4ARWA

Pseudomonas aeruginosa rmla in complex with allosteric inhibitor
Total Genus 97
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
97
sequence length
299
structure length
294
Chain Sequence
HHHRKGIILAGGSGTRLHPATLAISKQLLPVYDKPMIYYPLSTLMLAGIREILIISTPQDTPRFQQLLGDGSNWGLDLQYAVQPSPDGLAQAFLIGESFIGNDLSALVLGDNLYYGHDFHELLGSASQRQTGASVFAYHVLDPERYGVVEFDQGGKAISLEEKPLEPKSNYAVTGLYFYDQQVVDIARDLKPSPRGELEITDVNRAYLERGQLSVEIMGRGYAWLDTGTHDSLLEAGQFIATLENRQGLKVACPEEIAYRQKWIDAAQLEKLAAPLAKNGYGQYLKRLLTETVY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords GLUCOSE-1-PHOSPHATE THYMIDYLYLTRANSFERASE
publication title Allosteric competitive inhibitors of the glucose-1-phosphate thymidylyltransferase (RmlA) from Pseudomonas aeruginosa.
pubmed doi rcsb
source organism Pseudomonas aeruginosa
molecule tags Transferase
total genus 97
structure length 294
sequence length 299
chains with identical sequence B, C, D
ec nomenclature ec 2.7.7.74: 1L-myo-inositol 1-phosphate cytidylyltransferase.
pdb deposition date 2012-04-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00483 NTP_transferase Nucleotidyl transferase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.550.10 Alpha Beta Alpha-Beta Complex Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A 4arwA00
5AJNA 5L6SA 1INJA 4DDZA 5C4EA 2VD4A 5C4DA 4FRDA 2XWMA 2BO7A 1FR9A 1S4PA 4FRLA 2DPWA 3FWWA 2OI5A 5AJPA 4FCUA 5L6VA 1GWWA 3NGWA 2AH9A 5C36A 3R3IA 1G97A 3OKRA 1H7HA 1VH1A 4HO3A 5FU8A 3ZLLA 3SX8A 4CJBA 3ZLKA 4ASYA 1LL0A 4FRMA 5AJOA 2RIXA 2JCLA 5C47A 4Y64A 1G1LA 3SXCA 1H5RB 5C1LA 1G2VA 5C48A 4HG6A 2X65A 3IOJA 2V0IA 1YP4A 2JCOA 3SX7A 2YESA 1VH3A 1H7FA 4MYBA 2FYBA 2YQJA 1FXJA 3IOIA 4HO8A 1GX4A 1IIMA 4D11C 1H3MA 1H4CA 1OMZA 3BCVA 2P6WA 2QKXA 1FO8A 2Y4JA 5FUHA 5I1FA 3SX3A 5C3BA 1R81A 3OC9A 1JV3A 3U2UA 4FCEA 2YCMA 4AYLA 2RJ9A 1W57A 3PKPA 1GQCA 2VXLA 2OI7A 2WGZA 4BQHA 1ZHJA 2VXMA 4ZDQA 2E3DA 1HM0A 2JCKA 3TQDA 3CKNA 1WT2A 2X60A 3RMWA 3ST8A 1NMMB 3RMVA 1ZJ0A 3U2WA 1G3LA 1XHBA 1H7EA 3V0PA 2VS5A 2OEFA 5CMIA 1XZ6A 5EIYA 4P00A 1ZIZA 2AECA 1LL3A 1PZTA 1R82A 1ZDGA 3LW6A 4KNXA 4FROA 2ICYA 4FRQA 3DK5A 2AM3A 4NAKA 4EE5A 1FG5N 3OH1A 4HO4A 4FQWA 3OAMA 2Y4KA 2X5SA 4J18A 1R80A 3U0XA 3OH3A 5CMHA 3CKQA 2YQSA 1ZCTA 5CMFX 1JYKA 5C4BA 1LZ7A 1ZJPA 1ZI1A 2W0VA 5CQOA 2XWNA 2ICXA 3SXEA 2FYDB 2E8BA 1K4VA 5CQNX 3U2XA 3T7OA 2A8UA 2VS4A 3I0DA 4Y7FA 1FGGA 2AM5A 1VGZA 2RJ1A 2VSHA 5CQPA 3ZF8A 3GUEA 2AGDA 4B2XA 2W0WA 2O1HA 4EE4A 4KXOA 2RIZA 1G23A 4B4MA 1V83A 1JVDA 1ZJOA 4KPXA 3T7MA 1H5SA 1MC3A 2A8WA 4ECMA 4Y7GA 4KC1A 1LZ0A 1YP2A 2O1GA 3CGXA 2FYAA 1TZFA 4Y6UA 5FTSA 1ZDFA 2GGQA 2XWLA 4B5BA 5HS2A 4HO0A 2MZBA 1OMXA 2RIYA 4C2SA 3V90A 3I0CA 1QG8A 2AE7A 4EE3A 3SPTA 2RJ6A 1R7XA 2I7BA 1VZTA 1ON6A 2ZU9A 4EEGA 1LVWA 3BRKX 5CMGX 4FRAA 4DECA 2FFUA 1TW1A 3V0LA 2V0HA 1G8OA 1H7QA 1O7OA 5CMJA 5J49A 2BO6A 1VICA 1LL2A 2XMEA 2Z86A 2AM4A 3POLA 1NKHB 1H5SD 3EE5A 2WVMA 5FU0A 2D7IA 2WVLA 1VGWA 2RJ8A 4ARWA 1FZWA 2D0JA 5FYEA 3KIAA 3Q7UA 4Y6NA 4JD0A 1JYLA 1MP4A 1FRWA 3I0JA 1H5TA 1R7UA 1H7GA 3USRA 4HO5A 3ZGFA 2PGYA 3SXBA 1YROB 1MP5A 3CKJA 1OQMB 3V0NA 5IFYA 4G3QA 4BMAA 4EEMA 4B3UA 1FO9A 1FGXA 1G0RA 1QGSA 2V0JA 4B42A 1S4OA 2YC5A 4GBPA 3V0QA 4FRHA 3E26A 1WT1A 1G9RA 1SS9A 2I5EA 1PZYB 4UEGA 1H5SB 3K8DA 4HO2A 5CQLX 4E1KA 1QWJA 5EJ1A 4KC4A 2PA4A 3DJ4A 4P02A 5C3AA 3SX5A 2AESA 2CU2A 2YQCA 1IINA 5C4CA 2XMHA 2RJ0A 1NWGB 1G95A 3TZTA 2Y7AA 3PKQA 1H5RA 1FWYA 1TVYA 1FOAA 3I0HA 4HO6A 5C4FA 3K8EA 4EEOA 1KWSA 4KNRA 3JUJA 2WAWA 3U0YA 2QH5A 3T7NA 4M2AA 3I0FA 1LZJA 1HM9A 2FY7A 1VPAA 1GA8A 1ZCVA 2P73A 3V8YA 2PX7A 1EYRA 1FXOA 1VGUA 1QGQA 2WVKA 2D7RA 3D98A 1Z90A 3CKOA 1ZI4A 1YP3A 4G3PA 4D0TA 5IDSA 4D48A 2QGIA 3R2WA 1W77A 4M4KA 4Y7VA 4M28A 4DE7A 5FV9A 1S4NA 4Y7UA 1H5TB 3SXDA 3OGZA 4NALA 3OH2A 3U2VA 1INIA 1W55A 4K6RA 1G93A 4B4BA 4G3SA 2O1FA 1FR8A 4Y63A 1WT0A 1HV9A 5DDVA 4LW3A 4D0ZA 1ZI3A 1VGTA 3U2TA 4Y62A 2FFVA 1MP3A 1I52A 1V82A 1ZI5A 4R7PA 5IDTA 1VZUA 4MNDA 3V0OA 4AAWA 4ASJA 3SXGA 3PNNA 4CJ8A 4HOCA 3CU0A 2PGVA 4LW6A 3V91A 1O23B 4KQLA 2BO8A 2OI6A 3OH0A 2ZU7A 3I0KA 1O0RA 1ZJ3A 5EJZA 5JQQA 2RJ7A 2RITA 3JTJA 3O3PA 1NQIB 3JUKA 4G87A 1GQ9A 3USQA 3E25A 3I0EA 2RJ5A 1EZIA 4M2BA 4XWIA 4FREA 4KPZA 3IOHA 4IRQA 4AC3A 3SXAA 1LZIA 2VSIA 4KC2A 1R7YA 1ZCUA 2Z87A 4Y7TA 3FOQA 1GWVA 4CJCA 1H5SC 4EVWA 2Q4JA 1H4EA 2NXVA 2X5ZA 1O7QA 2P72A 2APCA 2Y4MA 3I0IX 4B2WA 1H7LA 4FRBA 1WSZA 3DUVA 3V8ZA 1H4DA 4IRPA 1ZJ1A 1JVGA 2JCJA 1JV1A 2GGOA 3Q4SA 5C1GA 4YS8A 4AYJA 5C49A 4CVHA 2YC3A 2I5KA 2V0LA 3HL3A 1H7TA 5DDTA 2YQHA 1GX0A 2UX8A 4NAIA 3RSBA 3Q80A 3F1YA 3N9WA 4JISA 4KT7A 2VFZA 1HM8A 3D8VA 2Y4LA 5CQMX 2WEEA 2OEGA 1WVCA 1ZJ2A 2WE9A 3I0LA 5C8RA 2RJ4A 2FYCB 3F1CA 1VZXA 1V84A 3V0MA 2VS3A 2ZU8A 4B4GA 4HO9A 1NHEB 5C3DA 1WT3A 3I0GA 2BO4A 4NANA 2Y6PA 5C38A 5C1HA 4D11A 4FRPA 4Y9XA 3D5NA 3QVBA 4L41C 1HJJA 1TW5A 1HJLA 1VM8A 1NF5B 5BXCA 1E5KA 4HCQA 4KRVA 4EEAA 2V0KA 5FTVA 1R7VA 1ZCYA 1ON8A 3OH4A 3ZGGA 1R7TA 3CKVA
chains in the Genus database with same CATH superfamily
5AJNA 5L6SA 1INJA 4DDZA 5C4EA 2VD4A 5C4DA 4FRDA 2XWMA 2BO7A 1FR9A 1S4PA 4FRLA 2DPWA 3FWWA 2OI5A 5AJPA 4FCUA 5L6VA 1GWWA 3NGWA 2AH9A 5C36A 3R3IA 1G97A 3OKRA 1H7HA 1VH1A 4HO3A 5FU8A 3ZLLA 3SX8A 4CJBA 3ZLKA 4ASYA 1LL0A 4FRMA 5AJOA 2RIXA 2JCLA 5C47A 4Y64A 1G1LA 3SXCA 1H5RB 5C1LA 1G2VA 5C48A 4HG6A 2X65A 3IOJA 2V0IA 1YP4A 2JCOA 3SX7A 2YESA 1VH3A 1H7FA 4MYBA 2FYBA 2YQJA 1FXJA 3IOIA 4HO8A 1GX4A 1IIMA 4D11C 1H3MA 1H4CA 1OMZA 3BCVA 2P6WA 2QKXA 1FO8A 2Y4JA 5FUHA 5I1FA 3SX3A 5C3BA 1R81A 3OC9A 1JV3A 3U2UA 4FCEA 2YCMA 4AYLA 2RJ9A 1W57A 3PKPA 1GQCA 2VK9A 2VXLA 2OI7A 2WGZA 4BQHA 1ZHJA 2VXMA 4ZDQA 2E3DA 1HM0A 2JCKA 3TQDA 3CKNA 1WT2A 2X60A 3RMWA 3ST8A 1NMMB 3RMVA 1ZJ0A 2C0NA 3U2WA 1G3LA 1XHBA 1H7EA 3V0PA 2VS5A 2OEFA 5CMIA 1XZ6A 5EIYA 4P00A 1ZIZA 2AECA 1LL3A 1PZTA 1R82A 1ZDGA 3LW6A 4KNXA 4FROA 2ICYA 4FRQA 3DK5A 2AM3A 4NAKA 4EE5A 1FG5N 3OH1A 4HO4A 4FQWA 3OAMA 2Y4KA 2X5SA 4J18A 1R80A 3U0XA 3OH3A 5CMHA 3CKQA 4Q7CA 2YQSA 1ZCTA 5CMFX 1JYKA 5C4BA 1LZ7A 1ZJPA 1ZI1A 2W0VA 5CQOA 2XWNA 2ICXA 3SXEA 2FYDB 2E8BA 1K4VA 5CQNX 3U2XA 3T7OA 2A8UA 2VS4A 3I0DA 4Y7FA 1FGGA 2AM5A 1VGZA 2RJ1A 2VSHA 5CQPA 3ZF8A 3GUEA 2AGDA 4B2XA 2W0WA 2O1HA 4EE4A 4KXOA 2RIZA 1G23A 4B4MA 1V83A 1JVDA 1ZJOA 4KPXA 3T7MA 1H5SA 1MC3A 2A8WA 4ECMA 4Y7GA 4KC1A 1LZ0A 1YP2A 2O1GA 3CGXA 2FYAA 1TZFA 4Y6UA 4O6MA 5FTSA 1ZDFA 2GGQA 2XWLA 4B5BA 5HS2A 4HO0A 2MZBA 1OMXA 2RIYA 4C2SA 3V90A 3I0CA 1QG8A 2AE7A 4EE3A 3SPTA 2RJ6A 1R7XA 2I7BA 2J0AA 1VZTA 1ON6A 2ZU9A 4EEGA 1LVWA 3BRKX 5CMGX 4FRAA 4DECA 2FFUA 1TW1A 3V0LA 2V0HA 1G8OA 1H7QA 1O7OA 5CMJA 4FIYA 2BO6A 5J49A 1VICA 1LL2A 2XMEA 2Z86A 2AM4A 3POLA 1NKHB 1H5SD 3EE5A 2WVMA 5FU0A 2D7IA 2WVLA 1VGWA 2RJ8A 4ARWA 1FZWA 2D0JA 5FYEA 3KIAA 3Q7UA 4Y6NA 4JD0A 1JYLA 5D91A 1MP4A 1FRWA 3I0JA 1H5TA 1R7UA 1H7GA 3USRA 4HO5A 3ZGFA 2PGYA 3SXBA 1YROB 1MP5A 3CKJA 1OQMB 3V0NA 5IFYA 4G3QA 4BMAA 4EEMA 4B3UA 1FO9A 1FGXA 1G0RA 1QGSA 2V0JA 4B42A 1S4OA 2YC5A 4GBPA 3V0QA 4FRHA 3E26A 1WT1A 1G9RA 1SS9A 2I5EA 1PZYB 4UEGA 1H5SB 3K8DA 4HO2A 5CQLX 4E1KA 1QWJA 5EJ1A 4KC4A 2PA4A 3DJ4A 4FIXA 4P02A 5C3AA 3SX5A 2AESA 2CU2A 2YQCA 1IINA 5C4CA 2XMHA 2RJ0A 1NWGB 1G95A 3TZTA 2Y7AA 3PKQA 1H5RA 1FWYA 1TVYA 1FOAA 3I0HA 4HO6A 5C4FA 3K8EA 4EEOA 1KWSA 4KNRA 3JUJA 2WAWA 3U0YA 2QH5A 3T7NA 4M2AA 3I0FA 1LZJA 1HM9A 2FY7A 1VPAA 1GA8A 1ZCVA 2P73A 3V8YA 2PX7A 1EYRA 1FXOA 1VGUA 1QGQA 2WVKA 2D7RA 3D98A 1Z90A 3CKOA 1ZI4A 1YP3A 4G3PA 4D0TA 5IDSA 4D48A 2QGIA 3R2WA 1W77A 4M4KA 4Y7VA 5D92A 4M28A 4DE7A 5FV9A 1S4NA 4Y7UA 1H5TB 3SXDA 3OGZA 4NALA 3OH2A 3U2VA 1INIA 1W55A 4K6RA 1G93A 4B4BA 4G3SA 2O1FA 1FR8A 4Y63A 1WT0A 1HV9A 5DDVA 4LW3A 4D0ZA 1ZI3A 1VGTA 3U2TA 4Y62A 2FFVA 1MP3A 1I52A 1V82A 1ZI5A 4R7PA 5IDTA 1VZUA 4MNDA 3V0OA 4AAWA 4ASJA 3SXGA 3PNNA 4CJ8A 4HOCA 3CU0A 2PGVA 4LW6A 3V91A 1O23B 4KQLA 2BO8A 2OI6A 3OH0A 2ZU7A 3I0KA 1O0RA 1ZJ3A 5EJZA 4MIXA 5JQQA 2RJ7A 2RITA 3JTJA 3O3PA 1NQIB 3JUKA 4G87A 1GQ9A 3USQA 3E25A 3I0EA 2RJ5A 1EZIA 4M2BA 4XWIA 4FREA 4KPZA 3IOHA 4IRQA 4AC3A 3SXAA 1LZIA 2VSIA 4KC2A 1R7YA 1ZCUA 2Z87A 4Y7TA 3FOQA 1GWVA 4CJCA 1H5SC 4EVWA 2Q4JA 1H4EA 2NXVA 2X5ZA 1O7QA 2P72A 2APCA 2Y4MA 3I0IX 4B2WA 1H7LA 4FRBA 1WSZA 3DUVA 3V8ZA 1H4DA 4IRPA 1ZJ1A 1JVGA 2JCJA 1JV1A 2GGOA 3Q4SA 5C1GA 4YS8A 4AYJA 5C49A 4CVHA 2YC3A 2I5KA 2V0LA 3HL3A 4O6NA 1H7TA 5DDTA 2YQHA 1GX0A 2UX8A 4NAIA 3RSBA 3Q80A 3F1YA 3N9WA 4JISA 4KT7A 2VFZA 1HM8A 3D8VA 2Y4LA 5CQMX 2WEEA 2OEGA 1WVCA 1ZJ2A 2WE9A 3I0LA 5C8RA 2RJ4A 2FYCB 3F1CA 1VZXA 1V84A 3V0MA 2VS3A 2ZU8A 4B4GA 4HO9A 1NHEB 5C3DA 1WT3A 3I0GA 2BO4A 4NANA 2Y6PA 5C38A 5C1HA 4D11A 4FRPA 4Y9XA 3D5NA 3QVBA 4L41C 1HJJA 1TW5A 1HJLA 1VM8A 1NF5B 5BXCA 1E5KA 4HCQA 4KRVA 4EEAA 2V0KA 2J0BA 5FTVA 1R7VA 1ZCYA 1ON8A 3OH4A 3ZGGA 1R7TA 3CKVA
chains in the Genus database with same CATH topology
5AJNA 5L6SA 1INJA 4DDZA 5C4EA 2VD4A 5C4DA 4FRDA 2XWMA 2BO7A 1FR9A 1S4PA 4FRLA 2DPWA 3FWWA 2OI5A 5AJPA 4FCUA 5L6VA 1GWWA 3NGWA 2AH9A 5C36A 3R3IA 1G97A 3OKRA 1H7HA 1VH1A 4HO3A 5FU8A 3ZLLA 3SX8A 4CJBA 3ZLKA 4ASYA 1LL0A 4FRMA 5AJOA 2RIXA 2JCLA 5C47A 4Y64A 1G1LA 3SXCA 1H5RB 5C1LA 1G2VA 5C48A 4HG6A 2X65A 3IOJA 2V0IA 1YP4A 2JCOA 3SX7A 2YESA 1VH3A 1H7FA 4MYBA 2FYBA 2YQJA 1FXJA 3IOIA 4HO8A 1GX4A 1IIMA 4D11C 1H3MA 1H4CA 1OMZA 3BCVA 2P6WA 2QKXA 1FO8A 2Y4JA 5FUHA 5I1FA 3SX3A 5C3BA 1R81A 3OC9A 1JV3A 3U2UA 4FCEA 2YCMA 4AYLA 2RJ9A 1W57A 3PKPA 1GQCA 2VK9A 2VXLA 2OI7A 2WGZA 4BQHA 1ZHJA 2VXMA 4ZDQA 2E3DA 1HM0A 2JCKA 3TQDA 3CKNA 1WT2A 2X60A 3RMWA 3ST8A 1NMMB 3RMVA 1ZJ0A 2C0NA 3U2WA 1G3LA 1XHBA 1H7EA 3V0PA 2VS5A 2OEFA 5CMIA 1XZ6A 5EIYA 4P00A 1ZIZA 2AECA 1LL3A 1PZTA 1R82A 1ZDGA 3LW6A 4KNXA 4FROA 2ICYA 4FRQA 3DK5A 2AM3A 4NAKA 4EE5A 1FG5N 3OH1A 4HO4A 4FQWA 3OAMA 2Y4KA 2X5SA 4J18A 1R80A 3U0XA 3OH3A 5CMHA 3CKQA 4Q7CA 2YQSA 1ZCTA 5CMFX 1JYKA 5C4BA 1LZ7A 1ZJPA 1ZI1A 2W0VA 5CQOA 2XWNA 2ICXA 3SXEA 2FYDB 2E8BA 1K4VA 5CQNX 3U2XA 3T7OA 2A8UA 2VS4A 3I0DA 4Y7FA 1FGGA 2AM5A 1VGZA 2RJ1A 2VSHA 5CQPA 3ZF8A 3GUEA 2AGDA 4B2XA 2W0WA 2O1HA 4EE4A 4KXOA 2RIZA 1G23A 4B4MA 1V83A 1JVDA 1ZJOA 4KPXA 3T7MA 1H5SA 1MC3A 2A8WA 4ECMA 4Y7GA 4KC1A 1LZ0A 1YP2A 2O1GA 3CGXA 2FYAA 1TZFA 4Y6UA 4O6MA 5FTSA 1ZDFA 2GGQA 2XWLA 4B5BA 5HS2A 4HO0A 2MZBA 1OMXA 2RIYA 4C2SA 3V90A 3I0CA 1QG8A 2AE7A 4EE3A 3SPTA 2RJ6A 1R7XA 2I7BA 2J0AA 1VZTA 1ON6A 2ZU9A 4EEGA 1LVWA 3BRKX 5CMGX 4FRAA 4DECA 2FFUA 1TW1A 3V0LA 2V0HA 1G8OA 1H7QA 1O7OA 5CMJA 4FIYA 2BO6A 5J49A 1VICA 1LL2A 2XMEA 2Z86A 2AM4A 3POLA 1NKHB 1H5SD 3EE5A 2WVMA 5FU0A 2D7IA 2WVLA 1VGWA 2RJ8A 4ARWA 1FZWA 2D0JA 5FYEA 3KIAA 3Q7UA 4Y6NA 4JD0A 1JYLA 5D91A 1MP4A 1FRWA 3I0JA 1H5TA 1R7UA 1H7GA 3USRA 4HO5A 3ZGFA 2PGYA 3SXBA 1YROB 1MP5A 3CKJA 1OQMB 3V0NA 5IFYA 4G3QA 4BMAA 4EEMA 4B3UA 1FO9A 1FGXA 1G0RA 1QGSA 2V0JA 4B42A 1S4OA 2YC5A 4GBPA 3V0QA 4FRHA 3E26A 1WT1A 1G9RA 1SS9A 2I5EA 1PZYB 4UEGA 1H5SB 3K8DA 4HO2A 5CQLX 4E1KA 1QWJA 5EJ1A 4KC4A 2PA4A 3DJ4A 4FIXA 4P02A 5C3AA 3SX5A 2AESA 2CU2A 2YQCA 1IINA 5C4CA 2XMHA 2RJ0A 1NWGB 1G95A 3TZTA 2Y7AA 3PKQA 1H5RA 1FWYA 1TVYA 1FOAA 3I0HA 4HO6A 5C4FA 3K8EA 4EEOA 1KWSA 4KNRA 3JUJA 2WAWA 3U0YA 2QH5A 3T7NA 4M2AA 3I0FA 1LZJA 1HM9A 2FY7A 1VPAA 1GA8A 1ZCVA 2P73A 3V8YA 2PX7A 1EYRA 1FXOA 1VGUA 1QGQA 2WVKA 2D7RA 3D98A 1Z90A 3CKOA 1ZI4A 1YP3A 4G3PA 4D0TA 5IDSA 4D48A 2QGIA 3R2WA 1W77A 4M4KA 4Y7VA 5D92A 4M28A 4DE7A 5FV9A 1S4NA 4Y7UA 1H5TB 3SXDA 3OGZA 4NALA 3OH2A 3U2VA 1INIA 1W55A 4K6RA 1G93A 4B4BA 4G3SA 2O1FA 1FR8A 4Y63A 1WT0A 1HV9A 5DDVA 4LW3A 4D0ZA 1ZI3A 1VGTA 3U2TA 4Y62A 2FFVA 1MP3A 1I52A 1V82A 1ZI5A 4R7PA 5IDTA 1VZUA 4MNDA 3V0OA 4AAWA 4ASJA 3SXGA 3PNNA 4CJ8A 4HOCA 3CU0A 2PGVA 4LW6A 3V91A 1O23B 4KQLA 2BO8A 2OI6A 3OH0A 2ZU7A 3I0KA 1O0RA 1ZJ3A 5EJZA 4MIXA 5JQQA 2RJ7A 2RITA 3JTJA 3O3PA 1NQIB 3JUKA 4G87A 1GQ9A 3USQA 3E25A 3I0EA 2RJ5A 1EZIA 4M2BA 4XWIA 4FREA 4KPZA 3IOHA 4IRQA 4AC3A 3SXAA 1LZIA 2VSIA 4KC2A 1R7YA 1ZCUA 2Z87A 4Y7TA 3FOQA 1GWVA 4CJCA 1H5SC 4EVWA 2Q4JA 1H4EA 2NXVA 2X5ZA 1O7QA 2P72A 2APCA 2Y4MA 3I0IX 4B2WA 1H7LA 4FRBA 1WSZA 3DUVA 3V8ZA 1H4DA 4IRPA 1ZJ1A 1JVGA 2JCJA 1JV1A 2GGOA 3Q4SA 5C1GA 4YS8A 4AYJA 5C49A 4CVHA 2YC3A 2I5KA 2V0LA 3HL3A 4O6NA 1H7TA 5DDTA 2YQHA 1GX0A 2UX8A 4NAIA 3RSBA 3Q80A 3F1YA 3N9WA 4JISA 4KT7A 2VFZA 1HM8A 3D8VA 2Y4LA 5CQMX 2WEEA 2OEGA 1WVCA 1ZJ2A 2WE9A 3I0LA 5C8RA 2RJ4A 2FYCB 3F1CA 1VZXA 1V84A 3V0MA 2VS3A 2ZU8A 4B4GA 4HO9A 1NHEB 5C3DA 1WT3A 3I0GA 2BO4A 4NANA 2Y6PA 5C38A 5C1HA 4D11A 4FRPA 4Y9XA 3D5NA 3QVBA 4L41C 1HJJA 1TW5A 1HJLA 1VM8A 1NF5B 5BXCA 1E5KA 4HCQA 4KRVA 4EEAA 2V0KA 2J0BA 5FTVA 1R7VA 1ZCYA 1ON8A 3OH4A 3ZGGA 1R7TA 3CKVA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5AJN A;  5L6S A;  1INJ A;  4DDZ A;  5C4E A;  2VD4 A;  5C4D A;  4FRD A;  2XWM A;  2BO7 A;  1FR9 A;  1S4P A;  4FRL A;  2DPW A;  3FWW A;  2OI5 A;  5AJP A;  4FCU A;  5L6V A;  1GWW A;  3NGW A;  2AH9 A;  5C36 A;  3R3I A;  1G97 A;  3OKR A;  1H7H A;  1VH1 A;  4HO3 A;  5FU8 A;  3ZLL A;  3SX8 A;  4CJB A;  3ZLK A;  4ASY A;  1LL0 A;  4FRM A;  5AJO A;  2RIX A;  2JCL A;  5C47 A;  4Y64 A;  1G1L A;  3SXC A;  1H5R B;  5C1L A;  1G2V A;  5C48 A;  4HG6 A;  2X65 A;  3IOJ A;  2V0I A;  1YP4 A;  2JCO A;  3SX7 A;  2YES A;  1VH3 A;  1H7F A;  4MYB A;  2FYB A;  2YQJ A;  1FXJ A;  3IOI A;  4HO8 A;  1GX4 A;  1IIM A;  4D11 C;  1H3M A;  1H4C A;  1OMZ A;  3BCV A;  2P6W A;  2QKX A;  1FO8 A;  2Y4J A;  5FUH A;  5I1F A;  3SX3 A;  5C3B A;  1R81 A;  3OC9 A;  1JV3 A;  3U2U A;  4FCE A;  2YCM A;  4AYL A;  2RJ9 A;  1W57 A;  3PKP A;  1GQC A;  2VXL A;  2OI7 A;  2WGZ A;  4BQH A;  1ZHJ A;  2VXM A;  4ZDQ A;  2E3D A;  1HM0 A;  2JCK A;  3TQD A;  3CKN A;  1WT2 A;  2X60 A;  3RMW A;  3ST8 A;  1NMM B;  3RMV A;  1ZJ0 A;  3U2W A;  1G3L A;  1XHB A;  1H7E A;  3V0P A;  2VS5 A;  2OEF A;  5CMI A;  1XZ6 A;  5EIY A;  4P00 A;  1ZIZ A;  2AEC A;  1LL3 A;  1PZT A;  1R82 A;  1ZDG A;  3LW6 A;  4KNX A;  4FRO A;  2ICY A;  4FRQ A;  3DK5 A;  2AM3 A;  4NAK A;  4EE5 A;  1FG5 N;  3OH1 A;  4HO4 A;  4FQW A;  3OAM A;  2Y4K A;  2X5S A;  4J18 A;  1R80 A;  3U0X A;  3OH3 A;  5CMH A;  3CKQ A;  2YQS A;  1ZCT A;  5CMF X;  1JYK A;  5C4B A;  1LZ7 A;  1ZJP A;  1ZI1 A;  2W0V A;  5CQO A;  2XWN A;  2ICX A;  3SXE A;  2FYD B;  2E8B A;  1K4V A;  5CQN X;  3U2X A;  3T7O A;  2A8U A;  2VS4 A;  3I0D A;  4Y7F A;  1FGG A;  2AM5 A;  1VGZ A;  2RJ1 A;  2VSH A;  5CQP A;  3ZF8 A;  3GUE A;  2AGD A;  4B2X A;  2W0W A;  2O1H A;  4EE4 A;  4KXO A;  2RIZ A;  1G23 A;  4B4M A;  1V83 A;  1JVD A;  1ZJO A;  4KPX A;  3T7M A;  1H5S A;  1MC3 A;  2A8W A;  4ECM A;  4Y7G A;  4KC1 A;  1LZ0 A;  1YP2 A;  2O1G A;  3CGX A;  2FYA A;  1TZF A;  4Y6U A;  5FTS A;  1ZDF A;  2GGQ A;  2XWL A;  4B5B A;  5HS2 A;  4HO0 A;  2MZB A;  1OMX A;  2RIY A;  4C2S A;  3V90 A;  3I0C A;  1QG8 A;  2AE7 A;  4EE3 A;  3SPT A;  2RJ6 A;  1R7X A;  2I7B A;  1VZT A;  1ON6 A;  2ZU9 A;  4EEG A;  1LVW A;  3BRK X;  5CMG X;  4FRA A;  4DEC A;  2FFU A;  1TW1 A;  3V0L A;  2V0H A;  1G8O A;  1H7Q A;  1O7O A;  5CMJ A;  5J49 A;  2BO6 A;  1VIC A;  1LL2 A;  2XME A;  2Z86 A;  2AM4 A;  3POL A;  1NKH B;  1H5S D;  3EE5 A;  2WVM A;  5FU0 A;  2D7I A;  2WVL A;  1VGW A;  2RJ8 A;  4ARW A;  1FZW A;  2D0J A;  5FYE A;  3KIA A;  3Q7U A;  4Y6N A;  4JD0 A;  1JYL A;  1MP4 A;  1FRW A;  3I0J A;  1H5T A;  1R7U A;  1H7G A;  3USR A;  4HO5 A;  3ZGF A;  2PGY A;  3SXB A;  1YRO B;  1MP5 A;  3CKJ A;  1OQM B;  3V0N A;  5IFY A;  4G3Q A;  4BMA A;  4EEM A;  4B3U A;  1FO9 A;  1FGX A;  1G0R A;  1QGS A;  2V0J A;  4B42 A;  1S4O A;  2YC5 A;  4GBP A;  3V0Q A;  4FRH A;  3E26 A;  1WT1 A;  1G9R A;  1SS9 A;  2I5E A;  1PZY B;  4UEG A;  1H5S B;  3K8D A;  4HO2 A;  5CQL X;  4E1K A;  1QWJ A;  5EJ1 A;  4KC4 A;  2PA4 A;  3DJ4 A;  4P02 A;  5C3A A;  3SX5 A;  2AES A;  2CU2 A;  2YQC A;  1IIN A;  5C4C A;  2XMH A;  2RJ0 A;  1NWG B;  1G95 A;  3TZT A;  2Y7A A;  3PKQ A;  1H5R A;  1FWY A;  1TVY A;  1FOA A;  3I0H A;  4HO6 A;  5C4F A;  3K8E A;  4EEO A;  1KWS A;  4KNR A;  3JUJ A;  2WAW A;  3U0Y A;  2QH5 A;  3T7N A;  4M2A A;  3I0F A;  1LZJ A;  1HM9 A;  2FY7 A;  1VPA A;  1GA8 A;  1ZCV A;  2P73 A;  3V8Y A;  2PX7 A;  1EYR A;  1FXO A;  1VGU A;  1QGQ A;  2WVK A;  2D7R A;  3D98 A;  1Z90 A;  3CKO A;  1ZI4 A;  1YP3 A;  4G3P A;  4D0T A;  5IDS A;  4D48 A;  2QGI A;  3R2W A;  1W77 A;  4M4K A;  4Y7V A;  4M28 A;  4DE7 A;  5FV9 A;  1S4N A;  4Y7U A;  1H5T B;  3SXD A;  3OGZ A;  4NAL A;  3OH2 A;  3U2V A;  1INI A;  1W55 A;  4K6R A;  1G93 A;  4B4B A;  4G3S A;  2O1F A;  1FR8 A;  4Y63 A;  1WT0 A;  1HV9 A;  5DDV A;  4LW3 A;  4D0Z A;  1ZI3 A;  1VGT A;  3U2T A;  4Y62 A;  2FFV A;  1MP3 A;  1I52 A;  1V82 A;  1ZI5 A;  4R7P A;  5IDT A;  1VZU A;  4MND A;  3V0O A;  4AAW A;  4ASJ A;  3SXG A;  3PNN A;  4CJ8 A;  4HOC A;  3CU0 A;  2PGV A;  4LW6 A;  3V91 A;  1O23 B;  4KQL A;  2BO8 A;  2OI6 A;  3OH0 A;  2ZU7 A;  3I0K A;  1O0R A;  1ZJ3 A;  5EJZ A;  5JQQ A;  2RJ7 A;  2RIT A;  3JTJ A;  3O3P A;  1NQI B;  3JUK A;  4G87 A;  1GQ9 A;  3USQ A;  3E25 A;  3I0E A;  2RJ5 A;  1EZI A;  4M2B A;  4XWI A;  4FRE A;  4KPZ A;  3IOH A;  4IRQ A;  4AC3 A;  3SXA A;  1LZI A;  2VSI A;  4KC2 A;  1R7Y A;  1ZCU A;  2Z87 A;  4Y7T A;  3FOQ A;  1GWV A;  4CJC A;  1H5S C;  4EVW A;  2Q4J A;  1H4E A;  2NXV A;  2X5Z A;  1O7Q A;  2P72 A;  2APC A;  2Y4M A;  3I0I X;  4B2W A;  1H7L A;  4FRB A;  1WSZ A;  3DUV A;  3V8Z A;  1H4D A;  4IRP A;  1ZJ1 A;  1JVG A;  2JCJ A;  1JV1 A;  2GGO A;  3Q4S A;  5C1G A;  4YS8 A;  4AYJ A;  5C49 A;  4CVH A;  2YC3 A;  2I5K A;  2V0L A;  3HL3 A;  1H7T A;  5DDT A;  2YQH A;  1GX0 A;  2UX8 A;  4NAI A;  3RSB A;  3Q80 A;  3F1Y A;  3N9W A;  4JIS A;  4KT7 A;  2VFZ A;  1HM8 A;  3D8V A;  2Y4L A;  5CQM X;  2WEE A;  2OEG A;  1WVC A;  1ZJ2 A;  2WE9 A;  3I0L A;  5C8R A;  2RJ4 A;  2FYC B;  3F1C A;  1VZX A;  1V84 A;  3V0M A;  2VS3 A;  2ZU8 A;  4B4G A;  4HO9 A;  1NHE B;  5C3D A;  1WT3 A;  3I0G A;  2BO4 A;  4NAN A;  2Y6P A;  5C38 A;  5C1H A;  4D11 A;  4FRP A;  4Y9X A;  3D5N A;  3QVB A;  4L41 C;  1HJJ A;  1TW5 A;  1HJL A;  1VM8 A;  1NF5 B;  5BXC A;  1E5K A;  4HCQ A;  4KRV A;  4EEA A;  2V0K A;  5FTV A;  1R7V A;  1ZCY A;  1ON8 A;  3OH4 A;  3ZGG A;  1R7T A;  3CKV A; 
#chains in the Genus database with same CATH topology
 5AJN A;  5L6S A;  1INJ A;  4DDZ A;  5C4E A;  2VD4 A;  5C4D A;  4FRD A;  2XWM A;  2BO7 A;  1FR9 A;  1S4P A;  4FRL A;  2DPW A;  3FWW A;  2OI5 A;  5AJP A;  4FCU A;  5L6V A;  1GWW A;  3NGW A;  2AH9 A;  5C36 A;  3R3I A;  1G97 A;  3OKR A;  1H7H A;  1VH1 A;  4HO3 A;  5FU8 A;  3ZLL A;  3SX8 A;  4CJB A;  3ZLK A;  4ASY A;  1LL0 A;  4FRM A;  5AJO A;  2RIX A;  2JCL A;  5C47 A;  4Y64 A;  1G1L A;  3SXC A;  1H5R B;  5C1L A;  1G2V A;  5C48 A;  4HG6 A;  2X65 A;  3IOJ A;  2V0I A;  1YP4 A;  2JCO A;  3SX7 A;  2YES A;  1VH3 A;  1H7F A;  4MYB A;  2FYB A;  2YQJ A;  1FXJ A;  3IOI A;  4HO8 A;  1GX4 A;  1IIM A;  4D11 C;  1H3M A;  1H4C A;  1OMZ A;  3BCV A;  2P6W A;  2QKX A;  1FO8 A;  2Y4J A;  5FUH A;  5I1F A;  3SX3 A;  5C3B A;  1R81 A;  3OC9 A;  1JV3 A;  3U2U A;  4FCE A;  2YCM A;  4AYL A;  2RJ9 A;  1W57 A;  3PKP A;  1GQC A;  2VK9 A;  2VXL A;  2OI7 A;  2WGZ A;  4BQH A;  1ZHJ A;  2VXM A;  4ZDQ A;  2E3D A;  1HM0 A;  2JCK A;  3TQD A;  3CKN A;  1WT2 A;  2X60 A;  3RMW A;  3ST8 A;  1NMM B;  3RMV A;  1ZJ0 A;  2C0N A;  3U2W A;  1G3L A;  1XHB A;  1H7E A;  3V0P A;  2VS5 A;  2OEF A;  5CMI A;  1XZ6 A;  5EIY A;  4P00 A;  1ZIZ A;  2AEC A;  1LL3 A;  1PZT A;  1R82 A;  1ZDG A;  3LW6 A;  4KNX A;  4FRO A;  2ICY A;  4FRQ A;  3DK5 A;  2AM3 A;  4NAK A;  4EE5 A;  1FG5 N;  3OH1 A;  4HO4 A;  4FQW A;  3OAM A;  2Y4K A;  2X5S A;  4J18 A;  1R80 A;  3U0X A;  3OH3 A;  5CMH A;  3CKQ A;  4Q7C A;  2YQS A;  1ZCT A;  5CMF X;  1JYK A;  5C4B A;  1LZ7 A;  1ZJP A;  1ZI1 A;  2W0V A;  5CQO A;  2XWN A;  2ICX A;  3SXE A;  2FYD B;  2E8B A;  1K4V A;  5CQN X;  3U2X A;  3T7O A;  2A8U A;  2VS4 A;  3I0D A;  4Y7F A;  1FGG A;  2AM5 A;  1VGZ A;  2RJ1 A;  2VSH A;  5CQP A;  3ZF8 A;  3GUE A;  2AGD A;  4B2X A;  2W0W A;  2O1H A;  4EE4 A;  4KXO A;  2RIZ A;  1G23 A;  4B4M A;  1V83 A;  1JVD A;  1ZJO A;  4KPX A;  3T7M A;  1H5S A;  1MC3 A;  2A8W A;  4ECM A;  4Y7G A;  4KC1 A;  1LZ0 A;  1YP2 A;  2O1G A;  3CGX A;  2FYA A;  1TZF A;  4Y6U A;  4O6M A;  5FTS A;  1ZDF A;  2GGQ A;  2XWL A;  4B5B A;  5HS2 A;  4HO0 A;  2MZB A;  1OMX A;  2RIY A;  4C2S A;  3V90 A;  3I0C A;  1QG8 A;  2AE7 A;  4EE3 A;  3SPT A;  2RJ6 A;  1R7X A;  2I7B A;  2J0A A;  1VZT A;  1ON6 A;  2ZU9 A;  4EEG A;  1LVW A;  3BRK X;  5CMG X;  4FRA A;  4DEC A;  2FFU A;  1TW1 A;  3V0L A;  2V0H A;  1G8O A;  1H7Q A;  1O7O A;  5CMJ A;  4FIY A;  2BO6 A;  5J49 A;  1VIC A;  1LL2 A;  2XME A;  2Z86 A;  2AM4 A;  3POL A;  1NKH B;  1H5S D;  3EE5 A;  2WVM A;  5FU0 A;  2D7I A;  2WVL A;  1VGW A;  2RJ8 A;  4ARW A;  1FZW A;  2D0J A;  5FYE A;  3KIA A;  3Q7U A;  4Y6N A;  4JD0 A;  1JYL A;  5D91 A;  1MP4 A;  1FRW A;  3I0J A;  1H5T A;  1R7U A;  1H7G A;  3USR A;  4HO5 A;  3ZGF A;  2PGY A;  3SXB A;  1YRO B;  1MP5 A;  3CKJ A;  1OQM B;  3V0N A;  5IFY A;  4G3Q A;  4BMA A;  4EEM A;  4B3U A;  1FO9 A;  1FGX A;  1G0R A;  1QGS A;  2V0J A;  4B42 A;  1S4O A;  2YC5 A;  4GBP A;  3V0Q A;  4FRH A;  3E26 A;  1WT1 A;  1G9R A;  1SS9 A;  2I5E A;  1PZY B;  4UEG A;  1H5S B;  3K8D A;  4HO2 A;  5CQL X;  4E1K A;  1QWJ A;  5EJ1 A;  4KC4 A;  2PA4 A;  3DJ4 A;  4FIX A;  4P02 A;  5C3A A;  3SX5 A;  2AES A;  2CU2 A;  2YQC A;  1IIN A;  5C4C A;  2XMH A;  2RJ0 A;  1NWG B;  1G95 A;  3TZT A;  2Y7A A;  3PKQ A;  1H5R A;  1FWY A;  1TVY A;  1FOA A;  3I0H A;  4HO6 A;  5C4F A;  3K8E A;  4EEO A;  1KWS A;  4KNR A;  3JUJ A;  2WAW A;  3U0Y A;  2QH5 A;  3T7N A;  4M2A A;  3I0F A;  1LZJ A;  1HM9 A;  2FY7 A;  1VPA A;  1GA8 A;  1ZCV A;  2P73 A;  3V8Y A;  2PX7 A;  1EYR A;  1FXO A;  1VGU A;  1QGQ A;  2WVK A;  2D7R A;  3D98 A;  1Z90 A;  3CKO A;  1ZI4 A;  1YP3 A;  4G3P A;  4D0T A;  5IDS A;  4D48 A;  2QGI A;  3R2W A;  1W77 A;  4M4K A;  4Y7V A;  5D92 A;  4M28 A;  4DE7 A;  5FV9 A;  1S4N A;  4Y7U A;  1H5T B;  3SXD A;  3OGZ A;  4NAL A;  3OH2 A;  3U2V A;  1INI A;  1W55 A;  4K6R A;  1G93 A;  4B4B A;  4G3S A;  2O1F A;  1FR8 A;  4Y63 A;  1WT0 A;  1HV9 A;  5DDV A;  4LW3 A;  4D0Z A;  1ZI3 A;  1VGT A;  3U2T A;  4Y62 A;  2FFV A;  1MP3 A;  1I52 A;  1V82 A;  1ZI5 A;  4R7P A;  5IDT A;  1VZU A;  4MND A;  3V0O A;  4AAW A;  4ASJ A;  3SXG A;  3PNN A;  4CJ8 A;  4HOC A;  3CU0 A;  2PGV A;  4LW6 A;  3V91 A;  1O23 B;  4KQL A;  2BO8 A;  2OI6 A;  3OH0 A;  2ZU7 A;  3I0K A;  1O0R A;  1ZJ3 A;  5EJZ A;  4MIX A;  5JQQ A;  2RJ7 A;  2RIT A;  3JTJ A;  3O3P A;  1NQI B;  3JUK A;  4G87 A;  1GQ9 A;  3USQ A;  3E25 A;  3I0E A;  2RJ5 A;  1EZI A;  4M2B A;  4XWI A;  4FRE A;  4KPZ A;  3IOH A;  4IRQ A;  4AC3 A;  3SXA A;  1LZI A;  2VSI A;  4KC2 A;  1R7Y A;  1ZCU A;  2Z87 A;  4Y7T A;  3FOQ A;  1GWV A;  4CJC A;  1H5S C;  4EVW A;  2Q4J A;  1H4E A;  2NXV A;  2X5Z A;  1O7Q A;  2P72 A;  2APC A;  2Y4M A;  3I0I X;  4B2W A;  1H7L A;  4FRB A;  1WSZ A;  3DUV A;  3V8Z A;  1H4D A;  4IRP A;  1ZJ1 A;  1JVG A;  2JCJ A;  1JV1 A;  2GGO A;  3Q4S A;  5C1G A;  4YS8 A;  4AYJ A;  5C49 A;  4CVH A;  2YC3 A;  2I5K A;  2V0L A;  3HL3 A;  4O6N A;  1H7T A;  5DDT A;  2YQH A;  1GX0 A;  2UX8 A;  4NAI A;  3RSB A;  3Q80 A;  3F1Y A;  3N9W A;  4JIS A;  4KT7 A;  2VFZ A;  1HM8 A;  3D8V A;  2Y4L A;  5CQM X;  2WEE A;  2OEG A;  1WVC A;  1ZJ2 A;  2WE9 A;  3I0L A;  5C8R A;  2RJ4 A;  2FYC B;  3F1C A;  1VZX A;  1V84 A;  3V0M A;  2VS3 A;  2ZU8 A;  4B4G A;  4HO9 A;  1NHE B;  5C3D A;  1WT3 A;  3I0G A;  2BO4 A;  4NAN A;  2Y6P A;  5C38 A;  5C1H A;  4D11 A;  4FRP A;  4Y9X A;  3D5N A;  3QVB A;  4L41 C;  1HJJ A;  1TW5 A;  1HJL A;  1VM8 A;  1NF5 B;  5BXC A;  1E5K A;  4HCQ A;  4KRV A;  4EEA A;  2V0K A;  2J0B A;  5FTV A;  1R7V A;  1ZCY A;  1ON8 A;  3OH4 A;  3ZGG A;  1R7T A;  3CKV A; 
#chains in the Genus database with same CATH homology
 5AJN A;  5L6S A;  1INJ A;  4DDZ A;  5C4E A;  2VD4 A;  5C4D A;  4FRD A;  2XWM A;  2BO7 A;  1FR9 A;  1S4P A;  4FRL A;  2DPW A;  3FWW A;  2OI5 A;  5AJP A;  4FCU A;  5L6V A;  1GWW A;  3NGW A;  2AH9 A;  5C36 A;  3R3I A;  1G97 A;  3OKR A;  1H7H A;  1VH1 A;  4HO3 A;  5FU8 A;  3ZLL A;  3SX8 A;  4CJB A;  3ZLK A;  4ASY A;  1LL0 A;  4FRM A;  5AJO A;  2RIX A;  2JCL A;  5C47 A;  4Y64 A;  1G1L A;  3SXC A;  1H5R B;  5C1L A;  1G2V A;  5C48 A;  4HG6 A;  2X65 A;  3IOJ A;  2V0I A;  1YP4 A;  2JCO A;  3SX7 A;  2YES A;  1VH3 A;  1H7F A;  4MYB A;  2FYB A;  2YQJ A;  1FXJ A;  3IOI A;  4HO8 A;  1GX4 A;  1IIM A;  4D11 C;  1H3M A;  1H4C A;  1OMZ A;  3BCV A;  2P6W A;  2QKX A;  1FO8 A;  2Y4J A;  5FUH A;  5I1F A;  3SX3 A;  5C3B A;  1R81 A;  3OC9 A;  1JV3 A;  3U2U A;  4FCE A;  2YCM A;  4AYL A;  2RJ9 A;  1W57 A;  3PKP A;  1GQC A;  2VK9 A;  2VXL A;  2OI7 A;  2WGZ A;  4BQH A;  1ZHJ A;  2VXM A;  4ZDQ A;  2E3D A;  1HM0 A;  2JCK A;  3TQD A;  3CKN A;  1WT2 A;  2X60 A;  3RMW A;  3ST8 A;  1NMM B;  3RMV A;  1ZJ0 A;  2C0N A;  3U2W A;  1G3L A;  1XHB A;  1H7E A;  3V0P A;  2VS5 A;  2OEF A;  5CMI A;  1XZ6 A;  5EIY A;  4P00 A;  1ZIZ A;  2AEC A;  1LL3 A;  1PZT A;  1R82 A;  1ZDG A;  3LW6 A;  4KNX A;  4FRO A;  2ICY A;  4FRQ A;  3DK5 A;  2AM3 A;  4NAK A;  4EE5 A;  1FG5 N;  3OH1 A;  4HO4 A;  4FQW A;  3OAM A;  2Y4K A;  2X5S A;  4J18 A;  1R80 A;  3U0X A;  3OH3 A;  5CMH A;  3CKQ A;  4Q7C A;  2YQS A;  1ZCT A;  5CMF X;  1JYK A;  5C4B A;  1LZ7 A;  1ZJP A;  1ZI1 A;  2W0V A;  5CQO A;  2XWN A;  2ICX A;  3SXE A;  2FYD B;  2E8B A;  1K4V A;  5CQN X;  3U2X A;  3T7O A;  2A8U A;  2VS4 A;  3I0D A;  4Y7F A;  1FGG A;  2AM5 A;  1VGZ A;  2RJ1 A;  2VSH A;  5CQP A;  3ZF8 A;  3GUE A;  2AGD A;  4B2X A;  2W0W A;  2O1H A;  4EE4 A;  4KXO A;  2RIZ A;  1G23 A;  4B4M A;  1V83 A;  1JVD A;  1ZJO A;  4KPX A;  3T7M A;  1H5S A;  1MC3 A;  2A8W A;  4ECM A;  4Y7G A;  4KC1 A;  1LZ0 A;  1YP2 A;  2O1G A;  3CGX A;  2FYA A;  1TZF A;  4Y6U A;  4O6M A;  5FTS A;  1ZDF A;  2GGQ A;  2XWL A;  4B5B A;  5HS2 A;  4HO0 A;  2MZB A;  1OMX A;  2RIY A;  4C2S A;  3V90 A;  3I0C A;  1QG8 A;  2AE7 A;  4EE3 A;  3SPT A;  2RJ6 A;  1R7X A;  2I7B A;  2J0A A;  1VZT A;  1ON6 A;  2ZU9 A;  4EEG A;  1LVW A;  3BRK X;  5CMG X;  4FRA A;  4DEC A;  2FFU A;  1TW1 A;  3V0L A;  2V0H A;  1G8O A;  1H7Q A;  1O7O A;  5CMJ A;  4FIY A;  2BO6 A;  5J49 A;  1VIC A;  1LL2 A;  2XME A;  2Z86 A;  2AM4 A;  3POL A;  1NKH B;  1H5S D;  3EE5 A;  2WVM A;  5FU0 A;  2D7I A;  2WVL A;  1VGW A;  2RJ8 A;  4ARW A;  1FZW A;  2D0J A;  5FYE A;  3KIA A;  3Q7U A;  4Y6N A;  4JD0 A;  1JYL A;  5D91 A;  1MP4 A;  1FRW A;  3I0J A;  1H5T A;  1R7U A;  1H7G A;  3USR A;  4HO5 A;  3ZGF A;  2PGY A;  3SXB A;  1YRO B;  1MP5 A;  3CKJ A;  1OQM B;  3V0N A;  5IFY A;  4G3Q A;  4BMA A;  4EEM A;  4B3U A;  1FO9 A;  1FGX A;  1G0R A;  1QGS A;  2V0J A;  4B42 A;  1S4O A;  2YC5 A;  4GBP A;  3V0Q A;  4FRH A;  3E26 A;  1WT1 A;  1G9R A;  1SS9 A;  2I5E A;  1PZY B;  4UEG A;  1H5S B;  3K8D A;  4HO2 A;  5CQL X;  4E1K A;  1QWJ A;  5EJ1 A;  4KC4 A;  2PA4 A;  3DJ4 A;  4FIX A;  4P02 A;  5C3A A;  3SX5 A;  2AES A;  2CU2 A;  2YQC A;  1IIN A;  5C4C A;  2XMH A;  2RJ0 A;  1NWG B;  1G95 A;  3TZT A;  2Y7A A;  3PKQ A;  1H5R A;  1FWY A;  1TVY A;  1FOA A;  3I0H A;  4HO6 A;  5C4F A;  3K8E A;  4EEO A;  1KWS A;  4KNR A;  3JUJ A;  2WAW A;  3U0Y A;  2QH5 A;  3T7N A;  4M2A A;  3I0F A;  1LZJ A;  1HM9 A;  2FY7 A;  1VPA A;  1GA8 A;  1ZCV A;  2P73 A;  3V8Y A;  2PX7 A;  1EYR A;  1FXO A;  1VGU A;  1QGQ A;  2WVK A;  2D7R A;  3D98 A;  1Z90 A;  3CKO A;  1ZI4 A;  1YP3 A;  4G3P A;  4D0T A;  5IDS A;  4D48 A;  2QGI A;  3R2W A;  1W77 A;  4M4K A;  4Y7V A;  5D92 A;  4M28 A;  4DE7 A;  5FV9 A;  1S4N A;  4Y7U A;  1H5T B;  3SXD A;  3OGZ A;  4NAL A;  3OH2 A;  3U2V A;  1INI A;  1W55 A;  4K6R A;  1G93 A;  4B4B A;  4G3S A;  2O1F A;  1FR8 A;  4Y63 A;  1WT0 A;  1HV9 A;  5DDV A;  4LW3 A;  4D0Z A;  1ZI3 A;  1VGT A;  3U2T A;  4Y62 A;  2FFV A;  1MP3 A;  1I52 A;  1V82 A;  1ZI5 A;  4R7P A;  5IDT A;  1VZU A;  4MND A;  3V0O A;  4AAW A;  4ASJ A;  3SXG A;  3PNN A;  4CJ8 A;  4HOC A;  3CU0 A;  2PGV A;  4LW6 A;  3V91 A;  1O23 B;  4KQL A;  2BO8 A;  2OI6 A;  3OH0 A;  2ZU7 A;  3I0K A;  1O0R A;  1ZJ3 A;  5EJZ A;  4MIX A;  5JQQ A;  2RJ7 A;  2RIT A;  3JTJ A;  3O3P A;  1NQI B;  3JUK A;  4G87 A;  1GQ9 A;  3USQ A;  3E25 A;  3I0E A;  2RJ5 A;  1EZI A;  4M2B A;  4XWI A;  4FRE A;  4KPZ A;  3IOH A;  4IRQ A;  4AC3 A;  3SXA A;  1LZI A;  2VSI A;  4KC2 A;  1R7Y A;  1ZCU A;  2Z87 A;  4Y7T A;  3FOQ A;  1GWV A;  4CJC A;  1H5S C;  4EVW A;  2Q4J A;  1H4E A;  2NXV A;  2X5Z A;  1O7Q A;  2P72 A;  2APC A;  2Y4M A;  3I0I X;  4B2W A;  1H7L A;  4FRB A;  1WSZ A;  3DUV A;  3V8Z A;  1H4D A;  4IRP A;  1ZJ1 A;  1JVG A;  2JCJ A;  1JV1 A;  2GGO A;  3Q4S A;  5C1G A;  4YS8 A;  4AYJ A;  5C49 A;  4CVH A;  2YC3 A;  2I5K A;  2V0L A;  3HL3 A;  4O6N A;  1H7T A;  5DDT A;  2YQH A;  1GX0 A;  2UX8 A;  4NAI A;  3RSB A;  3Q80 A;  3F1Y A;  3N9W A;  4JIS A;  4KT7 A;  2VFZ A;  1HM8 A;  3D8V A;  2Y4L A;  5CQM X;  2WEE A;  2OEG A;  1WVC A;  1ZJ2 A;  2WE9 A;  3I0L A;  5C8R A;  2RJ4 A;  2FYC B;  3F1C A;  1VZX A;  1V84 A;  3V0M A;  2VS3 A;  2ZU8 A;  4B4G A;  4HO9 A;  1NHE B;  5C3D A;  1WT3 A;  3I0G A;  2BO4 A;  4NAN A;  2Y6P A;  5C38 A;  5C1H A;  4D11 A;  4FRP A;  4Y9X A;  3D5N A;  3QVB A;  4L41 C;  1HJJ A;  1TW5 A;  1HJL A;  1VM8 A;  1NF5 B;  5BXC A;  1E5K A;  4HCQ A;  4KRV A;  4EEA A;  2V0K A;  2J0B A;  5FTV A;  1R7V A;  1ZCY A;  1ON8 A;  3OH4 A;  3ZGG A;  1R7T A;  3CKV A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...