3PKQA

Q83d variant of s. enterica rmla with dgtp
Total Genus 97
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
97
sequence length
288
structure length
285
Chain Sequence
TRKGIILAGGSGTRLYPVTMAVSKQLLPIYDKPMIYYPLSTLMLAGIRDILIISTPQDTPRFQQLLGDGSQWGLNLQYKVDPSPDGLAQAFIIGEEFIGHDDCALVLGDNIFYGHDLPKLMEAAVNKESGATVFAYHVNDPERYGVVEFDTAVSLEEKPLQPKSNYAVTGLYFYDNSVVEMAKNLKPSARGELEITDINRIYMEQGRLSVAMMGRGYAWLDTGTHQSLIEASNFIATIEERQGLKVSCPEEIAFRKNFINAQQVIELAGPLSKNDYGKYLLKMVK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords Glucose-1-phosphate thymidylyltransferase
publication title Expanding the Nucleotide and Sugar 1-Phosphate Promiscuity of Nucleotidyltransferase RmlA via Directed Evolution.
pubmed doi rcsb
source organism Salmonella enterica subsp. enterica serovar typhimurium
total genus 97
structure length 285
sequence length 288
chains with identical sequence B, C, D
ec nomenclature ec 2.7.7.24: Glucose-1-phosphate thymidylyltransferase.
pdb deposition date 2010-11-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00483 NTP_transferase Nucleotidyl transferase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.550.10 Alpha Beta Alpha-Beta Complex Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A 3pkqA00
1VM8A 3E26A 2AM3A 2VS5A 5CMHA 4FQWA 2V0JA 5C3AA 2ZU7A 3USRA 4E1KA 3D8VA 3R3IA 4EEOA 2XMHA 2I5EA 3U2UA 4EEGA 1QGSA 1WT2A 2OI6A 2BO8A 4NALA 2P73A 3FOQA 2WEEA 1VZTA 1GWWA 2YC5A 4Y6UA 1S4PA 5HS2A 4B2WA 1VGWA 4D11C 2FYDB 1H7EA 1K4VA 4HO9A 1LZJA 1LL3A 2ICYA 4KC2A 1JV1A 3JTJA 4AYJA 1HM0A 1INIA 5EJ1A 5C8RA 1EYRA 1ZJ1A 4FRBA 5I1FA 1G97A 1ZJOA 2FYCB 3T7MA 3U2XA 3CKQA 1FGXA 2W0WA 4HOCA 2I7BA 1H5SD 1O23B 2XWNA 3FWWA 4HO4A 2PGVA 4R7PA 1H4CA 4FREA 4KPXA 1FZWA 3SXDA 2V0HA 1WT0A 5C1LA 4C2SA 1H5SC 2FYAA 1G0RA 1INJA 4NAKA 2GGQA 2PX7A 2RIYA 2ICXA 5C47A 1R7TA 2A8WA 2NXVA 2UX8A 4HO2A 1VZXA 3ZF8A 1R7YA 1JYKA 1S4NA 4Y6NA 4G3SA 3OGZA 3I0FA 2JCOA 1HM9A 2DPWA 3SX8A 1GQ9A 1LVWA 2RJ7A 4EEMA 2VSHA 2E8BA 4Y9XA 2ZU9A 3BRKX 3V0OA 5AJNA 1G8OA 2VS4A 1NWGB 2BO7A 4ARWA 2OI7A 1FXJA 1FXOA 2FY7A 1E5KA 4KPZA 4D11A 1OMXA 3R2WA 1R80A 5CMJA 2VXMA 2RJ0A 2Z87A 4HO6A 1NKHB 1ZI3A 2MZBA 3OH4A 1PZTA 1QGQA 2QKXA 1VZUA 5CQOA 5C4FA 4FRLA 4EE4A 2RJ5A 3USQA 5C48A 3LW6A 1FOAA 3ST8A 1VGZA 2JCLA 4J18A 3SXGA 1ZI5A 4FCUA 3I0JA 1IINA 5CMFX 1G93A 4KRVA 5CQNX 3U2WA 4B4BA 4D48A 1GQCA 1ZJ0A 4JD0A 4M2AA 5IFYA 1ZJ3A 1TW1A 1H5TB 2XWMA 3OH1A 3V8YA 4UEGA 1TW5A 3ZGFA 3Q7UA 2APCA 4B4MA 1O7QA 3O3PA 4B5BA 4CJ8A 4FROA 2V0LA 3BCVA 1NQIB 1JVDA 1FWYA 1VH1A 2FFVA 5FU8A 2JCKA 4FRHA 2OEGA 1H7TA 2BO6A 1G1LA 3CKJA 1ZCUA 4AAWA 1JVGA 1MP3A 2PA4A 1LZ7A 2P6WA 4HO0A 4DDZA 4Y7FA 4HG6A 2JCJA 1ZI1A 2VSIA 2AM4A 4AYLA 1YP4A 1MP4A 2X5SA 2RJ8A 4MNDA 4KC4A 1FO8A 3I0CA 1G95A 4IRQA 1G9RA 1TZFA 4M4KA 2A8UA 4ASJA 5J49A 4B4GA 2RJ6A 3I0KA 2RJ4A 4Y62A 2RJ9A 4D0ZA 2V0IA 2WAWA 4Y7UA 2Q4JA 2FFUA 4FRMA 1NMMB 1ZJPA 4XWIA 4B2XA 5IDSA 5C3DA 3HL3A 4FRDA 2YC3A 5DDTA 2AECA 3DUVA 4D0TA 1NHEB 3OC9A 3T7OA 2QH5A 1ZJ2A 3GUEA 4LW3A 4Y7GA 1V83A 4JISA 1ON6A 2Z86A 3I0HA 4FCEA 2WGZA 1O0RA 3K8EA 2VD4A 3CKVA 3PNNA 1R7XA 1HM8A 1MC3A 3IOJA 3V0MA 5IDTA 3SX5A 5CQMX 2AH9A 3I0EA 5C1HA 5FYEA 2VXLA 1YP3A 2Y4LA 5FTVA 1W55A 1V82A 1FO9A 1HJLA 3CU0A 1GX4A 1FR9A 2WVMA 2Y7AA 3Q80A 5JQQA 1R7VA 1YROB 2WE9A 4KNXA 3ZLKA 4L41C 1R82A 3V90A 4MYBA 3SX7A 1SS9A 3RMVA 2V0KA 4EE5A 2FYBA 4LW6A 3OH3A 5FUHA 1H4DA 2ZU8A 3T7NA 1G3LA 2PGYA 2VFZA 4ECMA 1H7LA 1ZCVA 5EIYA 1ZCTA 3SXAA 1ZIZA 1H5SA 4EE3A 3ZLLA 5BXCA 4NANA 5C4CA 5C49A 4Y7TA 3V0PA 4B3UA 4BQHA 5C4EA 3OAMA 5C36A 4DECA 1LL0A 1S4OA 1H7FA 1VGTA 2AM5A 1FR8A 4CVHA 3OKRA 1GA8A 1OMZA 2P72A 1JYLA 1ZCYA 1H7GA 3KIAA 1GWVA 3OH2A 5L6VA 1WSZA 2WVLA 3JUKA 4K6RA 2Y4JA 2YQHA 1H7HA 2D7IA 3DK5A 2I5KA 3E25A 5C38A 3D5NA 4G3PA 1ZI4A 3SXEA 3IOHA 1MP5A 4EEAA 5AJOA 1WVCA 4AC3A 1FGGA 4GBPA 1WT1A 1H5SB 3Q4SA 1H4EA 4P00A 4G3QA 3SXBA 5C1GA 1H7QA 3I0IX 2BO4A 1PZYB 3RMWA 3CKOA 4M28A 1TVYA 2W0VA 3U0YA 3ZGGA 5C4DA 1GX0A 2YQJA 4KC1A 3IOIA 4M2BA 1H5RA 3N9WA 3PKPA 4Y7VA 2AE7A 1LZIA 4HO3A 3I0DA 2XWLA 1W77A 4KXOA 2YQCA 1IIMA 1JV3A 1KWSA 2X5ZA 2OEFA 5EJZA 3RSBA 1WT3A 5FU0A 1LZ0A 4YS8A 2RITA 2Y4KA 5C4BA 2GGOA 3V0QA 3PKQA 4FRPA 2D7RA 3K8DA 5FTSA 2Y6PA 2WVKA 5FV9A 2O1FA 4P02A 3TQDA 1V84A 1LL2A 2VS3A 3QVBA 4ZDQA 1ZDGA 4CJBA 4FRAA 5CMGX 5CQPA 1VPAA 4ASYA 1O7OA 3OH0A 1R7UA 4B42A 1R81A 3TZTA 3POLA 3EE5A 3U2TA 2D0JA 1XZ6A 3V8ZA 2RJ1A 1OQMB 3DJ4A 3SPTA 2YQSA 2X60A 1Z90A 1H5RB 3CKNA 4KT7A 4KNRA 2E3DA 1VICA 3F1YA 4HCQA 2XMEA 5C3BA 1H3MA 4FRQA 2CU2A 1ZHJA 1FG5N 1H5TA 3D98A 1FRWA 5AJPA 1G2VA 3U0XA 1XHBA 2AESA 2Y4MA 3V91A 4DE7A 4HO5A 3CGXA 1W57A 1YP2A 5CMIA 3SXCA 4CJCA 4EVWA 4NAIA 3I0GA 3JUJA 2QGIA 2O1GA 5L6SA 1ZDFA 1QG8A 1HV9A 1ON8A 2RIXA 4KQLA 3F1CA 5DDVA 5CQLX 4BMAA 4Y64A 4IRPA 2YCMA 4HO8A 1EZIA 2RIZA 2YESA 2AGDA 3SX3A 3U2VA 1NF5B 2OI5A 1VH3A 1HJJA 1QWJA 1I52A 3V0NA 2X65A 3NGWA 4G87A 1G23A 3I0LA 3V0LA 1VGUA 4Y63A 2O1HA
chains in the Genus database with same CATH superfamily
1VM8A 3E26A 2AM3A 2VS5A 5CMHA 4FQWA 2V0JA 5C3AA 2ZU7A 4Q7CA 3USRA 4E1KA 3D8VA 3R3IA 4EEOA 2XMHA 2I5EA 3U2UA 4EEGA 1QGSA 1WT2A 2OI6A 2BO8A 4NALA 2P73A 3FOQA 2WEEA 1VZTA 1GWWA 2YC5A 4Y6UA 1S4PA 5HS2A 4B2WA 1VGWA 4D11C 2FYDB 1H7EA 1K4VA 4HO9A 1LZJA 1LL3A 2ICYA 4KC2A 1JV1A 3JTJA 4AYJA 1HM0A 1INIA 5EJ1A 5C8RA 1EYRA 1ZJ1A 4FRBA 5I1FA 1G97A 1ZJOA 2FYCB 3T7MA 3U2XA 3CKQA 1FGXA 2W0WA 4HOCA 2I7BA 1H5SD 1O23B 2XWNA 3FWWA 4HO4A 2PGVA 4R7PA 1H4CA 4FREA 4KPXA 1FZWA 4MIXA 3SXDA 2V0HA 1WT0A 5C1LA 4C2SA 1H5SC 2FYAA 1G0RA 1INJA 4NAKA 2GGQA 2PX7A 2RIYA 2ICXA 5C47A 1R7TA 2A8WA 2NXVA 2UX8A 4HO2A 1VZXA 3ZF8A 1R7YA 1JYKA 1S4NA 4Y6NA 4G3SA 3OGZA 3I0FA 2JCOA 1HM9A 2DPWA 3SX8A 1GQ9A 1LVWA 2RJ7A 4EEMA 2VSHA 2E8BA 4Y9XA 2ZU9A 4O6NA 3BRKX 3V0OA 5AJNA 1G8OA 2VS4A 1NWGB 2BO7A 4ARWA 2OI7A 1FXJA 1FXOA 2FY7A 1E5KA 4KPZA 4D11A 1OMXA 3R2WA 1R80A 5CMJA 2VXMA 2RJ0A 2Z87A 4HO6A 1NKHB 1ZI3A 2MZBA 3OH4A 1PZTA 1QGQA 2QKXA 1VZUA 5CQOA 5C4FA 4FRLA 4EE4A 2RJ5A 3USQA 5C48A 3LW6A 1FOAA 3ST8A 1VGZA 2JCLA 4J18A 3SXGA 1ZI5A 4FCUA 3I0JA 1IINA 5CMFX 1G93A 4KRVA 5CQNX 3U2WA 4B4BA 4D48A 1GQCA 1ZJ0A 4JD0A 4M2AA 5IFYA 1ZJ3A 1TW1A 1H5TB 2XWMA 3OH1A 3V8YA 4UEGA 1TW5A 3ZGFA 3Q7UA 2APCA 4B4MA 1O7QA 3O3PA 4B5BA 4CJ8A 4FROA 2V0LA 3BCVA 1NQIB 1JVDA 1FWYA 1VH1A 2FFVA 5FU8A 2JCKA 4FRHA 2OEGA 1H7TA 2BO6A 1G1LA 3CKJA 1ZCUA 4AAWA 1JVGA 1MP3A 2PA4A 1LZ7A 2P6WA 4HO0A 4DDZA 4Y7FA 4HG6A 2JCJA 1ZI1A 2VSIA 2AM4A 4AYLA 1YP4A 1MP4A 2X5SA 2RJ8A 4MNDA 5D92A 4KC4A 1FO8A 3I0CA 1G95A 4IRQA 1G9RA 1TZFA 4M4KA 2A8UA 4ASJA 5J49A 4FIXA 4B4GA 2RJ6A 3I0KA 2RJ4A 4Y62A 2VK9A 2RJ9A 4D0ZA 2V0IA 2WAWA 4Y7UA 2Q4JA 2FFUA 4FRMA 1NMMB 1ZJPA 4XWIA 4B2XA 5IDSA 5C3DA 3HL3A 4FRDA 2YC3A 5DDTA 2AECA 3DUVA 4D0TA 1NHEB 3OC9A 3T7OA 2QH5A 1ZJ2A 3GUEA 4LW3A 4Y7GA 1V83A 4JISA 1ON6A 2Z86A 3I0HA 4FCEA 2WGZA 1O0RA 3K8EA 2VD4A 3CKVA 3PNNA 1R7XA 1HM8A 1MC3A 3IOJA 3V0MA 5IDTA 3SX5A 5CQMX 2AH9A 3I0EA 5C1HA 5FYEA 2VXLA 1YP3A 2Y4LA 5FTVA 1W55A 1V82A 1FO9A 1HJLA 3CU0A 1GX4A 1FR9A 2WVMA 2Y7AA 3Q80A 5JQQA 1R7VA 1YROB 2WE9A 4KNXA 3ZLKA 4L41C 1R82A 3V90A 4MYBA 3SX7A 1SS9A 3RMVA 2V0KA 4EE5A 2FYBA 4LW6A 3OH3A 5FUHA 1H4DA 2ZU8A 3T7NA 1G3LA 2PGYA 2VFZA 4ECMA 1H7LA 1ZCVA 5EIYA 1ZCTA 3SXAA 1ZIZA 1H5SA 4EE3A 3ZLLA 5BXCA 4NANA 5C4CA 5C49A 4Y7TA 3V0PA 2J0AA 4B3UA 4BQHA 5C4EA 3OAMA 5C36A 4DECA 1LL0A 1S4OA 1H7FA 1VGTA 2AM5A 1FR8A 4CVHA 3OKRA 1GA8A 1OMZA 2P72A 1JYLA 1ZCYA 1H7GA 3KIAA 1GWVA 3OH2A 5L6VA 1WSZA 2WVLA 3JUKA 4K6RA 2Y4JA 2YQHA 1H7HA 2D7IA 4FIYA 3DK5A 2I5KA 3E25A 5C38A 3D5NA 4G3PA 1ZI4A 3SXEA 3IOHA 1MP5A 4EEAA 5AJOA 1WVCA 4AC3A 1FGGA 4GBPA 1WT1A 1H5SB 3Q4SA 1H4EA 4P00A 4G3QA 3SXBA 5C1GA 1H7QA 3I0IX 2BO4A 1PZYB 3RMWA 3CKOA 4M28A 1TVYA 2W0VA 3U0YA 3ZGGA 5C4DA 1GX0A 2YQJA 4KC1A 3IOIA 4M2BA 1H5RA 3N9WA 3PKPA 4Y7VA 2AE7A 1LZIA 4HO3A 3I0DA 2XWLA 1W77A 4KXOA 2YQCA 1IIMA 1JV3A 1KWSA 2X5ZA 2OEFA 5EJZA 3RSBA 1WT3A 5FU0A 1LZ0A 2J0BA 4YS8A 2RITA 2Y4KA 5C4BA 2GGOA 3V0QA 3PKQA 4FRPA 2D7RA 3K8DA 5FTSA 2Y6PA 2C0NA 2WVKA 5FV9A 2O1FA 4P02A 3TQDA 1V84A 1LL2A 2VS3A 3QVBA 4ZDQA 1ZDGA 4CJBA 4FRAA 5CMGX 5CQPA 1VPAA 4ASYA 1O7OA 3OH0A 1R7UA 4B42A 1R81A 5D91A 3TZTA 3POLA 3EE5A 3U2TA 2D0JA 1XZ6A 3V8ZA 2RJ1A 1OQMB 3DJ4A 3SPTA 2YQSA 2X60A 1Z90A 1H5RB 3CKNA 4KT7A 4KNRA 2E3DA 1VICA 3F1YA 4HCQA 2XMEA 5C3BA 1H3MA 4FRQA 2CU2A 1ZHJA 1FG5N 1H5TA 3D98A 1FRWA 5AJPA 1G2VA 3U0XA 1XHBA 2AESA 2Y4MA 3V91A 4DE7A 4HO5A 3CGXA 1W57A 1YP2A 5CMIA 3SXCA 4CJCA 4EVWA 4NAIA 3I0GA 3JUJA 2QGIA 2O1GA 5L6SA 1ZDFA 1QG8A 1HV9A 1ON8A 2RIXA 4KQLA 3F1CA 5DDVA 5CQLX 4BMAA 4Y64A 4IRPA 2YCMA 4HO8A 1EZIA 2RIZA 2YESA 2AGDA 3SX3A 3U2VA 1NF5B 2OI5A 1VH3A 1HJJA 1QWJA 1I52A 3V0NA 2X65A 3NGWA 4G87A 1G23A 4O6MA 3I0LA 3V0LA 1VGUA 4Y63A 2O1HA
chains in the Genus database with same CATH topology
1VM8A 3E26A 2AM3A 2VS5A 5CMHA 4FQWA 2V0JA 5C3AA 2ZU7A 4Q7CA 3USRA 4E1KA 3D8VA 3R3IA 4EEOA 2XMHA 2I5EA 3U2UA 4EEGA 1QGSA 1WT2A 2OI6A 2BO8A 4NALA 2P73A 3FOQA 2WEEA 1VZTA 1GWWA 2YC5A 4Y6UA 1S4PA 5HS2A 4B2WA 1VGWA 4D11C 2FYDB 1H7EA 1K4VA 4HO9A 1LZJA 1LL3A 2ICYA 4KC2A 1JV1A 3JTJA 4AYJA 1HM0A 1INIA 5EJ1A 5C8RA 1EYRA 1ZJ1A 4FRBA 5I1FA 1G97A 1ZJOA 2FYCB 3T7MA 3U2XA 3CKQA 1FGXA 2W0WA 4HOCA 2I7BA 1H5SD 1O23B 2XWNA 3FWWA 4HO4A 2PGVA 4R7PA 1H4CA 4FREA 4KPXA 1FZWA 4MIXA 3SXDA 2V0HA 1WT0A 5C1LA 4C2SA 1H5SC 2FYAA 1G0RA 1INJA 4NAKA 2GGQA 2PX7A 2RIYA 2ICXA 5C47A 1R7TA 2A8WA 2NXVA 2UX8A 4HO2A 1VZXA 3ZF8A 1R7YA 1JYKA 1S4NA 4Y6NA 4G3SA 3OGZA 3I0FA 2JCOA 1HM9A 2DPWA 3SX8A 1GQ9A 1LVWA 2RJ7A 4EEMA 2VSHA 2E8BA 4Y9XA 2ZU9A 4O6NA 3BRKX 3V0OA 5AJNA 1G8OA 2VS4A 1NWGB 2BO7A 4ARWA 2OI7A 1FXJA 1FXOA 2FY7A 1E5KA 4KPZA 4D11A 1OMXA 3R2WA 1R80A 5CMJA 2VXMA 2RJ0A 2Z87A 4HO6A 1NKHB 1ZI3A 2MZBA 3OH4A 1PZTA 1QGQA 2QKXA 1VZUA 5CQOA 5C4FA 4FRLA 4EE4A 2RJ5A 3USQA 5C48A 3LW6A 1FOAA 3ST8A 1VGZA 2JCLA 4J18A 3SXGA 1ZI5A 4FCUA 3I0JA 1IINA 5CMFX 1G93A 4KRVA 5CQNX 3U2WA 4B4BA 4D48A 1GQCA 1ZJ0A 4JD0A 4M2AA 5IFYA 1ZJ3A 1TW1A 1H5TB 2XWMA 3OH1A 3V8YA 4UEGA 1TW5A 3ZGFA 3Q7UA 2APCA 4B4MA 1O7QA 3O3PA 4B5BA 4CJ8A 4FROA 2V0LA 3BCVA 1NQIB 1JVDA 1FWYA 1VH1A 2FFVA 5FU8A 2JCKA 4FRHA 2OEGA 1H7TA 2BO6A 1G1LA 3CKJA 1ZCUA 4AAWA 1JVGA 1MP3A 2PA4A 1LZ7A 2P6WA 4HO0A 4DDZA 4Y7FA 4HG6A 2JCJA 1ZI1A 2VSIA 2AM4A 4AYLA 1YP4A 1MP4A 2X5SA 2RJ8A 4MNDA 5D92A 4KC4A 1FO8A 3I0CA 1G95A 4IRQA 1G9RA 1TZFA 4M4KA 2A8UA 4ASJA 5J49A 4FIXA 4B4GA 2RJ6A 3I0KA 2RJ4A 4Y62A 2VK9A 2RJ9A 4D0ZA 2V0IA 2WAWA 4Y7UA 2Q4JA 2FFUA 4FRMA 1NMMB 1ZJPA 4XWIA 4B2XA 5IDSA 5C3DA 3HL3A 4FRDA 2YC3A 5DDTA 2AECA 3DUVA 4D0TA 1NHEB 3OC9A 3T7OA 2QH5A 1ZJ2A 3GUEA 4LW3A 4Y7GA 1V83A 4JISA 1ON6A 2Z86A 3I0HA 4FCEA 2WGZA 1O0RA 3K8EA 2VD4A 3CKVA 3PNNA 1R7XA 1HM8A 1MC3A 3IOJA 3V0MA 5IDTA 3SX5A 5CQMX 2AH9A 3I0EA 5C1HA 5FYEA 2VXLA 1YP3A 2Y4LA 5FTVA 1W55A 1V82A 1FO9A 1HJLA 3CU0A 1GX4A 1FR9A 2WVMA 2Y7AA 3Q80A 5JQQA 1R7VA 1YROB 2WE9A 4KNXA 3ZLKA 4L41C 1R82A 3V90A 4MYBA 3SX7A 1SS9A 3RMVA 2V0KA 4EE5A 2FYBA 4LW6A 3OH3A 5FUHA 1H4DA 2ZU8A 3T7NA 1G3LA 2PGYA 2VFZA 4ECMA 1H7LA 1ZCVA 5EIYA 1ZCTA 3SXAA 1ZIZA 1H5SA 4EE3A 3ZLLA 5BXCA 4NANA 5C4CA 5C49A 4Y7TA 3V0PA 2J0AA 4B3UA 4BQHA 5C4EA 3OAMA 5C36A 4DECA 1LL0A 1S4OA 1H7FA 1VGTA 2AM5A 1FR8A 4CVHA 3OKRA 1GA8A 1OMZA 2P72A 1JYLA 1ZCYA 1H7GA 3KIAA 1GWVA 3OH2A 5L6VA 1WSZA 2WVLA 3JUKA 4K6RA 2Y4JA 2YQHA 1H7HA 2D7IA 4FIYA 3DK5A 2I5KA 3E25A 5C38A 3D5NA 4G3PA 1ZI4A 3SXEA 3IOHA 1MP5A 4EEAA 5AJOA 1WVCA 4AC3A 1FGGA 4GBPA 1WT1A 1H5SB 3Q4SA 1H4EA 4P00A 4G3QA 3SXBA 5C1GA 1H7QA 3I0IX 2BO4A 1PZYB 3RMWA 3CKOA 4M28A 1TVYA 2W0VA 3U0YA 3ZGGA 5C4DA 1GX0A 2YQJA 4KC1A 3IOIA 4M2BA 1H5RA 3N9WA 3PKPA 4Y7VA 2AE7A 1LZIA 4HO3A 3I0DA 2XWLA 1W77A 4KXOA 2YQCA 1IIMA 1JV3A 1KWSA 2X5ZA 2OEFA 5EJZA 3RSBA 1WT3A 5FU0A 1LZ0A 2J0BA 4YS8A 2RITA 2Y4KA 5C4BA 2GGOA 3V0QA 3PKQA 4FRPA 2D7RA 3K8DA 5FTSA 2Y6PA 2C0NA 2WVKA 5FV9A 2O1FA 4P02A 3TQDA 1V84A 1LL2A 2VS3A 3QVBA 4ZDQA 1ZDGA 4CJBA 4FRAA 5CMGX 5CQPA 1VPAA 4ASYA 1O7OA 3OH0A 1R7UA 4B42A 1R81A 5D91A 3TZTA 3POLA 3EE5A 3U2TA 2D0JA 1XZ6A 3V8ZA 2RJ1A 1OQMB 3DJ4A 3SPTA 2YQSA 2X60A 1Z90A 1H5RB 3CKNA 4KT7A 4KNRA 2E3DA 1VICA 3F1YA 4HCQA 2XMEA 5C3BA 1H3MA 4FRQA 2CU2A 1ZHJA 1FG5N 1H5TA 3D98A 1FRWA 5AJPA 1G2VA 3U0XA 1XHBA 2AESA 2Y4MA 3V91A 4DE7A 4HO5A 3CGXA 1W57A 1YP2A 5CMIA 3SXCA 4CJCA 4EVWA 4NAIA 3I0GA 3JUJA 2QGIA 2O1GA 5L6SA 1ZDFA 1QG8A 1HV9A 1ON8A 2RIXA 4KQLA 3F1CA 5DDVA 5CQLX 4BMAA 4Y64A 4IRPA 2YCMA 4HO8A 1EZIA 2RIZA 2YESA 2AGDA 3SX3A 3U2VA 1NF5B 2OI5A 1VH3A 1HJJA 1QWJA 1I52A 3V0NA 2X65A 3NGWA 4G87A 1G23A 4O6MA 3I0LA 3V0LA 1VGUA 4Y63A 2O1HA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1VM8 A;  3E26 A;  2AM3 A;  2VS5 A;  5CMH A;  4FQW A;  2V0J A;  5C3A A;  2ZU7 A;  3USR A;  4E1K A;  3D8V A;  3R3I A;  4EEO A;  2XMH A;  2I5E A;  3U2U A;  4EEG A;  1QGS A;  1WT2 A;  2OI6 A;  2BO8 A;  4NAL A;  2P73 A;  3FOQ A;  2WEE A;  1VZT A;  1GWW A;  2YC5 A;  4Y6U A;  1S4P A;  5HS2 A;  4B2W A;  1VGW A;  4D11 C;  2FYD B;  1H7E A;  1K4V A;  4HO9 A;  1LZJ A;  1LL3 A;  2ICY A;  4KC2 A;  1JV1 A;  3JTJ A;  4AYJ A;  1HM0 A;  1INI A;  5EJ1 A;  5C8R A;  1EYR A;  1ZJ1 A;  4FRB A;  5I1F A;  1G97 A;  1ZJO A;  2FYC B;  3T7M A;  3U2X A;  3CKQ A;  1FGX A;  2W0W A;  4HOC A;  2I7B A;  1H5S D;  1O23 B;  2XWN A;  3FWW A;  4HO4 A;  2PGV A;  4R7P A;  1H4C A;  4FRE A;  4KPX A;  1FZW A;  3SXD A;  2V0H A;  1WT0 A;  5C1L A;  4C2S A;  1H5S C;  2FYA A;  1G0R A;  1INJ A;  4NAK A;  2GGQ A;  2PX7 A;  2RIY A;  2ICX A;  5C47 A;  1R7T A;  2A8W A;  2NXV A;  2UX8 A;  4HO2 A;  1VZX A;  3ZF8 A;  1R7Y A;  1JYK A;  1S4N A;  4Y6N A;  4G3S A;  3OGZ A;  3I0F A;  2JCO A;  1HM9 A;  2DPW A;  3SX8 A;  1GQ9 A;  1LVW A;  2RJ7 A;  4EEM A;  2VSH A;  2E8B A;  4Y9X A;  2ZU9 A;  3BRK X;  3V0O A;  5AJN A;  1G8O A;  2VS4 A;  1NWG B;  2BO7 A;  4ARW A;  2OI7 A;  1FXJ A;  1FXO A;  2FY7 A;  1E5K A;  4KPZ A;  4D11 A;  1OMX A;  3R2W A;  1R80 A;  5CMJ A;  2VXM A;  2RJ0 A;  2Z87 A;  4HO6 A;  1NKH B;  1ZI3 A;  2MZB A;  3OH4 A;  1PZT A;  1QGQ A;  2QKX A;  1VZU A;  5CQO A;  5C4F A;  4FRL A;  4EE4 A;  2RJ5 A;  3USQ A;  5C48 A;  3LW6 A;  1FOA A;  3ST8 A;  1VGZ A;  2JCL A;  4J18 A;  3SXG A;  1ZI5 A;  4FCU A;  3I0J A;  1IIN A;  5CMF X;  1G93 A;  4KRV A;  5CQN X;  3U2W A;  4B4B A;  4D48 A;  1GQC A;  1ZJ0 A;  4JD0 A;  4M2A A;  5IFY A;  1ZJ3 A;  1TW1 A;  1H5T B;  2XWM A;  3OH1 A;  3V8Y A;  4UEG A;  1TW5 A;  3ZGF A;  3Q7U A;  2APC A;  4B4M A;  1O7Q A;  3O3P A;  4B5B A;  4CJ8 A;  4FRO A;  2V0L A;  3BCV A;  1NQI B;  1JVD A;  1FWY A;  1VH1 A;  2FFV A;  5FU8 A;  2JCK A;  4FRH A;  2OEG A;  1H7T A;  2BO6 A;  1G1L A;  3CKJ A;  1ZCU A;  4AAW A;  1JVG A;  1MP3 A;  2PA4 A;  1LZ7 A;  2P6W A;  4HO0 A;  4DDZ A;  4Y7F A;  4HG6 A;  2JCJ A;  1ZI1 A;  2VSI A;  2AM4 A;  4AYL A;  1YP4 A;  1MP4 A;  2X5S A;  2RJ8 A;  4MND A;  4KC4 A;  1FO8 A;  3I0C A;  1G95 A;  4IRQ A;  1G9R A;  1TZF A;  4M4K A;  2A8U A;  4ASJ A;  5J49 A;  4B4G A;  2RJ6 A;  3I0K A;  2RJ4 A;  4Y62 A;  2RJ9 A;  4D0Z A;  2V0I A;  2WAW A;  4Y7U A;  2Q4J A;  2FFU A;  4FRM A;  1NMM B;  1ZJP A;  4XWI A;  4B2X A;  5IDS A;  5C3D A;  3HL3 A;  4FRD A;  2YC3 A;  5DDT A;  2AEC A;  3DUV A;  4D0T A;  1NHE B;  3OC9 A;  3T7O A;  2QH5 A;  1ZJ2 A;  3GUE A;  4LW3 A;  4Y7G A;  1V83 A;  4JIS A;  1ON6 A;  2Z86 A;  3I0H A;  4FCE A;  2WGZ A;  1O0R A;  3K8E A;  2VD4 A;  3CKV A;  3PNN A;  1R7X A;  1HM8 A;  1MC3 A;  3IOJ A;  3V0M A;  5IDT A;  3SX5 A;  5CQM X;  2AH9 A;  3I0E A;  5C1H A;  5FYE A;  2VXL A;  1YP3 A;  2Y4L A;  5FTV A;  1W55 A;  1V82 A;  1FO9 A;  1HJL A;  3CU0 A;  1GX4 A;  1FR9 A;  2WVM A;  2Y7A A;  3Q80 A;  5JQQ A;  1R7V A;  1YRO B;  2WE9 A;  4KNX A;  3ZLK A;  4L41 C;  1R82 A;  3V90 A;  4MYB A;  3SX7 A;  1SS9 A;  3RMV A;  2V0K A;  4EE5 A;  2FYB A;  4LW6 A;  3OH3 A;  5FUH A;  1H4D A;  2ZU8 A;  3T7N A;  1G3L A;  2PGY A;  2VFZ A;  4ECM A;  1H7L A;  1ZCV A;  5EIY A;  1ZCT A;  3SXA A;  1ZIZ A;  1H5S A;  4EE3 A;  3ZLL A;  5BXC A;  4NAN A;  5C4C A;  5C49 A;  4Y7T A;  3V0P A;  4B3U A;  4BQH A;  5C4E A;  3OAM A;  5C36 A;  4DEC A;  1LL0 A;  1S4O A;  1H7F A;  1VGT A;  2AM5 A;  1FR8 A;  4CVH A;  3OKR A;  1GA8 A;  1OMZ A;  2P72 A;  1JYL A;  1ZCY A;  1H7G A;  3KIA A;  1GWV A;  3OH2 A;  5L6V A;  1WSZ A;  2WVL A;  3JUK A;  4K6R A;  2Y4J A;  2YQH A;  1H7H A;  2D7I A;  3DK5 A;  2I5K A;  3E25 A;  5C38 A;  3D5N A;  4G3P A;  1ZI4 A;  3SXE A;  3IOH A;  1MP5 A;  4EEA A;  5AJO A;  1WVC A;  4AC3 A;  1FGG A;  4GBP A;  1WT1 A;  1H5S B;  3Q4S A;  1H4E A;  4P00 A;  4G3Q A;  3SXB A;  5C1G A;  1H7Q A;  3I0I X;  2BO4 A;  1PZY B;  3RMW A;  3CKO A;  4M28 A;  1TVY A;  2W0V A;  3U0Y A;  3ZGG A;  5C4D A;  1GX0 A;  2YQJ A;  4KC1 A;  3IOI A;  4M2B A;  1H5R A;  3N9W A;  3PKP A;  4Y7V A;  2AE7 A;  1LZI A;  4HO3 A;  3I0D A;  2XWL A;  1W77 A;  4KXO A;  2YQC A;  1IIM A;  1JV3 A;  1KWS A;  2X5Z A;  2OEF A;  5EJZ A;  3RSB A;  1WT3 A;  5FU0 A;  1LZ0 A;  4YS8 A;  2RIT A;  2Y4K A;  5C4B A;  2GGO A;  3V0Q A;  3PKQ A;  4FRP A;  2D7R A;  3K8D A;  5FTS A;  2Y6P A;  2WVK A;  5FV9 A;  2O1F A;  4P02 A;  3TQD A;  1V84 A;  1LL2 A;  2VS3 A;  3QVB A;  4ZDQ A;  1ZDG A;  4CJB A;  4FRA A;  5CMG X;  5CQP A;  1VPA A;  4ASY A;  1O7O A;  3OH0 A;  1R7U A;  4B42 A;  1R81 A;  3TZT A;  3POL A;  3EE5 A;  3U2T A;  2D0J A;  1XZ6 A;  3V8Z A;  2RJ1 A;  1OQM B;  3DJ4 A;  3SPT A;  2YQS A;  2X60 A;  1Z90 A;  1H5R B;  3CKN A;  4KT7 A;  4KNR A;  2E3D A;  1VIC A;  3F1Y A;  4HCQ A;  2XME A;  5C3B A;  1H3M A;  4FRQ A;  2CU2 A;  1ZHJ A;  1FG5 N;  1H5T A;  3D98 A;  1FRW A;  5AJP A;  1G2V A;  3U0X A;  1XHB A;  2AES A;  2Y4M A;  3V91 A;  4DE7 A;  4HO5 A;  3CGX A;  1W57 A;  1YP2 A;  5CMI A;  3SXC A;  4CJC A;  4EVW A;  4NAI A;  3I0G A;  3JUJ A;  2QGI A;  2O1G A;  5L6S A;  1ZDF A;  1QG8 A;  1HV9 A;  1ON8 A;  2RIX A;  4KQL A;  3F1C A;  5DDV A;  5CQL X;  4BMA A;  4Y64 A;  4IRP A;  2YCM A;  4HO8 A;  1EZI A;  2RIZ A;  2YES A;  2AGD A;  3SX3 A;  3U2V A;  1NF5 B;  2OI5 A;  1VH3 A;  1HJJ A;  1QWJ A;  1I52 A;  3V0N A;  2X65 A;  3NGW A;  4G87 A;  1G23 A;  3I0L A;  3V0L A;  1VGU A;  4Y63 A;  2O1H A; 
#chains in the Genus database with same CATH topology
 1VM8 A;  3E26 A;  2AM3 A;  2VS5 A;  5CMH A;  4FQW A;  2V0J A;  5C3A A;  2ZU7 A;  4Q7C A;  3USR A;  4E1K A;  3D8V A;  3R3I A;  4EEO A;  2XMH A;  2I5E A;  3U2U A;  4EEG A;  1QGS A;  1WT2 A;  2OI6 A;  2BO8 A;  4NAL A;  2P73 A;  3FOQ A;  2WEE A;  1VZT A;  1GWW A;  2YC5 A;  4Y6U A;  1S4P A;  5HS2 A;  4B2W A;  1VGW A;  4D11 C;  2FYD B;  1H7E A;  1K4V A;  4HO9 A;  1LZJ A;  1LL3 A;  2ICY A;  4KC2 A;  1JV1 A;  3JTJ A;  4AYJ A;  1HM0 A;  1INI A;  5EJ1 A;  5C8R A;  1EYR A;  1ZJ1 A;  4FRB A;  5I1F A;  1G97 A;  1ZJO A;  2FYC B;  3T7M A;  3U2X A;  3CKQ A;  1FGX A;  2W0W A;  4HOC A;  2I7B A;  1H5S D;  1O23 B;  2XWN A;  3FWW A;  4HO4 A;  2PGV A;  4R7P A;  1H4C A;  4FRE A;  4KPX A;  1FZW A;  4MIX A;  3SXD A;  2V0H A;  1WT0 A;  5C1L A;  4C2S A;  1H5S C;  2FYA A;  1G0R A;  1INJ A;  4NAK A;  2GGQ A;  2PX7 A;  2RIY A;  2ICX A;  5C47 A;  1R7T A;  2A8W A;  2NXV A;  2UX8 A;  4HO2 A;  1VZX A;  3ZF8 A;  1R7Y A;  1JYK A;  1S4N A;  4Y6N A;  4G3S A;  3OGZ A;  3I0F A;  2JCO A;  1HM9 A;  2DPW A;  3SX8 A;  1GQ9 A;  1LVW A;  2RJ7 A;  4EEM A;  2VSH A;  2E8B A;  4Y9X A;  2ZU9 A;  4O6N A;  3BRK X;  3V0O A;  5AJN A;  1G8O A;  2VS4 A;  1NWG B;  2BO7 A;  4ARW A;  2OI7 A;  1FXJ A;  1FXO A;  2FY7 A;  1E5K A;  4KPZ A;  4D11 A;  1OMX A;  3R2W A;  1R80 A;  5CMJ A;  2VXM A;  2RJ0 A;  2Z87 A;  4HO6 A;  1NKH B;  1ZI3 A;  2MZB A;  3OH4 A;  1PZT A;  1QGQ A;  2QKX A;  1VZU A;  5CQO A;  5C4F A;  4FRL A;  4EE4 A;  2RJ5 A;  3USQ A;  5C48 A;  3LW6 A;  1FOA A;  3ST8 A;  1VGZ A;  2JCL A;  4J18 A;  3SXG A;  1ZI5 A;  4FCU A;  3I0J A;  1IIN A;  5CMF X;  1G93 A;  4KRV A;  5CQN X;  3U2W A;  4B4B A;  4D48 A;  1GQC A;  1ZJ0 A;  4JD0 A;  4M2A A;  5IFY A;  1ZJ3 A;  1TW1 A;  1H5T B;  2XWM A;  3OH1 A;  3V8Y A;  4UEG A;  1TW5 A;  3ZGF A;  3Q7U A;  2APC A;  4B4M A;  1O7Q A;  3O3P A;  4B5B A;  4CJ8 A;  4FRO A;  2V0L A;  3BCV A;  1NQI B;  1JVD A;  1FWY A;  1VH1 A;  2FFV A;  5FU8 A;  2JCK A;  4FRH A;  2OEG A;  1H7T A;  2BO6 A;  1G1L A;  3CKJ A;  1ZCU A;  4AAW A;  1JVG A;  1MP3 A;  2PA4 A;  1LZ7 A;  2P6W A;  4HO0 A;  4DDZ A;  4Y7F A;  4HG6 A;  2JCJ A;  1ZI1 A;  2VSI A;  2AM4 A;  4AYL A;  1YP4 A;  1MP4 A;  2X5S A;  2RJ8 A;  4MND A;  5D92 A;  4KC4 A;  1FO8 A;  3I0C A;  1G95 A;  4IRQ A;  1G9R A;  1TZF A;  4M4K A;  2A8U A;  4ASJ A;  5J49 A;  4FIX A;  4B4G A;  2RJ6 A;  3I0K A;  2RJ4 A;  4Y62 A;  2VK9 A;  2RJ9 A;  4D0Z A;  2V0I A;  2WAW A;  4Y7U A;  2Q4J A;  2FFU A;  4FRM A;  1NMM B;  1ZJP A;  4XWI A;  4B2X A;  5IDS A;  5C3D A;  3HL3 A;  4FRD A;  2YC3 A;  5DDT A;  2AEC A;  3DUV A;  4D0T A;  1NHE B;  3OC9 A;  3T7O A;  2QH5 A;  1ZJ2 A;  3GUE A;  4LW3 A;  4Y7G A;  1V83 A;  4JIS A;  1ON6 A;  2Z86 A;  3I0H A;  4FCE A;  2WGZ A;  1O0R A;  3K8E A;  2VD4 A;  3CKV A;  3PNN A;  1R7X A;  1HM8 A;  1MC3 A;  3IOJ A;  3V0M A;  5IDT A;  3SX5 A;  5CQM X;  2AH9 A;  3I0E A;  5C1H A;  5FYE A;  2VXL A;  1YP3 A;  2Y4L A;  5FTV A;  1W55 A;  1V82 A;  1FO9 A;  1HJL A;  3CU0 A;  1GX4 A;  1FR9 A;  2WVM A;  2Y7A A;  3Q80 A;  5JQQ A;  1R7V A;  1YRO B;  2WE9 A;  4KNX A;  3ZLK A;  4L41 C;  1R82 A;  3V90 A;  4MYB A;  3SX7 A;  1SS9 A;  3RMV A;  2V0K A;  4EE5 A;  2FYB A;  4LW6 A;  3OH3 A;  5FUH A;  1H4D A;  2ZU8 A;  3T7N A;  1G3L A;  2PGY A;  2VFZ A;  4ECM A;  1H7L A;  1ZCV A;  5EIY A;  1ZCT A;  3SXA A;  1ZIZ A;  1H5S A;  4EE3 A;  3ZLL A;  5BXC A;  4NAN A;  5C4C A;  5C49 A;  4Y7T A;  3V0P A;  2J0A A;  4B3U A;  4BQH A;  5C4E A;  3OAM A;  5C36 A;  4DEC A;  1LL0 A;  1S4O A;  1H7F A;  1VGT A;  2AM5 A;  1FR8 A;  4CVH A;  3OKR A;  1GA8 A;  1OMZ A;  2P72 A;  1JYL A;  1ZCY A;  1H7G A;  3KIA A;  1GWV A;  3OH2 A;  5L6V A;  1WSZ A;  2WVL A;  3JUK A;  4K6R A;  2Y4J A;  2YQH A;  1H7H A;  2D7I A;  4FIY A;  3DK5 A;  2I5K A;  3E25 A;  5C38 A;  3D5N A;  4G3P A;  1ZI4 A;  3SXE A;  3IOH A;  1MP5 A;  4EEA A;  5AJO A;  1WVC A;  4AC3 A;  1FGG A;  4GBP A;  1WT1 A;  1H5S B;  3Q4S A;  1H4E A;  4P00 A;  4G3Q A;  3SXB A;  5C1G A;  1H7Q A;  3I0I X;  2BO4 A;  1PZY B;  3RMW A;  3CKO A;  4M28 A;  1TVY A;  2W0V A;  3U0Y A;  3ZGG A;  5C4D A;  1GX0 A;  2YQJ A;  4KC1 A;  3IOI A;  4M2B A;  1H5R A;  3N9W A;  3PKP A;  4Y7V A;  2AE7 A;  1LZI A;  4HO3 A;  3I0D A;  2XWL A;  1W77 A;  4KXO A;  2YQC A;  1IIM A;  1JV3 A;  1KWS A;  2X5Z A;  2OEF A;  5EJZ A;  3RSB A;  1WT3 A;  5FU0 A;  1LZ0 A;  2J0B A;  4YS8 A;  2RIT A;  2Y4K A;  5C4B A;  2GGO A;  3V0Q A;  3PKQ A;  4FRP A;  2D7R A;  3K8D A;  5FTS A;  2Y6P A;  2C0N A;  2WVK A;  5FV9 A;  2O1F A;  4P02 A;  3TQD A;  1V84 A;  1LL2 A;  2VS3 A;  3QVB A;  4ZDQ A;  1ZDG A;  4CJB A;  4FRA A;  5CMG X;  5CQP A;  1VPA A;  4ASY A;  1O7O A;  3OH0 A;  1R7U A;  4B42 A;  1R81 A;  5D91 A;  3TZT A;  3POL A;  3EE5 A;  3U2T A;  2D0J A;  1XZ6 A;  3V8Z A;  2RJ1 A;  1OQM B;  3DJ4 A;  3SPT A;  2YQS A;  2X60 A;  1Z90 A;  1H5R B;  3CKN A;  4KT7 A;  4KNR A;  2E3D A;  1VIC A;  3F1Y A;  4HCQ A;  2XME A;  5C3B A;  1H3M A;  4FRQ A;  2CU2 A;  1ZHJ A;  1FG5 N;  1H5T A;  3D98 A;  1FRW A;  5AJP A;  1G2V A;  3U0X A;  1XHB A;  2AES A;  2Y4M A;  3V91 A;  4DE7 A;  4HO5 A;  3CGX A;  1W57 A;  1YP2 A;  5CMI A;  3SXC A;  4CJC A;  4EVW A;  4NAI A;  3I0G A;  3JUJ A;  2QGI A;  2O1G A;  5L6S A;  1ZDF A;  1QG8 A;  1HV9 A;  1ON8 A;  2RIX A;  4KQL A;  3F1C A;  5DDV A;  5CQL X;  4BMA A;  4Y64 A;  4IRP A;  2YCM A;  4HO8 A;  1EZI A;  2RIZ A;  2YES A;  2AGD A;  3SX3 A;  3U2V A;  1NF5 B;  2OI5 A;  1VH3 A;  1HJJ A;  1QWJ A;  1I52 A;  3V0N A;  2X65 A;  3NGW A;  4G87 A;  1G23 A;  4O6M A;  3I0L A;  3V0L A;  1VGU A;  4Y63 A;  2O1H A; 
#chains in the Genus database with same CATH homology
 1VM8 A;  3E26 A;  2AM3 A;  2VS5 A;  5CMH A;  4FQW A;  2V0J A;  5C3A A;  2ZU7 A;  4Q7C A;  3USR A;  4E1K A;  3D8V A;  3R3I A;  4EEO A;  2XMH A;  2I5E A;  3U2U A;  4EEG A;  1QGS A;  1WT2 A;  2OI6 A;  2BO8 A;  4NAL A;  2P73 A;  3FOQ A;  2WEE A;  1VZT A;  1GWW A;  2YC5 A;  4Y6U A;  1S4P A;  5HS2 A;  4B2W A;  1VGW A;  4D11 C;  2FYD B;  1H7E A;  1K4V A;  4HO9 A;  1LZJ A;  1LL3 A;  2ICY A;  4KC2 A;  1JV1 A;  3JTJ A;  4AYJ A;  1HM0 A;  1INI A;  5EJ1 A;  5C8R A;  1EYR A;  1ZJ1 A;  4FRB A;  5I1F A;  1G97 A;  1ZJO A;  2FYC B;  3T7M A;  3U2X A;  3CKQ A;  1FGX A;  2W0W A;  4HOC A;  2I7B A;  1H5S D;  1O23 B;  2XWN A;  3FWW A;  4HO4 A;  2PGV A;  4R7P A;  1H4C A;  4FRE A;  4KPX A;  1FZW A;  4MIX A;  3SXD A;  2V0H A;  1WT0 A;  5C1L A;  4C2S A;  1H5S C;  2FYA A;  1G0R A;  1INJ A;  4NAK A;  2GGQ A;  2PX7 A;  2RIY A;  2ICX A;  5C47 A;  1R7T A;  2A8W A;  2NXV A;  2UX8 A;  4HO2 A;  1VZX A;  3ZF8 A;  1R7Y A;  1JYK A;  1S4N A;  4Y6N A;  4G3S A;  3OGZ A;  3I0F A;  2JCO A;  1HM9 A;  2DPW A;  3SX8 A;  1GQ9 A;  1LVW A;  2RJ7 A;  4EEM A;  2VSH A;  2E8B A;  4Y9X A;  2ZU9 A;  4O6N A;  3BRK X;  3V0O A;  5AJN A;  1G8O A;  2VS4 A;  1NWG B;  2BO7 A;  4ARW A;  2OI7 A;  1FXJ A;  1FXO A;  2FY7 A;  1E5K A;  4KPZ A;  4D11 A;  1OMX A;  3R2W A;  1R80 A;  5CMJ A;  2VXM A;  2RJ0 A;  2Z87 A;  4HO6 A;  1NKH B;  1ZI3 A;  2MZB A;  3OH4 A;  1PZT A;  1QGQ A;  2QKX A;  1VZU A;  5CQO A;  5C4F A;  4FRL A;  4EE4 A;  2RJ5 A;  3USQ A;  5C48 A;  3LW6 A;  1FOA A;  3ST8 A;  1VGZ A;  2JCL A;  4J18 A;  3SXG A;  1ZI5 A;  4FCU A;  3I0J A;  1IIN A;  5CMF X;  1G93 A;  4KRV A;  5CQN X;  3U2W A;  4B4B A;  4D48 A;  1GQC A;  1ZJ0 A;  4JD0 A;  4M2A A;  5IFY A;  1ZJ3 A;  1TW1 A;  1H5T B;  2XWM A;  3OH1 A;  3V8Y A;  4UEG A;  1TW5 A;  3ZGF A;  3Q7U A;  2APC A;  4B4M A;  1O7Q A;  3O3P A;  4B5B A;  4CJ8 A;  4FRO A;  2V0L A;  3BCV A;  1NQI B;  1JVD A;  1FWY A;  1VH1 A;  2FFV A;  5FU8 A;  2JCK A;  4FRH A;  2OEG A;  1H7T A;  2BO6 A;  1G1L A;  3CKJ A;  1ZCU A;  4AAW A;  1JVG A;  1MP3 A;  2PA4 A;  1LZ7 A;  2P6W A;  4HO0 A;  4DDZ A;  4Y7F A;  4HG6 A;  2JCJ A;  1ZI1 A;  2VSI A;  2AM4 A;  4AYL A;  1YP4 A;  1MP4 A;  2X5S A;  2RJ8 A;  4MND A;  5D92 A;  4KC4 A;  1FO8 A;  3I0C A;  1G95 A;  4IRQ A;  1G9R A;  1TZF A;  4M4K A;  2A8U A;  4ASJ A;  5J49 A;  4FIX A;  4B4G A;  2RJ6 A;  3I0K A;  2RJ4 A;  4Y62 A;  2VK9 A;  2RJ9 A;  4D0Z A;  2V0I A;  2WAW A;  4Y7U A;  2Q4J A;  2FFU A;  4FRM A;  1NMM B;  1ZJP A;  4XWI A;  4B2X A;  5IDS A;  5C3D A;  3HL3 A;  4FRD A;  2YC3 A;  5DDT A;  2AEC A;  3DUV A;  4D0T A;  1NHE B;  3OC9 A;  3T7O A;  2QH5 A;  1ZJ2 A;  3GUE A;  4LW3 A;  4Y7G A;  1V83 A;  4JIS A;  1ON6 A;  2Z86 A;  3I0H A;  4FCE A;  2WGZ A;  1O0R A;  3K8E A;  2VD4 A;  3CKV A;  3PNN A;  1R7X A;  1HM8 A;  1MC3 A;  3IOJ A;  3V0M A;  5IDT A;  3SX5 A;  5CQM X;  2AH9 A;  3I0E A;  5C1H A;  5FYE A;  2VXL A;  1YP3 A;  2Y4L A;  5FTV A;  1W55 A;  1V82 A;  1FO9 A;  1HJL A;  3CU0 A;  1GX4 A;  1FR9 A;  2WVM A;  2Y7A A;  3Q80 A;  5JQQ A;  1R7V A;  1YRO B;  2WE9 A;  4KNX A;  3ZLK A;  4L41 C;  1R82 A;  3V90 A;  4MYB A;  3SX7 A;  1SS9 A;  3RMV A;  2V0K A;  4EE5 A;  2FYB A;  4LW6 A;  3OH3 A;  5FUH A;  1H4D A;  2ZU8 A;  3T7N A;  1G3L A;  2PGY A;  2VFZ A;  4ECM A;  1H7L A;  1ZCV A;  5EIY A;  1ZCT A;  3SXA A;  1ZIZ A;  1H5S A;  4EE3 A;  3ZLL A;  5BXC A;  4NAN A;  5C4C A;  5C49 A;  4Y7T A;  3V0P A;  2J0A A;  4B3U A;  4BQH A;  5C4E A;  3OAM A;  5C36 A;  4DEC A;  1LL0 A;  1S4O A;  1H7F A;  1VGT A;  2AM5 A;  1FR8 A;  4CVH A;  3OKR A;  1GA8 A;  1OMZ A;  2P72 A;  1JYL A;  1ZCY A;  1H7G A;  3KIA A;  1GWV A;  3OH2 A;  5L6V A;  1WSZ A;  2WVL A;  3JUK A;  4K6R A;  2Y4J A;  2YQH A;  1H7H A;  2D7I A;  4FIY A;  3DK5 A;  2I5K A;  3E25 A;  5C38 A;  3D5N A;  4G3P A;  1ZI4 A;  3SXE A;  3IOH A;  1MP5 A;  4EEA A;  5AJO A;  1WVC A;  4AC3 A;  1FGG A;  4GBP A;  1WT1 A;  1H5S B;  3Q4S A;  1H4E A;  4P00 A;  4G3Q A;  3SXB A;  5C1G A;  1H7Q A;  3I0I X;  2BO4 A;  1PZY B;  3RMW A;  3CKO A;  4M28 A;  1TVY A;  2W0V A;  3U0Y A;  3ZGG A;  5C4D A;  1GX0 A;  2YQJ A;  4KC1 A;  3IOI A;  4M2B A;  1H5R A;  3N9W A;  3PKP A;  4Y7V A;  2AE7 A;  1LZI A;  4HO3 A;  3I0D A;  2XWL A;  1W77 A;  4KXO A;  2YQC A;  1IIM A;  1JV3 A;  1KWS A;  2X5Z A;  2OEF A;  5EJZ A;  3RSB A;  1WT3 A;  5FU0 A;  1LZ0 A;  2J0B A;  4YS8 A;  2RIT A;  2Y4K A;  5C4B A;  2GGO A;  3V0Q A;  3PKQ A;  4FRP A;  2D7R A;  3K8D A;  5FTS A;  2Y6P A;  2C0N A;  2WVK A;  5FV9 A;  2O1F A;  4P02 A;  3TQD A;  1V84 A;  1LL2 A;  2VS3 A;  3QVB A;  4ZDQ A;  1ZDG A;  4CJB A;  4FRA A;  5CMG X;  5CQP A;  1VPA A;  4ASY A;  1O7O A;  3OH0 A;  1R7U A;  4B42 A;  1R81 A;  5D91 A;  3TZT A;  3POL A;  3EE5 A;  3U2T A;  2D0J A;  1XZ6 A;  3V8Z A;  2RJ1 A;  1OQM B;  3DJ4 A;  3SPT A;  2YQS A;  2X60 A;  1Z90 A;  1H5R B;  3CKN A;  4KT7 A;  4KNR A;  2E3D A;  1VIC A;  3F1Y A;  4HCQ A;  2XME A;  5C3B A;  1H3M A;  4FRQ A;  2CU2 A;  1ZHJ A;  1FG5 N;  1H5T A;  3D98 A;  1FRW A;  5AJP A;  1G2V A;  3U0X A;  1XHB A;  2AES A;  2Y4M A;  3V91 A;  4DE7 A;  4HO5 A;  3CGX A;  1W57 A;  1YP2 A;  5CMI A;  3SXC A;  4CJC A;  4EVW A;  4NAI A;  3I0G A;  3JUJ A;  2QGI A;  2O1G A;  5L6S A;  1ZDF A;  1QG8 A;  1HV9 A;  1ON8 A;  2RIX A;  4KQL A;  3F1C A;  5DDV A;  5CQL X;  4BMA A;  4Y64 A;  4IRP A;  2YCM A;  4HO8 A;  1EZI A;  2RIZ A;  2YES A;  2AGD A;  3SX3 A;  3U2V A;  1NF5 B;  2OI5 A;  1VH3 A;  1HJJ A;  1QWJ A;  1I52 A;  3V0N A;  2X65 A;  3NGW A;  4G87 A;  1G23 A;  4O6M A;  3I0L A;  3V0L A;  1VGU A;  4Y63 A;  2O1H A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...