3PKQA

Q83d variant of s. enterica rmla with dgtp
Total Genus 97
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
97
sequence length
288
structure length
285
Chain Sequence
TRKGIILAGGSGTRLYPVTMAVSKQLLPIYDKPMIYYPLSTLMLAGIRDILIISTPQDTPRFQQLLGDGSQWGLNLQYKVDPSPDGLAQAFIIGEEFIGHDDCALVLGDNIFYGHDLPKLMEAAVNKESGATVFAYHVNDPERYGVVEFDTAVSLEEKPLQPKSNYAVTGLYFYDNSVVEMAKNLKPSARGELEITDINRIYMEQGRLSVAMMGRGYAWLDTGTHQSLIEASNFIATIEERQGLKVSCPEEIAFRKNFINAQQVIELAGPLSKNDYGKYLLKMVK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Glucose-1-phosphate thymidylyltransferase
publication title Expanding the Nucleotide and Sugar 1-Phosphate Promiscuity of Nucleotidyltransferase RmlA via Directed Evolution.
pubmed doi rcsb
source organism Salmonella enterica subsp. enterica serovar typhimurium
molecule tags Transferase
total genus 97
structure length 285
sequence length 288
chains with identical sequence B, C, D
ec nomenclature ec 2.7.7.24: Glucose-1-phosphate thymidylyltransferase.
pdb deposition date 2010-11-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00483 NTP_transferase Nucleotidyl transferase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.550.10 Alpha Beta Alpha-Beta Complex Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A 3pkqA00
1HJLA 1G97A 1PZTA 4LW3A 3TQDA 1QGSA 5C1GA 3FWWA 5FU8A 2XMEA 1FOAA 2XWLA 1R7TA 3LW6A 1H7TA 4HO5A 1YP4A 5JQQA 1Z90A 3V0OA 4EEOA 1LL2A 4Y62A 2PGVA 2BO4A 3ST8A 3SX7A 2V0IA 1ZI4A 1R7YA 2RJ4A 4FCEA 1WVCA 1H7GA 4AAWA 2RJ7A 3V8YA 1LL0A 1FGGA 2QKXA 2O1GA 3OH2A 4AYLA 3O3PA 4JISA 4KPXA 4KQLA 3SPTA 2YESA 5C1LA 2ZU8A 2Z87A 1INJA 4C2SA 1YROB 4B2WA 1VH3A 1V84A 1ZJ2A 5C4EA 1EYRA 2XWMA 1HM8A 4FRDA 5FV9A 4FRQA 4IRPA 2E8BA 1GWVA 3PKQA 1GX4A 2P72A 2JCOA 1GQ9A 1OQMB 4ASYA 4EEMA 2RJ8A 3U0YA 2JCJA 4KNXA 2X60A 4XWIA 1W55A 1ZIZA 1VPAA 5C1HA 4M4KA 1R7XA 4HO3A 1G8OA 2FFUA 3USRA 3OGZA 4AYJA 1XZ6A 4HO0A 4FRLA 1QG8A 4B2XA 3N9WA 3U2TA 3CKNA 1H4EA 4L41C 1H5SD 2JCKA 3I0LA 1JV1A 2CU2A 1JV3A 5CMHA 4FCUA 2V0HA 3U2VA 3I0DA 1QGQA 1MP3A 2Y4KA 1OMZA 1OMXA 4HCQA 4Y7FA 1GQCA 1NQIB 1FWYA 4G3SA 4FREA 2WVKA 4HO6A 4P00A 2MZBA 2QGIA 4K6RA 3SX3A 4FRAA 4D0ZA 1ZCVA 4BMAA 5FU0A 1VGWA 2AE7A 2JCLA 5CQPA 3GUEA 2Z86A 3SXDA 3Q80A 3POLA 4Y6NA 1R82A 3F1CA 4G87A 4G3QA 3I0CA 2UX8A 3NGWA 3K8DA 1H3MA 3E26A 1R81A 5FTVA 2RJ5A 3SXEA 3T7OA 3I0IX 3V0NA 5L6SA 2VFZA 1H5TB 2A8UA 1G9RA 1LZJA 5AJOA 1W57A 1VH1A 3I0JA 5IDSA 1LL3A 2AESA 1NKHB 2PX7A 2WEEA 2RJ6A 4Y64A 4EE4A 4ASJA 3EE5A 5HS2A 1VZTA 3SXCA 1WT2A 1FO9A 1ZHJA 1S4NA 2XMHA 3CKOA 2V0LA 3BRKX 4UEGA 3U0XA 3E25A 1ZDGA 2OI6A 5BXCA 1O23B 2AECA 3SXGA 1FRWA 4KNRA 1H7EA 1JYKA 4MYBA 5AJNA 5IFYA 5C3DA 3D98A 1WT1A 2AM4A 1IIMA 2FY7A 2Y4JA 5CMGX 1O0RA 1W77A 5CQLX 2WAWA 1FG5N 1G23A 1LZ7A 1ZCYA 2APCA 3V0QA 3Q4SA 4B3UA 1ON6A 3SX5A 1O7OA 3JUKA 4Y7GA 4B42A 2RIYA 2ZU7A 1ZJOA 1H7HA 1FR8A 4KXOA 4HO9A 1G3LA 4CJ8A 4EEAA 2I5KA 2FYDB 4Y7TA 1H5SB 3PNNA 1G93A 5CMIA 4EE5A 1O7QA 1H7LA 1E5KA 3KIAA 1ZCTA 5C8RA 1ZI5A 1SS9A 1EZIA 5C48A 1S4PA 1NMMB 2RJ9A 2O1FA 2Y7AA 3V90A 1H4DA 2AM3A 4EE3A 2X5SA 1TZFA 3U2UA 1WSZA 1VGTA 3IOJA 5C36A 3K8EA 4HO2A 1I52A 1ZCUA 1G0RA 2V0JA 2WVLA 5CMJA 1H5RA 4KPZA 5J49A 2VS4A 1JVDA 3V0PA 4HOCA 3CKQA 3HL3A 4D11C 2D7IA 5CMFX 4J18A 1ON8A 4B4BA 3ZLLA 3PKPA 1V83A 4R7PA 4M2BA 2YC3A 1LZIA 2PA4A 4LW6A 1WT3A 3U2WA 4EVWA 2RIXA 1YP3A 1G1LA 4YS8A 5EJ1A 5DDTA 4NAKA 5L6VA 2YCMA 2BO8A 1NHEB 2PGYA 2V0KA 1NF5B 3V0LA 3OH0A 4Y63A 5DDVA 3CKJA 2VSIA 2I7BA 4AC3A 3V91A 5FUHA 4DECA 1XHBA 3ZGFA 4EEGA 1JVGA 5C4BA 4DDZA 4E1KA 1TW1A 5FTSA 3T7MA 1G95A 1LVWA 1H4CA 1ZJ1A 2I5EA 2W0VA 5C4FA 3QVBA 1FR9A 1PZYB 2QH5A 4FROA 1R7VA 2YQJA 4KC2A 2VXMA 5CQNX 5EJZA 2X65A 2X5ZA 3I0EA 2OEGA 1H5SC 1ZDFA 1FGXA 5C38A 2AGDA 3RMVA 1MP4A 2OI7A 1H7QA 2YQSA 4DE7A 2VSHA 3DK5A 3BCVA 4FQWA 1IINA 5AJPA 3TZTA 2BO6A 2GGOA 4B4MA 1NWGB 4B5BA 1ZI1A 2ICXA 5I1FA 4HO8A 3R2WA 2A8WA 4ECMA 3I0HA 1HM9A 4KC1A 3ZF8A 3CKVA 4CJBA 3IOHA 2FYCB 4IRQA 2RJ0A 3OH4A 1ZI3A 2ICYA 2P6WA 3OAMA 1H5SA 1MC3A 4Y7VA 2VXLA 3V0MA 2D0JA 2BO7A 2E3DA 2YQHA 4M2AA 1YP2A 1GA8A 3SXBA 5C49A 1S4OA 3Q7UA 3CU0A 4MNDA 1HM0A 2D7RA 4BQHA 5C3BA 3F1YA 1VGUA 2VD4A 2FFVA 4GBPA 3SX8A 4KT7A 1FZWA 3ZGGA 3RSBA 4ZDQA 4NANA 5C4CA 1FXOA 3OKRA 4G3PA 3T7NA 2WVMA 4HO4A 3ZLKA 2GGQA 1VZXA 2WE9A 4P02A 1R7UA 1FO8A 1K4VA 3SXAA 1FXJA 2AH9A 1VZUA 3DJ4A 4D48A 1VICA 2FYBA 3IOIA 1VM8A 4KC4A 2AM5A 2RJ1A 4HG6A 3RMWA 4JD0A 4NALA 2NXVA 2VS3A 4D0TA 3OH1A 3OC9A 1GX0A 2OI5A 2P73A 1JYLA 2Q4JA 5C47A 5EIYA 5IDTA 3V8ZA 4Y7UA 4ARWA 2RIZA 2Y4MA 4FRBA 1INIA 4FRPA 3DUVA 1ZJ3A 2YC5A 1KWSA 4KRVA 1VGZA 2W0WA 2XWNA 3I0GA 2WGZA 4FRMA 5C3AA 3U2XA 1QWJA 1H5TA 3I0KA 1H5RB 2DPWA 4FRHA 4CVHA 2YQCA 5CQOA 3JTJA 5FYEA 1R80A 5C4DA 1WT0A 1H7FA 4D11A 4B4GA 3D8VA 1GWWA 1G2VA 4CJCA 2ZU9A 3FOQA 2OEFA 4Y6UA 1HV9A 3R3IA 2RITA 4M28A 1TW5A 1ZJ0A 1ZJPA 1LZ0A 1MP5A 1TVYA 1V82A 3I0FA 2O1HA 3OH3A 2FYAA 1HJJA 5CQMX 4Y9XA 2VS5A 3D5NA 3CGXA 4NAIA 2Y6PA 3JUJA 3USQA 2Y4LA
chains in the Genus database with same CATH superfamily
1HJLA 1G97A 1PZTA 4LW3A 3TQDA 1QGSA 5C1GA 3FWWA 5FU8A 2XMEA 1FOAA 2XWLA 1R7TA 3LW6A 1H7TA 4HO5A 1YP4A 5JQQA 1Z90A 3V0OA 4EEOA 1LL2A 4Y62A 2PGVA 2BO4A 3ST8A 3SX7A 2V0IA 1ZI4A 1R7YA 2RJ4A 4FCEA 1WVCA 1H7GA 4AAWA 2RJ7A 3V8YA 1LL0A 1FGGA 2QKXA 2O1GA 3OH2A 4AYLA 3O3PA 4JISA 4KPXA 4KQLA 3SPTA 2YESA 5C1LA 2ZU8A 2Z87A 1INJA 4C2SA 1YROB 4B2WA 1VH3A 1V84A 1ZJ2A 5C4EA 1EYRA 2XWMA 1HM8A 4FRDA 5FV9A 4FRQA 4IRPA 2E8BA 1GWVA 3PKQA 1GX4A 2P72A 2JCOA 1GQ9A 1OQMB 4ASYA 4EEMA 2RJ8A 3U0YA 2JCJA 4KNXA 2X60A 4XWIA 5D91A 1W55A 1ZIZA 1VPAA 5C1HA 4M4KA 1R7XA 4HO3A 1G8OA 2FFUA 3USRA 3OGZA 4AYJA 1XZ6A 4HO0A 4FRLA 1QG8A 4B2XA 3N9WA 3U2TA 3CKNA 1H4EA 4L41C 1H5SD 2JCKA 3I0LA 1JV1A 2CU2A 1JV3A 5CMHA 4FCUA 2V0HA 3U2VA 3I0DA 1QGQA 4O6NA 1MP3A 2Y4KA 1OMZA 1OMXA 4HCQA 4Y7FA 1GQCA 1NQIB 1FWYA 4G3SA 4FREA 2WVKA 4HO6A 4P00A 2MZBA 2QGIA 4K6RA 3SX3A 4FRAA 4D0ZA 1ZCVA 4BMAA 5FU0A 1VGWA 4Q7CA 2AE7A 2JCLA 5CQPA 3GUEA 2Z86A 3SXDA 3Q80A 3POLA 4Y6NA 1R82A 3F1CA 4G87A 4G3QA 3I0CA 2UX8A 3NGWA 3K8DA 1H3MA 3E26A 1R81A 5FTVA 2RJ5A 3SXEA 3T7OA 3I0IX 3V0NA 5L6SA 2VFZA 1H5TB 2A8UA 1G9RA 1LZJA 5AJOA 1W57A 1VH1A 3I0JA 5IDSA 1LL3A 2AESA 1NKHB 2PX7A 2WEEA 2RJ6A 4Y64A 4EE4A 4ASJA 3EE5A 5HS2A 1VZTA 3SXCA 1WT2A 1FO9A 1ZHJA 1S4NA 2XMHA 3CKOA 2V0LA 3BRKX 4UEGA 3U0XA 3E25A 1ZDGA 2OI6A 5BXCA 1O23B 2AECA 3SXGA 1FRWA 4KNRA 1H7EA 1JYKA 4MIXA 4MYBA 5AJNA 5IFYA 5C3DA 3D98A 1WT1A 2AM4A 1IIMA 2FY7A 2Y4JA 5CMGX 1O0RA 1W77A 5CQLX 2WAWA 1FG5N 1G23A 1LZ7A 1ZCYA 2APCA 3V0QA 3Q4SA 4B3UA 1ON6A 3SX5A 1O7OA 3JUKA 4Y7GA 4B42A 2RIYA 2ZU7A 1ZJOA 1H7HA 1FR8A 4KXOA 4HO9A 1G3LA 4CJ8A 4EEAA 2I5KA 2FYDB 4Y7TA 1H5SB 3PNNA 1G93A 5CMIA 4EE5A 1O7QA 1H7LA 1E5KA 3KIAA 1ZCTA 5C8RA 1ZI5A 1SS9A 1EZIA 5C48A 1S4PA 1NMMB 2RJ9A 2O1FA 2Y7AA 3V90A 1H4DA 2AM3A 4EE3A 2X5SA 1TZFA 3U2UA 1WSZA 1VGTA 3IOJA 5C36A 3K8EA 4HO2A 1I52A 1ZCUA 1G0RA 2V0JA 2WVLA 5CMJA 1H5RA 4KPZA 5J49A 2VS4A 1JVDA 3V0PA 4HOCA 3CKQA 3HL3A 4D11C 2D7IA 5CMFX 4J18A 1ON8A 4B4BA 3ZLLA 3PKPA 1V83A 4R7PA 4M2BA 2YC3A 1LZIA 2PA4A 4LW6A 1WT3A 3U2WA 4EVWA 2RIXA 1YP3A 1G1LA 4YS8A 5EJ1A 5DDTA 4NAKA 5L6VA 2YCMA 2BO8A 1NHEB 2PGYA 2V0KA 1NF5B 3V0LA 3OH0A 4Y63A 5DDVA 3CKJA 2VSIA 2I7BA 4AC3A 3V91A 5FUHA 4DECA 1XHBA 3ZGFA 4EEGA 1JVGA 5C4BA 4DDZA 4E1KA 1TW1A 5FTSA 3T7MA 1G95A 1LVWA 1H4CA 1ZJ1A 2I5EA 2W0VA 5C4FA 3QVBA 1FR9A 1PZYB 2QH5A 4FROA 4FIXA 1R7VA 2YQJA 4KC2A 2VXMA 5CQNX 5EJZA 2X65A 2X5ZA 3I0EA 4O6MA 2OEGA 1H5SC 1ZDFA 1FGXA 5C38A 2AGDA 3RMVA 1MP4A 2OI7A 1H7QA 5D92A 2YQSA 4DE7A 2VSHA 3DK5A 3BCVA 4FQWA 1IINA 5AJPA 3TZTA 2BO6A 2GGOA 4B4MA 1NWGB 4B5BA 1ZI1A 2J0AA 2ICXA 5I1FA 4HO8A 3R2WA 2VK9A 2A8WA 4ECMA 3I0HA 1HM9A 4KC1A 3ZF8A 3CKVA 4CJBA 3IOHA 2FYCB 4IRQA 2RJ0A 3OH4A 1ZI3A 2ICYA 2P6WA 3OAMA 1H5SA 1MC3A 4Y7VA 2VXLA 3V0MA 2D0JA 2BO7A 2E3DA 2YQHA 4M2AA 1YP2A 1GA8A 3SXBA 5C49A 1S4OA 3Q7UA 3CU0A 4MNDA 1HM0A 2D7RA 4BQHA 5C3BA 3F1YA 1VGUA 2VD4A 2FFVA 4GBPA 3SX8A 4KT7A 2J0BA 1FZWA 3ZGGA 3RSBA 4ZDQA 4NANA 5C4CA 1FXOA 3OKRA 4G3PA 3T7NA 2WVMA 4HO4A 3ZLKA 2GGQA 1VZXA 2WE9A 4P02A 1R7UA 1FO8A 1K4VA 3SXAA 1FXJA 2AH9A 1VZUA 3DJ4A 4D48A 1VICA 2FYBA 3IOIA 1VM8A 4KC4A 2AM5A 2RJ1A 4HG6A 3RMWA 4JD0A 4NALA 2NXVA 2VS3A 4D0TA 3OH1A 3OC9A 1GX0A 2OI5A 2P73A 1JYLA 2Q4JA 5C47A 5EIYA 5IDTA 3V8ZA 4Y7UA 4ARWA 2RIZA 2Y4MA 4FRBA 1INIA 4FRPA 3DUVA 1ZJ3A 2YC5A 1KWSA 4KRVA 1VGZA 2W0WA 2XWNA 3I0GA 2WGZA 4FRMA 5C3AA 3U2XA 1QWJA 1H5TA 3I0KA 1H5RB 2DPWA 4FRHA 4CVHA 2YQCA 5CQOA 3JTJA 4FIYA 1R80A 5FYEA 5C4DA 1WT0A 1H7FA 4D11A 4B4GA 3D8VA 1GWWA 1G2VA 4CJCA 2ZU9A 3FOQA 2OEFA 4Y6UA 1HV9A 3R3IA 2RITA 4M28A 1TW5A 1ZJ0A 1ZJPA 1LZ0A 1MP5A 1TVYA 1V82A 3I0FA 2O1HA 3OH3A 2FYAA 1HJJA 5CQMX 4Y9XA 2VS5A 3D5NA 3CGXA 4NAIA 2Y6PA 3JUJA 3USQA 2C0NA 2Y4LA
chains in the Genus database with same CATH topology
1HJLA 1G97A 1PZTA 4LW3A 3TQDA 1QGSA 5C1GA 3FWWA 5FU8A 2XMEA 1FOAA 2XWLA 1R7TA 3LW6A 1H7TA 4HO5A 1YP4A 5JQQA 1Z90A 3V0OA 4EEOA 1LL2A 4Y62A 2PGVA 2BO4A 3ST8A 3SX7A 2V0IA 1ZI4A 1R7YA 2RJ4A 4FCEA 1WVCA 1H7GA 4AAWA 2RJ7A 3V8YA 1LL0A 1FGGA 2QKXA 2O1GA 3OH2A 4AYLA 3O3PA 4JISA 4KPXA 4KQLA 3SPTA 2YESA 5C1LA 2ZU8A 2Z87A 1INJA 4C2SA 1YROB 4B2WA 1VH3A 1V84A 1ZJ2A 5C4EA 1EYRA 2XWMA 1HM8A 4FRDA 5FV9A 4FRQA 4IRPA 2E8BA 1GWVA 3PKQA 1GX4A 2P72A 2JCOA 1GQ9A 1OQMB 4ASYA 4EEMA 2RJ8A 3U0YA 2JCJA 4KNXA 2X60A 4XWIA 5D91A 1W55A 1ZIZA 1VPAA 5C1HA 4M4KA 1R7XA 4HO3A 1G8OA 2FFUA 3USRA 3OGZA 4AYJA 1XZ6A 4HO0A 4FRLA 1QG8A 4B2XA 3N9WA 3U2TA 3CKNA 1H4EA 4L41C 1H5SD 2JCKA 3I0LA 1JV1A 2CU2A 1JV3A 5CMHA 4FCUA 2V0HA 3U2VA 3I0DA 1QGQA 4O6NA 1MP3A 2Y4KA 1OMZA 1OMXA 4HCQA 4Y7FA 1GQCA 1NQIB 1FWYA 4G3SA 4FREA 2WVKA 4HO6A 4P00A 2MZBA 2QGIA 4K6RA 3SX3A 4FRAA 4D0ZA 1ZCVA 4BMAA 5FU0A 1VGWA 4Q7CA 2AE7A 2JCLA 5CQPA 3GUEA 2Z86A 3SXDA 3Q80A 3POLA 4Y6NA 1R82A 3F1CA 4G87A 4G3QA 3I0CA 2UX8A 3NGWA 3K8DA 1H3MA 3E26A 1R81A 5FTVA 2RJ5A 3SXEA 3T7OA 3I0IX 3V0NA 5L6SA 2VFZA 1H5TB 2A8UA 1G9RA 1LZJA 5AJOA 1W57A 1VH1A 3I0JA 5IDSA 1LL3A 2AESA 1NKHB 2PX7A 2WEEA 2RJ6A 4Y64A 4EE4A 4ASJA 3EE5A 5HS2A 1VZTA 3SXCA 1WT2A 1FO9A 1ZHJA 1S4NA 2XMHA 3CKOA 2V0LA 3BRKX 4UEGA 3U0XA 3E25A 1ZDGA 2OI6A 5BXCA 1O23B 2AECA 3SXGA 1FRWA 4KNRA 1H7EA 1JYKA 4MIXA 4MYBA 5AJNA 5IFYA 5C3DA 3D98A 1WT1A 2AM4A 1IIMA 2FY7A 2Y4JA 5CMGX 1O0RA 1W77A 5CQLX 2WAWA 1FG5N 1G23A 1LZ7A 1ZCYA 2APCA 3V0QA 3Q4SA 4B3UA 1ON6A 3SX5A 1O7OA 3JUKA 4Y7GA 4B42A 2RIYA 2ZU7A 1ZJOA 1H7HA 1FR8A 4KXOA 4HO9A 1G3LA 4CJ8A 4EEAA 2I5KA 2FYDB 4Y7TA 1H5SB 3PNNA 1G93A 5CMIA 4EE5A 1O7QA 1H7LA 1E5KA 3KIAA 1ZCTA 5C8RA 1ZI5A 1SS9A 1EZIA 5C48A 1S4PA 1NMMB 2RJ9A 2O1FA 2Y7AA 3V90A 1H4DA 2AM3A 4EE3A 2X5SA 1TZFA 3U2UA 1WSZA 1VGTA 3IOJA 5C36A 3K8EA 4HO2A 1I52A 1ZCUA 1G0RA 2V0JA 2WVLA 5CMJA 1H5RA 4KPZA 5J49A 2VS4A 1JVDA 3V0PA 4HOCA 3CKQA 3HL3A 4D11C 2D7IA 5CMFX 4J18A 1ON8A 4B4BA 3ZLLA 3PKPA 1V83A 4R7PA 4M2BA 2YC3A 1LZIA 2PA4A 4LW6A 1WT3A 3U2WA 4EVWA 2RIXA 1YP3A 1G1LA 4YS8A 5EJ1A 5DDTA 4NAKA 5L6VA 2YCMA 2BO8A 1NHEB 2PGYA 2V0KA 1NF5B 3V0LA 3OH0A 4Y63A 5DDVA 3CKJA 2VSIA 2I7BA 4AC3A 3V91A 5FUHA 4DECA 1XHBA 3ZGFA 4EEGA 1JVGA 5C4BA 4DDZA 4E1KA 1TW1A 5FTSA 3T7MA 1G95A 1LVWA 1H4CA 1ZJ1A 2I5EA 2W0VA 5C4FA 3QVBA 1FR9A 1PZYB 2QH5A 4FROA 4FIXA 1R7VA 2YQJA 4KC2A 2VXMA 5CQNX 5EJZA 2X65A 2X5ZA 3I0EA 4O6MA 2OEGA 1H5SC 1ZDFA 1FGXA 5C38A 2AGDA 3RMVA 1MP4A 2OI7A 1H7QA 5D92A 2YQSA 4DE7A 2VSHA 3DK5A 3BCVA 4FQWA 1IINA 5AJPA 3TZTA 2BO6A 2GGOA 4B4MA 1NWGB 4B5BA 1ZI1A 2J0AA 2ICXA 5I1FA 4HO8A 3R2WA 2VK9A 2A8WA 4ECMA 3I0HA 1HM9A 4KC1A 3ZF8A 3CKVA 4CJBA 3IOHA 2FYCB 4IRQA 2RJ0A 3OH4A 1ZI3A 2ICYA 2P6WA 3OAMA 1H5SA 1MC3A 4Y7VA 2VXLA 3V0MA 2D0JA 2BO7A 2E3DA 2YQHA 4M2AA 1YP2A 1GA8A 3SXBA 5C49A 1S4OA 3Q7UA 3CU0A 4MNDA 1HM0A 2D7RA 4BQHA 5C3BA 3F1YA 1VGUA 2VD4A 2FFVA 4GBPA 3SX8A 4KT7A 2J0BA 1FZWA 3ZGGA 3RSBA 4ZDQA 4NANA 5C4CA 1FXOA 3OKRA 4G3PA 3T7NA 2WVMA 4HO4A 3ZLKA 2GGQA 1VZXA 2WE9A 4P02A 1R7UA 1FO8A 1K4VA 3SXAA 1FXJA 2AH9A 1VZUA 3DJ4A 4D48A 1VICA 2FYBA 3IOIA 1VM8A 4KC4A 2AM5A 2RJ1A 4HG6A 3RMWA 4JD0A 4NALA 2NXVA 2VS3A 4D0TA 3OH1A 3OC9A 1GX0A 2OI5A 2P73A 1JYLA 2Q4JA 5C47A 5EIYA 5IDTA 3V8ZA 4Y7UA 4ARWA 2RIZA 2Y4MA 4FRBA 1INIA 4FRPA 3DUVA 1ZJ3A 2YC5A 1KWSA 4KRVA 1VGZA 2W0WA 2XWNA 3I0GA 2WGZA 4FRMA 5C3AA 3U2XA 1QWJA 1H5TA 3I0KA 1H5RB 2DPWA 4FRHA 4CVHA 2YQCA 5CQOA 3JTJA 4FIYA 1R80A 5FYEA 5C4DA 1WT0A 1H7FA 4D11A 4B4GA 3D8VA 1GWWA 1G2VA 4CJCA 2ZU9A 3FOQA 2OEFA 4Y6UA 1HV9A 3R3IA 2RITA 4M28A 1TW5A 1ZJ0A 1ZJPA 1LZ0A 1MP5A 1TVYA 1V82A 3I0FA 2O1HA 3OH3A 2FYAA 1HJJA 5CQMX 4Y9XA 2VS5A 3D5NA 3CGXA 4NAIA 2Y6PA 3JUJA 3USQA 2C0NA 2Y4LA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1HJL A;  1G97 A;  1PZT A;  4LW3 A;  3TQD A;  1QGS A;  5C1G A;  3FWW A;  5FU8 A;  2XME A;  1FOA A;  2XWL A;  1R7T A;  3LW6 A;  1H7T A;  4HO5 A;  1YP4 A;  5JQQ A;  1Z90 A;  3V0O A;  4EEO A;  1LL2 A;  4Y62 A;  2PGV A;  2BO4 A;  3ST8 A;  3SX7 A;  2V0I A;  1ZI4 A;  1R7Y A;  2RJ4 A;  4FCE A;  1WVC A;  1H7G A;  4AAW A;  2RJ7 A;  3V8Y A;  1LL0 A;  1FGG A;  2QKX A;  2O1G A;  3OH2 A;  4AYL A;  3O3P A;  4JIS A;  4KPX A;  4KQL A;  3SPT A;  2YES A;  5C1L A;  2ZU8 A;  2Z87 A;  1INJ A;  4C2S A;  1YRO B;  4B2W A;  1VH3 A;  1V84 A;  1ZJ2 A;  5C4E A;  1EYR A;  2XWM A;  1HM8 A;  4FRD A;  5FV9 A;  4FRQ A;  4IRP A;  2E8B A;  1GWV A;  3PKQ A;  1GX4 A;  2P72 A;  2JCO A;  1GQ9 A;  1OQM B;  4ASY A;  4EEM A;  2RJ8 A;  3U0Y A;  2JCJ A;  4KNX A;  2X60 A;  4XWI A;  1W55 A;  1ZIZ A;  1VPA A;  5C1H A;  4M4K A;  1R7X A;  4HO3 A;  1G8O A;  2FFU A;  3USR A;  3OGZ A;  4AYJ A;  1XZ6 A;  4HO0 A;  4FRL A;  1QG8 A;  4B2X A;  3N9W A;  3U2T A;  3CKN A;  1H4E A;  4L41 C;  1H5S D;  2JCK A;  3I0L A;  1JV1 A;  2CU2 A;  1JV3 A;  5CMH A;  4FCU A;  2V0H A;  3U2V A;  3I0D A;  1QGQ A;  1MP3 A;  2Y4K A;  1OMZ A;  1OMX A;  4HCQ A;  4Y7F A;  1GQC A;  1NQI B;  1FWY A;  4G3S A;  4FRE A;  2WVK A;  4HO6 A;  4P00 A;  2MZB A;  2QGI A;  4K6R A;  3SX3 A;  4FRA A;  4D0Z A;  1ZCV A;  4BMA A;  5FU0 A;  1VGW A;  2AE7 A;  2JCL A;  5CQP A;  3GUE A;  2Z86 A;  3SXD A;  3Q80 A;  3POL A;  4Y6N A;  1R82 A;  3F1C A;  4G87 A;  4G3Q A;  3I0C A;  2UX8 A;  3NGW A;  3K8D A;  1H3M A;  3E26 A;  1R81 A;  5FTV A;  2RJ5 A;  3SXE A;  3T7O A;  3I0I X;  3V0N A;  5L6S A;  2VFZ A;  1H5T B;  2A8U A;  1G9R A;  1LZJ A;  5AJO A;  1W57 A;  1VH1 A;  3I0J A;  5IDS A;  1LL3 A;  2AES A;  1NKH B;  2PX7 A;  2WEE A;  2RJ6 A;  4Y64 A;  4EE4 A;  4ASJ A;  3EE5 A;  5HS2 A;  1VZT A;  3SXC A;  1WT2 A;  1FO9 A;  1ZHJ A;  1S4N A;  2XMH A;  3CKO A;  2V0L A;  3BRK X;  4UEG A;  3U0X A;  3E25 A;  1ZDG A;  2OI6 A;  5BXC A;  1O23 B;  2AEC A;  3SXG A;  1FRW A;  4KNR A;  1H7E A;  1JYK A;  4MYB A;  5AJN A;  5IFY A;  5C3D A;  3D98 A;  1WT1 A;  2AM4 A;  1IIM A;  2FY7 A;  2Y4J A;  5CMG X;  1O0R A;  1W77 A;  5CQL X;  2WAW A;  1FG5 N;  1G23 A;  1LZ7 A;  1ZCY A;  2APC A;  3V0Q A;  3Q4S A;  4B3U A;  1ON6 A;  3SX5 A;  1O7O A;  3JUK A;  4Y7G A;  4B42 A;  2RIY A;  2ZU7 A;  1ZJO A;  1H7H A;  1FR8 A;  4KXO A;  4HO9 A;  1G3L A;  4CJ8 A;  4EEA A;  2I5K A;  2FYD B;  4Y7T A;  1H5S B;  3PNN A;  1G93 A;  5CMI A;  4EE5 A;  1O7Q A;  1H7L A;  1E5K A;  3KIA A;  1ZCT A;  5C8R A;  1ZI5 A;  1SS9 A;  1EZI A;  5C48 A;  1S4P A;  1NMM B;  2RJ9 A;  2O1F A;  2Y7A A;  3V90 A;  1H4D A;  2AM3 A;  4EE3 A;  2X5S A;  1TZF A;  3U2U A;  1WSZ A;  1VGT A;  3IOJ A;  5C36 A;  3K8E A;  4HO2 A;  1I52 A;  1ZCU A;  1G0R A;  2V0J A;  2WVL A;  5CMJ A;  1H5R A;  4KPZ A;  5J49 A;  2VS4 A;  1JVD A;  3V0P A;  4HOC A;  3CKQ A;  3HL3 A;  4D11 C;  2D7I A;  5CMF X;  4J18 A;  1ON8 A;  4B4B A;  3ZLL A;  3PKP A;  1V83 A;  4R7P A;  4M2B A;  2YC3 A;  1LZI A;  2PA4 A;  4LW6 A;  1WT3 A;  3U2W A;  4EVW A;  2RIX A;  1YP3 A;  1G1L A;  4YS8 A;  5EJ1 A;  5DDT A;  4NAK A;  5L6V A;  2YCM A;  2BO8 A;  1NHE B;  2PGY A;  2V0K A;  1NF5 B;  3V0L A;  3OH0 A;  4Y63 A;  5DDV A;  3CKJ A;  2VSI A;  2I7B A;  4AC3 A;  3V91 A;  5FUH A;  4DEC A;  1XHB A;  3ZGF A;  4EEG A;  1JVG A;  5C4B A;  4DDZ A;  4E1K A;  1TW1 A;  5FTS A;  3T7M A;  1G95 A;  1LVW A;  1H4C A;  1ZJ1 A;  2I5E A;  2W0V A;  5C4F A;  3QVB A;  1FR9 A;  1PZY B;  2QH5 A;  4FRO A;  1R7V A;  2YQJ A;  4KC2 A;  2VXM A;  5CQN X;  5EJZ A;  2X65 A;  2X5Z A;  3I0E A;  2OEG A;  1H5S C;  1ZDF A;  1FGX A;  5C38 A;  2AGD A;  3RMV A;  1MP4 A;  2OI7 A;  1H7Q A;  2YQS A;  4DE7 A;  2VSH A;  3DK5 A;  3BCV A;  4FQW A;  1IIN A;  5AJP A;  3TZT A;  2BO6 A;  2GGO A;  4B4M A;  1NWG B;  4B5B A;  1ZI1 A;  2ICX A;  5I1F A;  4HO8 A;  3R2W A;  2A8W A;  4ECM A;  3I0H A;  1HM9 A;  4KC1 A;  3ZF8 A;  3CKV A;  4CJB A;  3IOH A;  2FYC B;  4IRQ A;  2RJ0 A;  3OH4 A;  1ZI3 A;  2ICY A;  2P6W A;  3OAM A;  1H5S A;  1MC3 A;  4Y7V A;  2VXL A;  3V0M A;  2D0J A;  2BO7 A;  2E3D A;  2YQH A;  4M2A A;  1YP2 A;  1GA8 A;  3SXB A;  5C49 A;  1S4O A;  3Q7U A;  3CU0 A;  4MND A;  1HM0 A;  2D7R A;  4BQH A;  5C3B A;  3F1Y A;  1VGU A;  2VD4 A;  2FFV A;  4GBP A;  3SX8 A;  4KT7 A;  1FZW A;  3ZGG A;  3RSB A;  4ZDQ A;  4NAN A;  5C4C A;  1FXO A;  3OKR A;  4G3P A;  3T7N A;  2WVM A;  4HO4 A;  3ZLK A;  2GGQ A;  1VZX A;  2WE9 A;  4P02 A;  1R7U A;  1FO8 A;  1K4V A;  3SXA A;  1FXJ A;  2AH9 A;  1VZU A;  3DJ4 A;  4D48 A;  1VIC A;  2FYB A;  3IOI A;  1VM8 A;  4KC4 A;  2AM5 A;  2RJ1 A;  4HG6 A;  3RMW A;  4JD0 A;  4NAL A;  2NXV A;  2VS3 A;  4D0T A;  3OH1 A;  3OC9 A;  1GX0 A;  2OI5 A;  2P73 A;  1JYL A;  2Q4J A;  5C47 A;  5EIY A;  5IDT A;  3V8Z A;  4Y7U A;  4ARW A;  2RIZ A;  2Y4M A;  4FRB A;  1INI A;  4FRP A;  3DUV A;  1ZJ3 A;  2YC5 A;  1KWS A;  4KRV A;  1VGZ A;  2W0W A;  2XWN A;  3I0G A;  2WGZ A;  4FRM A;  5C3A A;  3U2X A;  1QWJ A;  1H5T A;  3I0K A;  1H5R B;  2DPW A;  4FRH A;  4CVH A;  2YQC A;  5CQO A;  3JTJ A;  5FYE A;  1R80 A;  5C4D A;  1WT0 A;  1H7F A;  4D11 A;  4B4G A;  3D8V A;  1GWW A;  1G2V A;  4CJC A;  2ZU9 A;  3FOQ A;  2OEF A;  4Y6U A;  1HV9 A;  3R3I A;  2RIT A;  4M28 A;  1TW5 A;  1ZJ0 A;  1ZJP A;  1LZ0 A;  1MP5 A;  1TVY A;  1V82 A;  3I0F A;  2O1H A;  3OH3 A;  2FYA A;  1HJJ A;  5CQM X;  4Y9X A;  2VS5 A;  3D5N A;  3CGX A;  4NAI A;  2Y6P A;  3JUJ A;  3USQ A;  2Y4L A; 
#chains in the Genus database with same CATH topology
 1HJL A;  1G97 A;  1PZT A;  4LW3 A;  3TQD A;  1QGS A;  5C1G A;  3FWW A;  5FU8 A;  2XME A;  1FOA A;  2XWL A;  1R7T A;  3LW6 A;  1H7T A;  4HO5 A;  1YP4 A;  5JQQ A;  1Z90 A;  3V0O A;  4EEO A;  1LL2 A;  4Y62 A;  2PGV A;  2BO4 A;  3ST8 A;  3SX7 A;  2V0I A;  1ZI4 A;  1R7Y A;  2RJ4 A;  4FCE A;  1WVC A;  1H7G A;  4AAW A;  2RJ7 A;  3V8Y A;  1LL0 A;  1FGG A;  2QKX A;  2O1G A;  3OH2 A;  4AYL A;  3O3P A;  4JIS A;  4KPX A;  4KQL A;  3SPT A;  2YES A;  5C1L A;  2ZU8 A;  2Z87 A;  1INJ A;  4C2S A;  1YRO B;  4B2W A;  1VH3 A;  1V84 A;  1ZJ2 A;  5C4E A;  1EYR A;  2XWM A;  1HM8 A;  4FRD A;  5FV9 A;  4FRQ A;  4IRP A;  2E8B A;  1GWV A;  3PKQ A;  1GX4 A;  2P72 A;  2JCO A;  1GQ9 A;  1OQM B;  4ASY A;  4EEM A;  2RJ8 A;  3U0Y A;  2JCJ A;  4KNX A;  2X60 A;  4XWI A;  5D91 A;  1W55 A;  1ZIZ A;  1VPA A;  5C1H A;  4M4K A;  1R7X A;  4HO3 A;  1G8O A;  2FFU A;  3USR A;  3OGZ A;  4AYJ A;  1XZ6 A;  4HO0 A;  4FRL A;  1QG8 A;  4B2X A;  3N9W A;  3U2T A;  3CKN A;  1H4E A;  4L41 C;  1H5S D;  2JCK A;  3I0L A;  1JV1 A;  2CU2 A;  1JV3 A;  5CMH A;  4FCU A;  2V0H A;  3U2V A;  3I0D A;  1QGQ A;  4O6N A;  1MP3 A;  2Y4K A;  1OMZ A;  1OMX A;  4HCQ A;  4Y7F A;  1GQC A;  1NQI B;  1FWY A;  4G3S A;  4FRE A;  2WVK A;  4HO6 A;  4P00 A;  2MZB A;  2QGI A;  4K6R A;  3SX3 A;  4FRA A;  4D0Z A;  1ZCV A;  4BMA A;  5FU0 A;  1VGW A;  4Q7C A;  2AE7 A;  2JCL A;  5CQP A;  3GUE A;  2Z86 A;  3SXD A;  3Q80 A;  3POL A;  4Y6N A;  1R82 A;  3F1C A;  4G87 A;  4G3Q A;  3I0C A;  2UX8 A;  3NGW A;  3K8D A;  1H3M A;  3E26 A;  1R81 A;  5FTV A;  2RJ5 A;  3SXE A;  3T7O A;  3I0I X;  3V0N A;  5L6S A;  2VFZ A;  1H5T B;  2A8U A;  1G9R A;  1LZJ A;  5AJO A;  1W57 A;  1VH1 A;  3I0J A;  5IDS A;  1LL3 A;  2AES A;  1NKH B;  2PX7 A;  2WEE A;  2RJ6 A;  4Y64 A;  4EE4 A;  4ASJ A;  3EE5 A;  5HS2 A;  1VZT A;  3SXC A;  1WT2 A;  1FO9 A;  1ZHJ A;  1S4N A;  2XMH A;  3CKO A;  2V0L A;  3BRK X;  4UEG A;  3U0X A;  3E25 A;  1ZDG A;  2OI6 A;  5BXC A;  1O23 B;  2AEC A;  3SXG A;  1FRW A;  4KNR A;  1H7E A;  1JYK A;  4MIX A;  4MYB A;  5AJN A;  5IFY A;  5C3D A;  3D98 A;  1WT1 A;  2AM4 A;  1IIM A;  2FY7 A;  2Y4J A;  5CMG X;  1O0R A;  1W77 A;  5CQL X;  2WAW A;  1FG5 N;  1G23 A;  1LZ7 A;  1ZCY A;  2APC A;  3V0Q A;  3Q4S A;  4B3U A;  1ON6 A;  3SX5 A;  1O7O A;  3JUK A;  4Y7G A;  4B42 A;  2RIY A;  2ZU7 A;  1ZJO A;  1H7H A;  1FR8 A;  4KXO A;  4HO9 A;  1G3L A;  4CJ8 A;  4EEA A;  2I5K A;  2FYD B;  4Y7T A;  1H5S B;  3PNN A;  1G93 A;  5CMI A;  4EE5 A;  1O7Q A;  1H7L A;  1E5K A;  3KIA A;  1ZCT A;  5C8R A;  1ZI5 A;  1SS9 A;  1EZI A;  5C48 A;  1S4P A;  1NMM B;  2RJ9 A;  2O1F A;  2Y7A A;  3V90 A;  1H4D A;  2AM3 A;  4EE3 A;  2X5S A;  1TZF A;  3U2U A;  1WSZ A;  1VGT A;  3IOJ A;  5C36 A;  3K8E A;  4HO2 A;  1I52 A;  1ZCU A;  1G0R A;  2V0J A;  2WVL A;  5CMJ A;  1H5R A;  4KPZ A;  5J49 A;  2VS4 A;  1JVD A;  3V0P A;  4HOC A;  3CKQ A;  3HL3 A;  4D11 C;  2D7I A;  5CMF X;  4J18 A;  1ON8 A;  4B4B A;  3ZLL A;  3PKP A;  1V83 A;  4R7P A;  4M2B A;  2YC3 A;  1LZI A;  2PA4 A;  4LW6 A;  1WT3 A;  3U2W A;  4EVW A;  2RIX A;  1YP3 A;  1G1L A;  4YS8 A;  5EJ1 A;  5DDT A;  4NAK A;  5L6V A;  2YCM A;  2BO8 A;  1NHE B;  2PGY A;  2V0K A;  1NF5 B;  3V0L A;  3OH0 A;  4Y63 A;  5DDV A;  3CKJ A;  2VSI A;  2I7B A;  4AC3 A;  3V91 A;  5FUH A;  4DEC A;  1XHB A;  3ZGF A;  4EEG A;  1JVG A;  5C4B A;  4DDZ A;  4E1K A;  1TW1 A;  5FTS A;  3T7M A;  1G95 A;  1LVW A;  1H4C A;  1ZJ1 A;  2I5E A;  2W0V A;  5C4F A;  3QVB A;  1FR9 A;  1PZY B;  2QH5 A;  4FRO A;  4FIX A;  1R7V A;  2YQJ A;  4KC2 A;  2VXM A;  5CQN X;  5EJZ A;  2X65 A;  2X5Z A;  3I0E A;  4O6M A;  2OEG A;  1H5S C;  1ZDF A;  1FGX A;  5C38 A;  2AGD A;  3RMV A;  1MP4 A;  2OI7 A;  1H7Q A;  5D92 A;  2YQS A;  4DE7 A;  2VSH A;  3DK5 A;  3BCV A;  4FQW A;  1IIN A;  5AJP A;  3TZT A;  2BO6 A;  2GGO A;  4B4M A;  1NWG B;  4B5B A;  1ZI1 A;  2J0A A;  2ICX A;  5I1F A;  4HO8 A;  3R2W A;  2VK9 A;  2A8W A;  4ECM A;  3I0H A;  1HM9 A;  4KC1 A;  3ZF8 A;  3CKV A;  4CJB A;  3IOH A;  2FYC B;  4IRQ A;  2RJ0 A;  3OH4 A;  1ZI3 A;  2ICY A;  2P6W A;  3OAM A;  1H5S A;  1MC3 A;  4Y7V A;  2VXL A;  3V0M A;  2D0J A;  2BO7 A;  2E3D A;  2YQH A;  4M2A A;  1YP2 A;  1GA8 A;  3SXB A;  5C49 A;  1S4O A;  3Q7U A;  3CU0 A;  4MND A;  1HM0 A;  2D7R A;  4BQH A;  5C3B A;  3F1Y A;  1VGU A;  2VD4 A;  2FFV A;  4GBP A;  3SX8 A;  4KT7 A;  2J0B A;  1FZW A;  3ZGG A;  3RSB A;  4ZDQ A;  4NAN A;  5C4C A;  1FXO A;  3OKR A;  4G3P A;  3T7N A;  2WVM A;  4HO4 A;  3ZLK A;  2GGQ A;  1VZX A;  2WE9 A;  4P02 A;  1R7U A;  1FO8 A;  1K4V A;  3SXA A;  1FXJ A;  2AH9 A;  1VZU A;  3DJ4 A;  4D48 A;  1VIC A;  2FYB A;  3IOI A;  1VM8 A;  4KC4 A;  2AM5 A;  2RJ1 A;  4HG6 A;  3RMW A;  4JD0 A;  4NAL A;  2NXV A;  2VS3 A;  4D0T A;  3OH1 A;  3OC9 A;  1GX0 A;  2OI5 A;  2P73 A;  1JYL A;  2Q4J A;  5C47 A;  5EIY A;  5IDT A;  3V8Z A;  4Y7U A;  4ARW A;  2RIZ A;  2Y4M A;  4FRB A;  1INI A;  4FRP A;  3DUV A;  1ZJ3 A;  2YC5 A;  1KWS A;  4KRV A;  1VGZ A;  2W0W A;  2XWN A;  3I0G A;  2WGZ A;  4FRM A;  5C3A A;  3U2X A;  1QWJ A;  1H5T A;  3I0K A;  1H5R B;  2DPW A;  4FRH A;  4CVH A;  2YQC A;  5CQO A;  3JTJ A;  4FIY A;  1R80 A;  5FYE A;  5C4D A;  1WT0 A;  1H7F A;  4D11 A;  4B4G A;  3D8V A;  1GWW A;  1G2V A;  4CJC A;  2ZU9 A;  3FOQ A;  2OEF A;  4Y6U A;  1HV9 A;  3R3I A;  2RIT A;  4M28 A;  1TW5 A;  1ZJ0 A;  1ZJP A;  1LZ0 A;  1MP5 A;  1TVY A;  1V82 A;  3I0F A;  2O1H A;  3OH3 A;  2FYA A;  1HJJ A;  5CQM X;  4Y9X A;  2VS5 A;  3D5N A;  3CGX A;  4NAI A;  2Y6P A;  3JUJ A;  3USQ A;  2C0N A;  2Y4L A; 
#chains in the Genus database with same CATH homology
 1HJL A;  1G97 A;  1PZT A;  4LW3 A;  3TQD A;  1QGS A;  5C1G A;  3FWW A;  5FU8 A;  2XME A;  1FOA A;  2XWL A;  1R7T A;  3LW6 A;  1H7T A;  4HO5 A;  1YP4 A;  5JQQ A;  1Z90 A;  3V0O A;  4EEO A;  1LL2 A;  4Y62 A;  2PGV A;  2BO4 A;  3ST8 A;  3SX7 A;  2V0I A;  1ZI4 A;  1R7Y A;  2RJ4 A;  4FCE A;  1WVC A;  1H7G A;  4AAW A;  2RJ7 A;  3V8Y A;  1LL0 A;  1FGG A;  2QKX A;  2O1G A;  3OH2 A;  4AYL A;  3O3P A;  4JIS A;  4KPX A;  4KQL A;  3SPT A;  2YES A;  5C1L A;  2ZU8 A;  2Z87 A;  1INJ A;  4C2S A;  1YRO B;  4B2W A;  1VH3 A;  1V84 A;  1ZJ2 A;  5C4E A;  1EYR A;  2XWM A;  1HM8 A;  4FRD A;  5FV9 A;  4FRQ A;  4IRP A;  2E8B A;  1GWV A;  3PKQ A;  1GX4 A;  2P72 A;  2JCO A;  1GQ9 A;  1OQM B;  4ASY A;  4EEM A;  2RJ8 A;  3U0Y A;  2JCJ A;  4KNX A;  2X60 A;  4XWI A;  5D91 A;  1W55 A;  1ZIZ A;  1VPA A;  5C1H A;  4M4K A;  1R7X A;  4HO3 A;  1G8O A;  2FFU A;  3USR A;  3OGZ A;  4AYJ A;  1XZ6 A;  4HO0 A;  4FRL A;  1QG8 A;  4B2X A;  3N9W A;  3U2T A;  3CKN A;  1H4E A;  4L41 C;  1H5S D;  2JCK A;  3I0L A;  1JV1 A;  2CU2 A;  1JV3 A;  5CMH A;  4FCU A;  2V0H A;  3U2V A;  3I0D A;  1QGQ A;  4O6N A;  1MP3 A;  2Y4K A;  1OMZ A;  1OMX A;  4HCQ A;  4Y7F A;  1GQC A;  1NQI B;  1FWY A;  4G3S A;  4FRE A;  2WVK A;  4HO6 A;  4P00 A;  2MZB A;  2QGI A;  4K6R A;  3SX3 A;  4FRA A;  4D0Z A;  1ZCV A;  4BMA A;  5FU0 A;  1VGW A;  4Q7C A;  2AE7 A;  2JCL A;  5CQP A;  3GUE A;  2Z86 A;  3SXD A;  3Q80 A;  3POL A;  4Y6N A;  1R82 A;  3F1C A;  4G87 A;  4G3Q A;  3I0C A;  2UX8 A;  3NGW A;  3K8D A;  1H3M A;  3E26 A;  1R81 A;  5FTV A;  2RJ5 A;  3SXE A;  3T7O A;  3I0I X;  3V0N A;  5L6S A;  2VFZ A;  1H5T B;  2A8U A;  1G9R A;  1LZJ A;  5AJO A;  1W57 A;  1VH1 A;  3I0J A;  5IDS A;  1LL3 A;  2AES A;  1NKH B;  2PX7 A;  2WEE A;  2RJ6 A;  4Y64 A;  4EE4 A;  4ASJ A;  3EE5 A;  5HS2 A;  1VZT A;  3SXC A;  1WT2 A;  1FO9 A;  1ZHJ A;  1S4N A;  2XMH A;  3CKO A;  2V0L A;  3BRK X;  4UEG A;  3U0X A;  3E25 A;  1ZDG A;  2OI6 A;  5BXC A;  1O23 B;  2AEC A;  3SXG A;  1FRW A;  4KNR A;  1H7E A;  1JYK A;  4MIX A;  4MYB A;  5AJN A;  5IFY A;  5C3D A;  3D98 A;  1WT1 A;  2AM4 A;  1IIM A;  2FY7 A;  2Y4J A;  5CMG X;  1O0R A;  1W77 A;  5CQL X;  2WAW A;  1FG5 N;  1G23 A;  1LZ7 A;  1ZCY A;  2APC A;  3V0Q A;  3Q4S A;  4B3U A;  1ON6 A;  3SX5 A;  1O7O A;  3JUK A;  4Y7G A;  4B42 A;  2RIY A;  2ZU7 A;  1ZJO A;  1H7H A;  1FR8 A;  4KXO A;  4HO9 A;  1G3L A;  4CJ8 A;  4EEA A;  2I5K A;  2FYD B;  4Y7T A;  1H5S B;  3PNN A;  1G93 A;  5CMI A;  4EE5 A;  1O7Q A;  1H7L A;  1E5K A;  3KIA A;  1ZCT A;  5C8R A;  1ZI5 A;  1SS9 A;  1EZI A;  5C48 A;  1S4P A;  1NMM B;  2RJ9 A;  2O1F A;  2Y7A A;  3V90 A;  1H4D A;  2AM3 A;  4EE3 A;  2X5S A;  1TZF A;  3U2U A;  1WSZ A;  1VGT A;  3IOJ A;  5C36 A;  3K8E A;  4HO2 A;  1I52 A;  1ZCU A;  1G0R A;  2V0J A;  2WVL A;  5CMJ A;  1H5R A;  4KPZ A;  5J49 A;  2VS4 A;  1JVD A;  3V0P A;  4HOC A;  3CKQ A;  3HL3 A;  4D11 C;  2D7I A;  5CMF X;  4J18 A;  1ON8 A;  4B4B A;  3ZLL A;  3PKP A;  1V83 A;  4R7P A;  4M2B A;  2YC3 A;  1LZI A;  2PA4 A;  4LW6 A;  1WT3 A;  3U2W A;  4EVW A;  2RIX A;  1YP3 A;  1G1L A;  4YS8 A;  5EJ1 A;  5DDT A;  4NAK A;  5L6V A;  2YCM A;  2BO8 A;  1NHE B;  2PGY A;  2V0K A;  1NF5 B;  3V0L A;  3OH0 A;  4Y63 A;  5DDV A;  3CKJ A;  2VSI A;  2I7B A;  4AC3 A;  3V91 A;  5FUH A;  4DEC A;  1XHB A;  3ZGF A;  4EEG A;  1JVG A;  5C4B A;  4DDZ A;  4E1K A;  1TW1 A;  5FTS A;  3T7M A;  1G95 A;  1LVW A;  1H4C A;  1ZJ1 A;  2I5E A;  2W0V A;  5C4F A;  3QVB A;  1FR9 A;  1PZY B;  2QH5 A;  4FRO A;  4FIX A;  1R7V A;  2YQJ A;  4KC2 A;  2VXM A;  5CQN X;  5EJZ A;  2X65 A;  2X5Z A;  3I0E A;  4O6M A;  2OEG A;  1H5S C;  1ZDF A;  1FGX A;  5C38 A;  2AGD A;  3RMV A;  1MP4 A;  2OI7 A;  1H7Q A;  5D92 A;  2YQS A;  4DE7 A;  2VSH A;  3DK5 A;  3BCV A;  4FQW A;  1IIN A;  5AJP A;  3TZT A;  2BO6 A;  2GGO A;  4B4M A;  1NWG B;  4B5B A;  1ZI1 A;  2J0A A;  2ICX A;  5I1F A;  4HO8 A;  3R2W A;  2VK9 A;  2A8W A;  4ECM A;  3I0H A;  1HM9 A;  4KC1 A;  3ZF8 A;  3CKV A;  4CJB A;  3IOH A;  2FYC B;  4IRQ A;  2RJ0 A;  3OH4 A;  1ZI3 A;  2ICY A;  2P6W A;  3OAM A;  1H5S A;  1MC3 A;  4Y7V A;  2VXL A;  3V0M A;  2D0J A;  2BO7 A;  2E3D A;  2YQH A;  4M2A A;  1YP2 A;  1GA8 A;  3SXB A;  5C49 A;  1S4O A;  3Q7U A;  3CU0 A;  4MND A;  1HM0 A;  2D7R A;  4BQH A;  5C3B A;  3F1Y A;  1VGU A;  2VD4 A;  2FFV A;  4GBP A;  3SX8 A;  4KT7 A;  2J0B A;  1FZW A;  3ZGG A;  3RSB A;  4ZDQ A;  4NAN A;  5C4C A;  1FXO A;  3OKR A;  4G3P A;  3T7N A;  2WVM A;  4HO4 A;  3ZLK A;  2GGQ A;  1VZX A;  2WE9 A;  4P02 A;  1R7U A;  1FO8 A;  1K4V A;  3SXA A;  1FXJ A;  2AH9 A;  1VZU A;  3DJ4 A;  4D48 A;  1VIC A;  2FYB A;  3IOI A;  1VM8 A;  4KC4 A;  2AM5 A;  2RJ1 A;  4HG6 A;  3RMW A;  4JD0 A;  4NAL A;  2NXV A;  2VS3 A;  4D0T A;  3OH1 A;  3OC9 A;  1GX0 A;  2OI5 A;  2P73 A;  1JYL A;  2Q4J A;  5C47 A;  5EIY A;  5IDT A;  3V8Z A;  4Y7U A;  4ARW A;  2RIZ A;  2Y4M A;  4FRB A;  1INI A;  4FRP A;  3DUV A;  1ZJ3 A;  2YC5 A;  1KWS A;  4KRV A;  1VGZ A;  2W0W A;  2XWN A;  3I0G A;  2WGZ A;  4FRM A;  5C3A A;  3U2X A;  1QWJ A;  1H5T A;  3I0K A;  1H5R B;  2DPW A;  4FRH A;  4CVH A;  2YQC A;  5CQO A;  3JTJ A;  4FIY A;  1R80 A;  5FYE A;  5C4D A;  1WT0 A;  1H7F A;  4D11 A;  4B4G A;  3D8V A;  1GWW A;  1G2V A;  4CJC A;  2ZU9 A;  3FOQ A;  2OEF A;  4Y6U A;  1HV9 A;  3R3I A;  2RIT A;  4M28 A;  1TW5 A;  1ZJ0 A;  1ZJP A;  1LZ0 A;  1MP5 A;  1TVY A;  1V82 A;  3I0F A;  2O1H A;  3OH3 A;  2FYA A;  1HJJ A;  5CQM X;  4Y9X A;  2VS5 A;  3D5N A;  3CGX A;  4NAI A;  2Y6P A;  3JUJ A;  3USQ A;  2C0N A;  2Y4L A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...