5 A;  2VFZ A;  2Y4M A;  5EIY A;  3T7M A;  1OQM B;  1FR8 A;  3DJ4 A;  5FV9 A;  4G3P A;  1ZIZ A;  2FYB A;  2JCJ A;  1HJL A;  3JUJ A;  3SX7 A;  4EEO A;  2QH5 A;  5CMJ A;  1ZI4 A;  4FRA A;  2ZU7 A;  3I0C A;  3V8Y A;  2RIX A;  2D7I A;  2X60 A;  4NAK A;  1H5S A;  3ZGG A;  5CQM X;  1NQI B;  2O1F A;  4FCU A;  2YC3 A;  4IRQ A;  1ZDF A;  2Y4J A;  5C4D A;  3OKR A;  3E25 A;  3Q7U A;  1FR9 A;  2VSH A;  2X5S A;  4HO9 A;  5AJN A;  1ZI1 A;  2WEE A;  4B42 A;  4D11 A;  2RJ6 A;  2VS4 A;  3HL3 A;  4MYB A;  1GX4 A;  4AAW A;  2WE9 A;  1FOA A;  5C3A A;  4KT7 A;  1WT3 A;  1INI A;  4KQL A;  4J18 A;  4M2B A;  2Y7A A;  1MP4 A;  4O6M A;  4CJB A;  4DEC A;  1FRW A;  3SXE A;  2YQS A;  3JTJ A;  1H7T A;  4LW3 A;  4XWI A;  4M2A A;  4AYL A;  1H7H A;  3I0H A;  1MP3 A;  2D7R A;  3U0Y A;  4FRL A;  5C49 A;  5L6V A;  1NHE B;  3D8V A;  4KNX A;  2YES A;  1W57 A;  1R7Y A;  3F1Y A;  4B2X A;  5IFY A;  2X5Z A;  2J0A A;  3ZGF A;  3FWW A;  2W0W A;  5D91 A;  5C48 A;  1TVY A;  3E26 A;  3OH4 A;  3U2V A;  2QGI A;  2NXV A;  3V90 A;  2XWM A;  2AH9 A;  3DUV A;  4MND A;  1H7L A;  1LZJ A;  1FWY A;  1I52 A;  2YQJ A;  4G87 A;  2RJ0 A;  4IRP A;  3IOJ A;  3NGW A;  3USQ A;  2WVM A;  1O0R A;  1W77 A;  2RIT A;  1PZY B;  4L41 C;  4M28 A;  1EZI A;  1H5R A;  1LVW A;  2A8W A;  4G3Q A;  2YC5 A;  4Y6N A;  5J49 A;  3I0K A;  4Y7F A;  5AJO A;  4B2W A;  2AM5 A;  1ON8 A;  1QGQ A;  4KPZ A;  3U2W A;  4O6N A;  4D11 C;  2A8U A;  5CQL X;  5DDT A;  5C4C A;  4FRP A;  4NAN A;  3ZF8 A;  4B4G A;  4D0T A;  4FIX A;  2ICY A;  1S4N A;  3CKN A;  5DDV A;  4EEA A;  2CU2 A;  5C47 A;  4EE4 A;  1H4C A;  3EE5 A;  4HO8 A;  1O7O A;  2AM4 A;  1H5S D;  1R7V A;  1ZJ1 A;  2V0H A;  1VGZ A;  2VXL A;  4FRO A;  2I5K A;  4BQH A;  5FUH A;  1VGT A;  1G1L A;  2WAW A;  1ZJ0 A;  2ZU9 A;  3RSB A;  5FU8 A;  3CKO A;  3OGZ A;  1LZ0 A;  3SPT A;  3V0O A;  4NAI A;  4HOC A;  2Y4K A;  3F1C A;  1ZI5 A;  3CKJ A;  1H5S B;  3OC9 A;  4FRE A;  3V0L A;  4FRB A;  1TZF A;  1ZCV A;  1FZW A;  1S4O A;  4M4K A;  3SX3 A;  3T7O A;  4DE7 A;  1H4D A;  1YP2 A;  5CMG X;  1VGU A;  2FFU A;  4HO6 A;  4EE3 A;  4Y64 A;  2WVK A;  1S4P A;  2RJ9 A;  1G3L A;  1GWW A;  4P00 A;  2BO6 A;  1GQ9 A;  2GGO A;  4FRH A;  1ZJ2 A;  1XHB A;  2Q4J A;  2VD4 A;  3U2T A;  3R3I A;  4HO5 A;  3TZT A;  3OH2 A;  1ZCU A;  4Y7T A;  3JUK A;  2AM3 A;  4D0Z A;  2RIZ A;  2RJ5 A;  1K4V A;  2RIY A;  3ZLL A;  2GGQ A;  1JYL A;  5FTV A;  3V0N A;  2OEG A;  1W55 A;  5FTS A;  5CQP A;  1LL3 A;  2YQC A;  3V0P A;  1R7T A;  1WSZ A;  1WT0 A;  3Q4S A;  1H5T B;  3QVB A;  4B4B A;  4JIS A;  1FO8 A;  5D92 A;  1GWV A;  1FXJ A;  4MIX A;  1VZT A;  2XMH A;  5FYE A;  1JV1 A;  3V91 A;  4HO3 A;  4FQW A;  3I0G A;  1VGW A;  3SX5 A;  1VH3 A;  1R80 A;  1FGX A;  4KC4 A;  4CVH A;  2I5E A;  1GA8 A;  4FIY A;  4FRM A;  1GQC A;  3D98 A;  2Z87 A;  2VS5 A;  2RJ1 A;  2OI6 A;  3U0X A;  3V0Q A;  2W0V A;  3I0E A;  3D5N A;  3O3P A;  2P6W A;  3ZLK A;  5BXC A;  4CJC A;  2XWL A;  2PGV A;  2AES A;  3V0M A;  4P02 A;  2XME A;  3CKQ A;  2WGZ A;  1Z90 A;  2YQH A;  1R7U A;  4K6R A;  1FXO A;  1OMZ A;  4Y7G A;  1NWG B;  2O1G A;  1ZHJ A;  4FCE A;  4DDZ A;  5L6S A;  5C1L A;  4B3U A;  1OMX A;  2PX7 A;  4NAL A;  1HV9 A;  2BO4 A;  1G0R A;  2V0L A;  1H7E A;  2V0K A;  4BMA A;  3Q80 A;  2C0N A;  2QKX A;  4FRQ A;  5FU0 A;  2BO7 A;  3SX8 A;  1VZU A;  1LZ7 A;  4HO2 A;  4YS8 A;  3SXG A;  4G3S A;  2AGD A;  2Z86 A;  1ON6 A;  4Y63 A;  5IDS A;  5CQN X;  1V83 A;  3LW6 A;  2RJ4 A;  1WT2 A;  1LZI A;  3IOI A;  2JCL A;  3PNN A;  2V0I A;  2BO8 A;  1NMM B;  2FFV A;  5C38 A;  3DK5 A;  1FO9 A;  1ZI3 A;  1FG5 N;  1H4E A;  4GBP A;  3I0J A;  5CMI A;  1INJ A;  1R7X A;  1H7F A;  4LW6 A;  1V84 A;  3V8Z A;  2JCO A;  4ASJ A;  4EE5 A;  1FGG A;  2FYA A;  4EVW A;  4FRD A;  4KC1 A;  4B5B A;  5C36 A;  5C3D A;  3TQD A;  4JD0 A;  2VXM A;  3BCV A;  2I7B A;  5C4E A;  1HJJ A;  1NF5 B;  4C2S A;  2X65 A;  3U2X A;  4E1K A;  1PZT A;  3OH3 A;  3R2W A;  2VSI A;  2RJ8 A;  1ZCT A;  3CGX A;  2E8B A;  3U2U A;  2PA4 A;  4Y7V A;  4D48 A;  1IIN A;  1XZ6 A;  2J0B A;  5CMH A;  4ECM A;  2P72 A;  5C4F A;  1G95 A;  3K8D A;  3KIA A;  2XWN A;  1G97 A;  1QWJ A;  1JV3 A;  2WVL A;  3USR A;  5AJP A;  2FYD B;  4HG6 A;  1KWS A;  4KC2 A;  1V82 A;  4AC3 A;  5C8R A;  5CQO A;  1YP3 A;  1ZJO A;  1JYK A;  3FOQ A;  4Q7C A;  3SXC A;  1G8O A;  3RMW A;  4Y7U A;  2JCK A;  4HO0 A;  1O7Q A;  4KPX A;  3I0I X;  5C3B A;  1H3M A;  1HM9 A;  1VIC A;  5EJZ A;  4AYJ A;  1JVG A;  2PGY A;  3PKP A;  4UEG A;  2FYC B;  1JVD A;  2O1H A;  5EJ1 A;  1H5T A;  1SS9 A;  1VPA A;  3N9W A;  3I0F A;  2OI7 A;  1VZX A;  1R81 A;  1YP4 A;  2Y6P A;  4HCQ A;  4Y9X A;  3CKV A;  1G2V A;  3OAM A;  1H7Q A;  1IIM A;  2VS3 A;  3SXA A;  1HM0 A;  1ZJ3 A;  3BRK X;  5IDT A;  1MC3 A;  3IOH A;  4ZDQ A;  2D0J A;  2AEC A;  3RMV A;  5CMF X;  2FY7 A;  1WVC A;  4KNR A;  1ZDG A;  4B4M A;  1H5R B;  2E3D A;  1HM8 A;  4HO4 A;  2VK9 A;  2P73 A;  2Y4L A;  4Y62 A;  3SXD A;  1H5S C;  1LL0 A;  1VM8 A;  5I1F A;  5HS2 A;  2MZB A;  1NKH B; 
#chains in the Genus database with same CATH homology
 1GX0 A;  4ASY A;  4ARW A;  1EYR A;  2APC A;  3OH1 A;  3GUE A;  5C1G A;  3PKQ A;  3I0L A;  2AE7 A;  3OH0 A;  1G23 A;  4KRV A;  1LL2 A;  3POL A;  1O23 B;  1QG8 A;  3CU0 A;  1QGS A;  1TW1 A;  5C4B A;  1ZJP A;  2V0J A;  5JQQ A;  1H7G A;  3I0D A;  1VH1 A;  2RJ7 A;  2OEF A;  2UX8 A;  1WT1 A;  4KXO A;  1G93 A;  4R7P A;  1G9R A;  2ICX A;  4EEM A;  3SXB A;  3K8E A;  1MP5 A;  4CJ8 A;  3ST8 A;  1ZCY A;  2OI5 A;  5C1H A;  3T7N A;  4Y6U A;  4EEG A;  2YCM A;  2ZU8 A;  1E5K A;  1YRO B;  2DPW A;  1R82 A;  1TW5 A;  2VFZ A;  2Y4M A;  5EIY A;  3T7M A;  1OQM B;  1FR8 A;  3DJ4 A;  5FV9 A;  4G3P A;  1ZIZ A;  2FYB A;  2JCJ A;  1HJL A;  3JUJ A;  3SX7 A;  4EEO A;  2QH5 A;  5CMJ A;  1ZI4 A;  4FRA A;  2ZU7 A;  3I0C A;  3V8Y A;  2RIX A;  2D7I A;  2X60 A;  4NAK A;  1H5S A;  3ZGG A;  5CQM X;  1NQI B;  2O1F A;  4FCU A;  2YC3 A;  4IRQ A;  1ZDF A;  2Y4J A;  5C4D A;  3OKR A;  3E25 A;  3Q7U A;  1FR9 A;  2VSH A;  2X5S A;  4HO9 A;  5AJN A;  1ZI1 A;  2WEE A;  4B42 A;  4D11 A;  2RJ6 A;  2VS4 A;  3HL3 A;  4MYB A;  1GX4 A;  4AAW A;  2WE9 A;  1FOA A;  5C3A A;  4KT7 A;  1WT3 A;  1INI A;  4KQL A;  4J18 A;  4M2B A;  2Y7A A;  1MP4 A;  4O6M A;  4CJB A;  4DEC A;  1FRW A;  3SXE A;  2YQS A;  3JTJ A;  1H7T A;  4LW3 A;  4XWI A;  4M2A A;  4AYL A;  1H7H A;  3I0H A;  1MP3 A;  2D7R A;  3U0Y A;  4FRL A;  5C49 A;  5L6V A;  1NHE B;  3D8V A;  4KNX A;  2YES A;  1W57 A;  1R7Y A;  3F1Y A;  4B2X A;  5IFY A;  2X5Z A;  2J0A A;  3ZGF A;  3FWW A;  2W0W A;  5D91 A;  5C48 A;  1TVY A;  3E26 A;  3OH4 A;  3U2V A;  2QGI A;  2NXV A;  3V90 A;  2XWM A;  2AH9 A;  3DUV A;  4MND A;  1H7L A;  1LZJ A;  1FWY A;  1I52 A;  2YQJ A;  4G87 A;  2RJ0 A;  4IRP A;  3IOJ A;  3NGW A;  3USQ A;  2WVM A;  1O0R A;  1W77 A;  2RIT A;  1PZY B;  4L41 C;  4M28 A;  1EZI A;  1H5R A;  1LVW A;  2A8W A;  4G3Q A;  2YC5 A;  4Y6N A;  5J49 A;  3I0K A;  4Y7F A;  5AJO A;  4B2W A;  2AM5 A;  1ON8 A;  1QGQ A;  4KPZ A;  3U2W A;  4O6N A;  4D11 C;  2A8U A;  5CQL X;  5DDT A;  5C4C A;  4FRP A;  4NAN A;  3ZF8 A;  4B4G A;  4D0T A;  4FIX A;  2ICY A;  1S4N A;  3CKN A;  5DDV A;  4EEA A;  2CU2 A;  5C47 A;  4EE4 A;  1H4C A;  3EE5 A;  4HO8 A;  1O7O A;  2AM4 A;  1H5S D;  1R7V A;  1ZJ1 A;  2V0H A;  1VGZ A;  2VXL A;  4FRO A;  2I5K A;  4BQH A;  5FUH A;  1VGT A;  1G1L A;  2WAW A;  1ZJ0 A;  2ZU9 A;  3RSB A;  5FU8 A;  3CKO A;  3OGZ A;  1LZ0 A;  3SPT A;  3V0O A;  4NAI A;  4HOC A;  2Y4K A;  3F1C A;  1ZI5 A;  3CKJ A;  1H5S B;  3OC9 A;  4FRE A;  3V0L A;  4FRB A;  1TZF A;  1ZCV A;  1FZW A;  1S4O A;  4M4K A;  3SX3 A;  3T7O A;  4DE7 A;  1H4D A;  1YP2 A;  5CMG X;  1VGU A;  2FFU A;  4HO6 A;  4EE3 A;  4Y64 A;  2WVK A;  1S4P A;  2RJ9 A;  1G3L A;  1GWW A;  4P00 A;  2BO6 A;  1GQ9 A;  2GGO A;  4FRH A;  1ZJ2 A;  1XHB A;  2Q4J A;  2VD4 A;  3U2T A;  3R3I A;  4HO5 A;  3TZT A;  3OH2 A;  1ZCU A;  4Y7T A;  3JUK A;  2AM3 A;  4D0Z A;  2RIZ A;  2RJ5 A;  1K4V A;  2RIY A;  3ZLL A;  2GGQ A;  1JYL A;  5FTV A;  3V0N A;  2OEG A;  1W55 A;  5FTS A;  5CQP A;  1LL3 A;  2YQC A;  3V0P A;  1R7T A;  1WSZ A;  1WT0 A;  3Q4S A;  1H5T B;  3QVB A;  4B4B A;  4JIS A;  1FO8 A;  5D92 A;  1GWV A;  1FXJ A;  4MIX A;  1VZT A;  2XMH A;  5FYE A;  1JV1 A;  3V91 A;  4HO3 A;  4FQW A;  3I0G A;  1VGW A;  3SX5 A;  1VH3 A;  1R80 A;  1FGX A;  4KC4 A;  4CVH A;  2I5E A;  1GA8 A;  4FIY A;  4FRM A;  1GQC A;  3D98 A;  2Z87 A;  2VS5 A;  2RJ1 A;  2OI6 A;  3U0X A;  3V0Q A;  2W0V A;  3I0E A;  3D5N A;  3O3P A;  2P6W A;  3ZLK A;  5BXC A;  4CJC A;  2XWL A;  2PGV A;  2AES A;  3V0M A;  4P02 A;  2XME A;  3CKQ A;  2WGZ A;  1Z90 A;  2YQH A;  1R7U A;  4K6R A;  1FXO A;  1OMZ A;  4Y7G A;  1NWG B;  2O1G A;  1ZHJ A;  4FCE A;  4DDZ A;  5L6S A;  5C1L A;  4B3U A;  1OMX A;  2PX7 A;  4NAL A;  1HV9 A;  2BO4 A;  1G0R A;  2V0L A;  1H7E A;  2V0K A;  4BMA A;  3Q80 A;  2C0N A;  2QKX A;  4FRQ A;  5FU0 A;  2BO7 A;  3SX8 A;  1VZU A;  1LZ7 A;  4HO2 A;  4YS8 A;  3SXG A;  4G3S A;  2AGD A;  2Z86 A;  1ON6 A;  4Y63 A;  5IDS A;  5CQN X;  1V83 A;  3LW6 A;  2RJ4 A;  1WT2 A;  1LZI A;  3IOI A;  2JCL A;  3PNN A;  2V0I A;  2BO8 A;  1NMM B;  2FFV A;  5C38 A;  3DK5 A;  1FO9 A;  1ZI3 A;  1FG5 N;  1H4E A;  4GBP A;  3I0J A;  5CMI A;  1INJ A;  1R7X A;  1H7F A;  4LW6 A;  1V84 A;  3V8Z A;  2JCO A;  4ASJ A;  4EE5 A;  1FGG A;  2FYA A;  4EVW A;  4FRD A;  4KC1 A;  4B5B A;  5C36 A;  5C3D A;  3TQD A;  4JD0 A;  2VXM A;  3BCV A;  2I7B A;  5C4E A;  1HJJ A;  1NF5 B;  4C2S A;  2X65 A;  3U2X A;  4E1K A;  1PZT A;  3OH3 A;  3R2W A;  2VSI A;  2RJ8 A;  1ZCT A;  3CGX A;  2E8B A;  3U2U A;  2PA4 A;  4Y7V A;  4D48 A;  1IIN A;  1XZ6 A;  2J0B A;  5CMH A;  4ECM A;  2P72 A;  5C4F A;  1G95 A;  3K8D A;  3KIA A;  2XWN A;  1G97 A;  1QWJ A;  1JV3 A;  2WVL A;  3USR A;  5AJP A;  2FYD B;  4HG6 A;  1KWS A;  4KC2 A;  1V82 A;  4AC3 A;  5C8R A;  5CQO A;  1YP3 A;  1ZJO A;  1JYK A;  3FOQ A;  4Q7C A;  3SXC A;  1G8O A;  3RMW A;  4Y7U A;  2JCK A;  4HO0 A;  1O7Q A;  4KPX A;  3I0I X;  5C3B A;  1H3M A;  1HM9 A;  1VIC A;  5EJZ A;  4AYJ A;  1JVG A;  2PGY A;  3PKP A;  4UEG A;  2FYC B;  1JVD A;  2O1H A;  5EJ1 A;  1H5T A;  1SS9 A;  1VPA A;  3N9W A;  3I0F A;  2OI7 A;  1VZX A;  1R81 A;  1YP4 A;  2Y6P A;  4HCQ A;  4Y9X A;  3CKV A;  1G2V A;  3OAM A;  1H7Q A;  1IIM A;  2VS3 A;  3SXA A;  1HM0 A;  1ZJ3 A;  3BRK X;  5IDT A;  1MC3 A;  3IOH A;  4ZDQ A;  2D0J A;  2AEC A;  3RMV A;  5CMF X;  2FY7 A;  1WVC A;  4KNR A;  1ZDG A;  4B4M A;  1H5R B;  2E3D A;  1HM8 A;  4HO4 A;  2VK9 A;  2P73 A;  2Y4L A;  4Y62 A;  3SXD A;  1H5S C;  1LL0 A;  1VM8 A;  5I1F A;  5HS2 A;  2MZB A;  1NKH B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...