5C1HA

Crystal structure of abbb + udp + di
Total Genus 88
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
88
sequence length
285
structure length
277
Chain Sequence
FMVSLPRMVYPQPKVLTPCRKDVLVVTPWLAPIVWEGTFNIDILNEQFRLQNTTIGLTVFAIKKYVAFLKLFLETAEKHFMVGHRVHYYVFTDQPAAVPRVTLGTGRQLSVLEVRAYSMRRMEMISCERRFLSEVDYLVCVDVDMEFRDHVGVEILTPLFGTLHPSFYGSSREAFTYERRPQSQAYIPKDEGDFYYMGAFFGGSVQEVQRLTRACHQAMMVDQANGIEAVWHDESHLNKYLLRHKPTKVLSPEYLWDQQLLGWPAVLRKLRFTAVPK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title High Resolution Structures of the Human ABO(H) Blood Group Enzymes in Complex with Donor Analogs Reveal That the Enzymes Utilize Multiple Donor Conformations to Bind Substrates in a Stepwise Manner.
pubmed doi rcsb
molecule keywords Histo-blood group ABO system transferase
molecule tags Transferase
source organism Homo sapiens
total genus 88
structure length 277
sequence length 285
ec nomenclature ec 2.4.1.37: Fucosylgalactoside 3-alpha-galactosyltransferase.
pdb deposition date 2015-06-13
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.550.10 Alpha Beta Alpha-Beta Complex Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A 5c1hA00
4C2SA 1W57A 2GGOA 2BO4A 1GX4A 2VD4A 3I0IX 3JTJA 2BO8A 4FRLA 2X65A 4J18A 1PZTA 2PGVA 3U2UA 2O1GA 3SPTA 2JCJA 1ZCUA 1H3MA 4HO8A 4CJBA 3OAMA 4G87A 2I7BA 4G3PA 4GBPA 1H4CA 5CMIA 5C3DA 1ZI3A 4XWIA 1S4NA 3I0GA 5CQOA 3V0QA 1H7FA 4HO6A 5CQMX 4HCQA 3SXAA 4MNDA 4B4GA 1K4VA 2W0VA 2YQHA 3PNNA 4B42A 5C4DA 4ASJA 1H7QA 4HO4A 3IOJA 1H5SA 2FYAA 1E5KA 1LVWA 1H7GA 2QKXA 4KT7A 1H5TB 1VZUA 2Y4KA 3E25A 4B3UA 2WAWA 4AYJA 3FWWA 2XMEA 4EVWA 4B2WA 1INJA 3IOIA 2Z87A 4Y63A 3TZTA 1YP3A 1R82A 4FRPA 4KC1A 4Y9XA 5AJPA 1HJLA 1FG5N 1V84A 1VH3A 5EIYA 4IRQA 5JQQA 1O7OA 3V8YA 1HV9A 2NXVA 3V0LA 2VXLA 3ZGFA 5C1GA 3PKPA 3V0PA 3PKQA 2WVMA 3JUJA 4L41C 5EJ1A 5EJZA 2AGDA 1H4DA 5DDVA 4Y7UA 2X5SA 3V0NA 1TW5A 1Z90A 1IINA 2AESA 3OH0A 1GQ9A 1FXOA 1H7LA 2YCMA 1S4PA 5CMGX 1OMXA 1G2VA 1W55A 3U0XA 1ZI1A 2P73A 1FXJA 1YP4A 3OKRA 2V0KA 1WT0A 4AAWA 4EE4A 1NHEB 3V0MA 2BO7A 4FRQA 1XZ6A 2QGIA 4IRPA 3OH1A 1G95A 1YP2A 3RMVA 3U2TA 4ASYA 4K6RA 1VM8A 4FRBA 4JISA 2OEFA 2RJ6A 1G3LA 3I0HA 3T7NA 4FREA 2JCKA 5FV9A 4HO9A 3DK5A 1LL3A 4EE3A 1ZJ3A 1NWGB 1LL0A 2A8WA 2ICYA 1JYKA 2VS5A 3USRA 4CJ8A 4ARWA 4ZDQA 1H4EA 1V83A 2WEEA 3ZGGA 4Y7TA 1FO9A 1S4OA 1G9RA 2YC3A 4FCUA 1NMMB 2PGYA 1FZWA 5C8RA 3BCVA 2OEGA 1FR9A 5C1HA 1TZFA 1HM9A 3RSBA 4HO0A 3ZLKA 5L6SA 1LZJA 2JCLA 1ZIZA 2ZU8A 3RMWA 1O7QA 3T7MA 1MC3A 3D98A 4EEOA 1O23B 2E8BA 4M2AA 5C3BA 4D11C 3E26A 1G23A 3F1YA 4CVHA 3EE5A 3T7OA 1G93A 1H5SC 1H5RA 2V0LA 4Y7FA 1GA8A 2RIZA 1I52A 1ZDFA 1VH1A 2WVLA 3SXGA 4B5BA 3N9WA 1ZJ0A 4B2XA 1VGTA 1VGWA 2V0IA 5FUHA 4NAIA 2VFZA 5CQLX 1LZ7A 3V0OA 4HOCA 3OH2A 1JV3A 4DDZA 3OGZA 4D0ZA 3I0EA 2AECA 1VZXA 3OC9A 2OI6A 3O3PA 1H5SB 1G0RA 2FY7A 3CKJA 1O0RA 2A8UA 1JVGA 1HJJA 1PZYB 1VGZA 1LL2A 2AM3A 2YQSA 2I5EA 4E1KA 2OI5A 1ON6A 2Y4MA 3GUEA 4DE7A 5AJNA 1R7YA 3V91A 1H5TA 1ZJ1A 4AYLA 1ZDGA 2APCA 3SX3A 3OH3A 4KXOA 2Y7AA 2GGQA 2VXMA 3Q4SA 2WE9A 1QGQA 4HO3A 1ZJPA 2RIYA 4KQLA 2O1FA 4JD0A 3U0YA 4UEGA 3USQA 4EEAA 1SS9A 1WT3A 3FOQA 4KPZA 4NAKA 2RJ7A 1R7XA 1JV1A 5L6VA 2VSIA 3SX7A 1H5SD 1FOAA 5J49A 4M2BA 1H7EA 4Y7GA 3V90A 3CKOA 4G3SA 5C36A 2RITA 4HO5A 4NANA 4EEMA 4R7PA 3SX8A 1ON8A 1QG8A 5C1LA 1OQMB 3K8DA 3CKVA 5IDTA 2V0JA 1H7HA 3NGWA 2V0HA 4FRHA 1ZI4A 1ZI5A 5C49A 3SX5A 5IFYA 2YQCA 3I0LA 2E3DA 3DJ4A 5DDTA 1YROB 3ZF8A 2W0WA 3I0DA 2YESA 3D8VA 2AE7A 4BMAA 3I0CA 1WVCA 3OH4A 1GX0A 1TW1A 3CKQA 3TQDA 1XHBA 5C4BA 2O1HA 1INIA 1TVYA 4KC2A 2AH9A 3D5NA 4FCEA 2DPWA 4M28A 3IOHA 3SXEA 4EE5A 5CMFX 4KNXA 4Y6UA 1H5RB 3HL3A 1FWYA 2X5ZA 2D7IA 5C4CA 2RJ4A 1NKHB 1MP4A 2XWMA 4HG6A 3ZLLA 3I0FA 2BO6A 2VS3A 1H7TA 4Y7VA 3CU0A 5FU8A 1ZJ2A 4Y64A 5C4FA 5C3AA 2AM4A 4KRVA 2OI7A 1JYLA 1W77A 4ECMA 1OMZA 3F1CA 3DUVA 5C38A 3U2VA 4BQHA 3R2WA 1IIMA 5FTVA 4EEGA 1EZIA 4D48A 3QVBA 2PX7A 2FFVA 3U2WA 2XWNA 3JUKA 1FR8A 2RJ0A 2D0JA 4P00A 2P6WA 3POLA 4D11A 1FGGA 2YQJA 2VS4A 4G3QA 1R7TA 2Y4JA 3I0JA 2XMHA 1V82A 1R7UA 2Y6PA 1WSZA 4AC3A 2D7RA 3LW6A 3I0KA 1GWVA 3Q7UA 5HS2A 4M4KA 3K8EA 1VZTA 5C48A 1LZIA 2ICXA 2WVKA 4NALA 1WT1A 1G97A 1R81A 4FROA 4Y62A 1NQIB 1ZJOA 1MP5A 2FFUA 4FRAA 4KPXA 4D0TA 4Y6NA 1LZ0A 1EYRA 4FRDA 4KC4A 3SXBA 1G8OA 2UX8A 5AJOA 1NF5B 4FRMA 2MZBA 1G1LA 4P02A 3CKNA 3V8ZA 5IDSA 1ZHJA 3R3IA 5I1FA 3BRKX 1VPAA 2Y4LA 2PA4A 2Q4JA 2ZU7A 4FQWA 4B4MA 2FYCB 5C47A 3Q80A 2JCOA 1GWWA 1R80A 1VGUA 3U2XA 1GQCA 1ZCYA 2WGZA 4MYBA 5FU0A 2QH5A 2P72A 4B4BA 1FO8A 4YS8A 2ZU9A 2I5KA 1HM0A 4HO2A 2VSHA 1HM8A 1QGSA 4DECA 2XWLA 5BXCA 2RJ5A 3ST8A 2YC5A 1KWSA 3SXCA 3CGXA 2RJ8A 2AM5A 4LW6A 1FGXA 1MP3A 5CQPA 2FYBA 4KNRA 5FTSA 5FYEA 1WT2A 1FRWA 3SXDA 3KIAA 2CU2A 5C4EA 2RJ1A 2RJ9A 2FYDB 2X60A 1VICA 1QWJA 5CMJA 2RIXA 1JVDA 1ZCVA 4LW3A 5CMHA 1ZCTA 5CQNX 4CJCA 2Z86A 1R7VA
chains in the Genus database with same CATH superfamily
4C2SA 1W57A 2GGOA 2BO4A 1GX4A 2VD4A 3I0IX 3JTJA 2BO8A 4FRLA 2X65A 4J18A 1PZTA 2PGVA 3U2UA 2O1GA 3SPTA 2JCJA 1ZCUA 1H3MA 4HO8A 4CJBA 3OAMA 4G87A 2I7BA 4G3PA 4GBPA 1H4CA 5CMIA 5C3DA 1ZI3A 4XWIA 1S4NA 3I0GA 5CQOA 3V0QA 1H7FA 4HO6A 5CQMX 4HCQA 3SXAA 4MNDA 4B4GA 1K4VA 2VK9A 2W0VA 2YQHA 3PNNA 4B42A 5C4DA 4ASJA 1H7QA 4HO4A 3IOJA 1H5SA 2FYAA 1E5KA 1LVWA 1H7GA 2QKXA 4KT7A 1H5TB 1VZUA 2Y4KA 3E25A 4B3UA 2WAWA 4AYJA 3FWWA 2XMEA 4EVWA 4B2WA 1INJA 3IOIA 2Z87A 4Y63A 3TZTA 1YP3A 1R82A 4FRPA 4KC1A 4Y9XA 5AJPA 1HJLA 1FG5N 1V84A 1VH3A 5EIYA 4IRQA 5JQQA 1O7OA 3V8YA 1HV9A 4FIYA 2NXVA 3V0LA 2VXLA 3ZGFA 5C1GA 3PKPA 3V0PA 3PKQA 2WVMA 3JUJA 4L41C 5EJ1A 5EJZA 2AGDA 1H4DA 5DDVA 4Y7UA 2X5SA 3V0NA 1TW5A 1Z90A 1IINA 2AESA 3OH0A 1GQ9A 4FIXA 1FXOA 1H7LA 2YCMA 1S4PA 5CMGX 1OMXA 1G2VA 1W55A 2J0AA 3U0XA 1ZI1A 2P73A 1FXJA 1YP4A 4Q7CA 3OKRA 2V0KA 1WT0A 4AAWA 4EE4A 1NHEB 3V0MA 2BO7A 4FRQA 1XZ6A 2QGIA 4IRPA 3OH1A 1G95A 1YP2A 3RMVA 3U2TA 4ASYA 4K6RA 1VM8A 4FRBA 4JISA 2OEFA 2RJ6A 1G3LA 3I0HA 3T7NA 4FREA 2JCKA 5FV9A 4HO9A 3DK5A 1LL3A 4EE3A 1ZJ3A 1NWGB 1LL0A 2A8WA 2ICYA 1JYKA 2VS5A 3USRA 4CJ8A 4ARWA 4ZDQA 1H4EA 1V83A 2WEEA 3ZGGA 4Y7TA 1FO9A 1S4OA 1G9RA 2YC3A 4FCUA 1NMMB 2PGYA 1FZWA 5C8RA 3BCVA 2OEGA 1FR9A 5C1HA 1TZFA 1HM9A 3RSBA 4HO0A 3ZLKA 5L6SA 1LZJA 2JCLA 1ZIZA 2ZU8A 3RMWA 1O7QA 3T7MA 4MIXA 1MC3A 3D98A 4EEOA 1O23B 2E8BA 4M2AA 5C3BA 4D11C 3E26A 1G23A 3F1YA 4CVHA 3EE5A 3T7OA 1G93A 1H5SC 1H5RA 2V0LA 4Y7FA 2J0BA 1GA8A 2RIZA 1I52A 1ZDFA 1VH1A 2WVLA 3SXGA 4B5BA 3N9WA 1ZJ0A 4B2XA 1VGTA 1VGWA 2V0IA 5FUHA 4NAIA 2VFZA 5CQLX 1LZ7A 3V0OA 4HOCA 3OH2A 1JV3A 4DDZA 3OGZA 4D0ZA 3I0EA 2AECA 1VZXA 3OC9A 2OI6A 3O3PA 1H5SB 1G0RA 2FY7A 3CKJA 1O0RA 2A8UA 1JVGA 1HJJA 1PZYB 1VGZA 1LL2A 2AM3A 2YQSA 2I5EA 4E1KA 2OI5A 1ON6A 2Y4MA 3GUEA 5D92A 4DE7A 5AJNA 1R7YA 3V91A 1H5TA 1ZJ1A 4AYLA 1ZDGA 2APCA 3SX3A 3OH3A 4KXOA 2Y7AA 2GGQA 2VXMA 3Q4SA 2WE9A 1QGQA 4HO3A 1ZJPA 2RIYA 4KQLA 2O1FA 4JD0A 3U0YA 4UEGA 3USQA 4EEAA 1SS9A 1WT3A 3FOQA 4KPZA 4NAKA 2RJ7A 1R7XA 1JV1A 5L6VA 2VSIA 3SX7A 1H5SD 1FOAA 5J49A 4M2BA 1H7EA 4Y7GA 3V90A 3CKOA 4G3SA 5C36A 2RITA 4HO5A 4NANA 4EEMA 4R7PA 3SX8A 1ON8A 1QG8A 5C1LA 1OQMB 3K8DA 3CKVA 5IDTA 2V0JA 1H7HA 3NGWA 2V0HA 4FRHA 1ZI4A 1ZI5A 5C49A 3SX5A 5IFYA 2YQCA 3I0LA 2E3DA 3DJ4A 5DDTA 1YROB 3ZF8A 2W0WA 3I0DA 2YESA 3D8VA 2AE7A 4BMAA 3I0CA 1WVCA 3OH4A 1GX0A 1TW1A 3CKQA 3TQDA 1XHBA 4O6NA 5C4BA 2O1HA 1INIA 1TVYA 4KC2A 2AH9A 3D5NA 4FCEA 2DPWA 4M28A 3IOHA 3SXEA 4EE5A 5CMFX 4KNXA 4Y6UA 1H5RB 3HL3A 1FWYA 2X5ZA 2D7IA 5C4CA 2RJ4A 1NKHB 1MP4A 2XWMA 4HG6A 3ZLLA 3I0FA 2BO6A 2VS3A 1H7TA 4Y7VA 3CU0A 5FU8A 1ZJ2A 4Y64A 5C4FA 5C3AA 2AM4A 4KRVA 2OI7A 1JYLA 1W77A 4ECMA 5D91A 1OMZA 3F1CA 3DUVA 5C38A 3U2VA 4BQHA 3R2WA 1IIMA 5FTVA 4EEGA 1EZIA 4D48A 3QVBA 2PX7A 2FFVA 3U2WA 2XWNA 3JUKA 1FR8A 2RJ0A 2D0JA 4P00A 2P6WA 3POLA 4D11A 1FGGA 2YQJA 2VS4A 4G3QA 1R7TA 2Y4JA 3I0JA 2XMHA 1V82A 1R7UA 2Y6PA 1WSZA 4AC3A 2D7RA 3LW6A 3I0KA 1GWVA 3Q7UA 5HS2A 4M4KA 3K8EA 1VZTA 5C48A 1LZIA 2ICXA 2WVKA 4NALA 1WT1A 1G97A 1R81A 4FROA 4Y62A 1NQIB 1ZJOA 1MP5A 2FFUA 4FRAA 4KPXA 4D0TA 4Y6NA 1LZ0A 1EYRA 4FRDA 4KC4A 3SXBA 1G8OA 2UX8A 5AJOA 1NF5B 4FRMA 2MZBA 1G1LA 4P02A 3CKNA 3V8ZA 5IDSA 1ZHJA 3R3IA 5I1FA 3BRKX 1VPAA 2Y4LA 2PA4A 2Q4JA 2ZU7A 4FQWA 4B4MA 2FYCB 5C47A 3Q80A 2JCOA 1GWWA 1R80A 1VGUA 3U2XA 1GQCA 1ZCYA 2WGZA 4MYBA 5FU0A 2QH5A 2P72A 4B4BA 1FO8A 4YS8A 2ZU9A 2I5KA 1HM0A 4HO2A 2VSHA 1HM8A 1QGSA 4DECA 2XWLA 5BXCA 2RJ5A 3ST8A 2YC5A 1KWSA 3SXCA 3CGXA 2RJ8A 2C0NA 2AM5A 4LW6A 1FGXA 1MP3A 5CQPA 2FYBA 4O6MA 4KNRA 5FTSA 5FYEA 1WT2A 1FRWA 3SXDA 3KIAA 2CU2A 5C4EA 2RJ1A 2RJ9A 2FYDB 2X60A 1VICA 1QWJA 5CMJA 2RIXA 1JVDA 1ZCVA 4LW3A 5CMHA 1ZCTA 5CQNX 4CJCA 2Z86A 1R7VA
chains in the Genus database with same CATH topology
4C2SA 1W57A 2GGOA 2BO4A 1GX4A 2VD4A 3I0IX 3JTJA 2BO8A 4FRLA 2X65A 4J18A 1PZTA 2PGVA 3U2UA 2O1GA 3SPTA 2JCJA 1ZCUA 1H3MA 4HO8A 4CJBA 3OAMA 4G87A 2I7BA 4G3PA 4GBPA 1H4CA 5CMIA 5C3DA 1ZI3A 4XWIA 1S4NA 3I0GA 5CQOA 3V0QA 1H7FA 4HO6A 5CQMX 4HCQA 3SXAA 4MNDA 4B4GA 1K4VA 2VK9A 2W0VA 2YQHA 3PNNA 4B42A 5C4DA 4ASJA 1H7QA 4HO4A 3IOJA 1H5SA 2FYAA 1E5KA 1LVWA 1H7GA 2QKXA 4KT7A 1H5TB 1VZUA 2Y4KA 3E25A 4B3UA 2WAWA 4AYJA 3FWWA 2XMEA 4EVWA 4B2WA 1INJA 3IOIA 2Z87A 4Y63A 3TZTA 1YP3A 1R82A 4FRPA 4KC1A 4Y9XA 5AJPA 1HJLA 1FG5N 1V84A 1VH3A 5EIYA 4IRQA 5JQQA 1O7OA 3V8YA 1HV9A 4FIYA 2NXVA 3V0LA 2VXLA 3ZGFA 5C1GA 3PKPA 3V0PA 3PKQA 2WVMA 3JUJA 4L41C 5EJ1A 5EJZA 2AGDA 1H4DA 5DDVA 4Y7UA 2X5SA 3V0NA 1TW5A 1Z90A 1IINA 2AESA 3OH0A 1GQ9A 4FIXA 1FXOA 1H7LA 2YCMA 1S4PA 5CMGX 1OMXA 1G2VA 1W55A 2J0AA 3U0XA 1ZI1A 2P73A 1FXJA 1YP4A 4Q7CA 3OKRA 2V0KA 1WT0A 4AAWA 4EE4A 1NHEB 3V0MA 2BO7A 4FRQA 1XZ6A 2QGIA 4IRPA 3OH1A 1G95A 1YP2A 3RMVA 3U2TA 4ASYA 4K6RA 1VM8A 4FRBA 4JISA 2OEFA 2RJ6A 1G3LA 3I0HA 3T7NA 4FREA 2JCKA 5FV9A 4HO9A 3DK5A 1LL3A 4EE3A 1ZJ3A 1NWGB 1LL0A 2A8WA 2ICYA 1JYKA 2VS5A 3USRA 4CJ8A 4ARWA 4ZDQA 1H4EA 1V83A 2WEEA 3ZGGA 4Y7TA 1FO9A 1S4OA 1G9RA 2YC3A 4FCUA 1NMMB 2PGYA 1FZWA 5C8RA 3BCVA 2OEGA 1FR9A 5C1HA 1TZFA 1HM9A 3RSBA 4HO0A 3ZLKA 5L6SA 1LZJA 2JCLA 1ZIZA 2ZU8A 3RMWA 1O7QA 3T7MA 4MIXA 1MC3A 3D98A 4EEOA 1O23B 2E8BA 4M2AA 5C3BA 4D11C 3E26A 1G23A 3F1YA 4CVHA 3EE5A 3T7OA 1G93A 1H5SC 1H5RA 2V0LA 4Y7FA 2J0BA 1GA8A 2RIZA 1I52A 1ZDFA 1VH1A 2WVLA 3SXGA 4B5BA 3N9WA 1ZJ0A 4B2XA 1VGTA 1VGWA 2V0IA 5FUHA 4NAIA 2VFZA 5CQLX 1LZ7A 3V0OA 4HOCA 3OH2A 1JV3A 4DDZA 3OGZA 4D0ZA 3I0EA 2AECA 1VZXA 3OC9A 2OI6A 3O3PA 1H5SB 1G0RA 2FY7A 3CKJA 1O0RA 2A8UA 1JVGA 1HJJA 1PZYB 1VGZA 1LL2A 2AM3A 2YQSA 2I5EA 4E1KA 2OI5A 1ON6A 2Y4MA 3GUEA 5D92A 4DE7A 5AJNA 1R7YA 3V91A 1H5TA 1ZJ1A 4AYLA 1ZDGA 2APCA 3SX3A 3OH3A 4KXOA 2Y7AA 2GGQA 2VXMA 3Q4SA 2WE9A 1QGQA 4HO3A 1ZJPA 2RIYA 4KQLA 2O1FA 4JD0A 3U0YA 4UEGA 3USQA 4EEAA 1SS9A 1WT3A 3FOQA 4KPZA 4NAKA 2RJ7A 1R7XA 1JV1A 5L6VA 2VSIA 3SX7A 1H5SD 1FOAA 5J49A 4M2BA 1H7EA 4Y7GA 3V90A 3CKOA 4G3SA 5C36A 2RITA 4HO5A 4NANA 4EEMA 4R7PA 3SX8A 1ON8A 1QG8A 5C1LA 1OQMB 3K8DA 3CKVA 5IDTA 2V0JA 1H7HA 3NGWA 2V0HA 4FRHA 1ZI4A 1ZI5A 5C49A 3SX5A 5IFYA 2YQCA 3I0LA 2E3DA 3DJ4A 5DDTA 1YROB 3ZF8A 2W0WA 3I0DA 2YESA 3D8VA 2AE7A 4BMAA 3I0CA 1WVCA 3OH4A 1GX0A 1TW1A 3CKQA 3TQDA 1XHBA 4O6NA 5C4BA 2O1HA 1INIA 1TVYA 4KC2A 2AH9A 3D5NA 4FCEA 2DPWA 4M28A 3IOHA 3SXEA 4EE5A 5CMFX 4KNXA 4Y6UA 1H5RB 3HL3A 1FWYA 2X5ZA 2D7IA 5C4CA 2RJ4A 1NKHB 1MP4A 2XWMA 4HG6A 3ZLLA 3I0FA 2BO6A 2VS3A 1H7TA 4Y7VA 3CU0A 5FU8A 1ZJ2A 4Y64A 5C4FA 5C3AA 2AM4A 4KRVA 2OI7A 1JYLA 1W77A 4ECMA 5D91A 1OMZA 3F1CA 3DUVA 5C38A 3U2VA 4BQHA 3R2WA 1IIMA 5FTVA 4EEGA 1EZIA 4D48A 3QVBA 2PX7A 2FFVA 3U2WA 2XWNA 3JUKA 1FR8A 2RJ0A 2D0JA 4P00A 2P6WA 3POLA 4D11A 1FGGA 2YQJA 2VS4A 4G3QA 1R7TA 2Y4JA 3I0JA 2XMHA 1V82A 1R7UA 2Y6PA 1WSZA 4AC3A 2D7RA 3LW6A 3I0KA 1GWVA 3Q7UA 5HS2A 4M4KA 3K8EA 1VZTA 5C48A 1LZIA 2ICXA 2WVKA 4NALA 1WT1A 1G97A 1R81A 4FROA 4Y62A 1NQIB 1ZJOA 1MP5A 2FFUA 4FRAA 4KPXA 4D0TA 4Y6NA 1LZ0A 1EYRA 4FRDA 4KC4A 3SXBA 1G8OA 2UX8A 5AJOA 1NF5B 4FRMA 2MZBA 1G1LA 4P02A 3CKNA 3V8ZA 5IDSA 1ZHJA 3R3IA 5I1FA 3BRKX 1VPAA 2Y4LA 2PA4A 2Q4JA 2ZU7A 4FQWA 4B4MA 2FYCB 5C47A 3Q80A 2JCOA 1GWWA 1R80A 1VGUA 3U2XA 1GQCA 1ZCYA 2WGZA 4MYBA 5FU0A 2QH5A 2P72A 4B4BA 1FO8A 4YS8A 2ZU9A 2I5KA 1HM0A 4HO2A 2VSHA 1HM8A 1QGSA 4DECA 2XWLA 5BXCA 2RJ5A 3ST8A 2YC5A 1KWSA 3SXCA 3CGXA 2RJ8A 2C0NA 2AM5A 4LW6A 1FGXA 1MP3A 5CQPA 2FYBA 4O6MA 4KNRA 5FTSA 5FYEA 1WT2A 1FRWA 3SXDA 3KIAA 2CU2A 5C4EA 2RJ1A 2RJ9A 2FYDB 2X60A 1VICA 1QWJA 5CMJA 2RIXA 1JVDA 1ZCVA 4LW3A 5CMHA 1ZCTA 5CQNX 4CJCA 2Z86A 1R7VA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4C2S A;  1W57 A;  2GGO A;  2BO4 A;  1GX4 A;  2VD4 A;  3I0I X;  3JTJ A;  2BO8 A;  4FRL A;  2X65 A;  4J18 A;  1PZT A;  2PGV A;  3U2U A;  2O1G A;  3SPT A;  2JCJ A;  1ZCU A;  1H3M A;  4HO8 A;  4CJB A;  3OAM A;  4G87 A;  2I7B A;  4G3P A;  4GBP A;  1H4C A;  5CMI A;  5C3D A;  1ZI3 A;  4XWI A;  1S4N A;  3I0G A;  5CQO A;  3V0Q A;  1H7F A;  4HO6 A;  5CQM X;  4HCQ A;  3SXA A;  4MND A;  4B4G A;  1K4V A;  2W0V A;  2YQH A;  3PNN A;  4B42 A;  5C4D A;  4ASJ A;  1H7Q A;  4HO4 A;  3IOJ A;  1H5S A;  2FYA A;  1E5K A;  1LVW A;  1H7G A;  2QKX A;  4KT7 A;  1H5T B;  1VZU A;  2Y4K A;  3E25 A;  4B3U A;  2WAW A;  4AYJ A;  3FWW A;  2XME A;  4EVW A;  4B2W A;  1INJ A;  3IOI A;  2Z87 A;  4Y63 A;  3TZT A;  1YP3 A;  1R82 A;  4FRP A;  4KC1 A;  4Y9X A;  5AJP A;  1HJL A;  1FG5 N;  1V84 A;  1VH3 A;  5EIY A;  4IRQ A;  5JQQ A;  1O7O A;  3V8Y A;  1HV9 A;  2NXV A;  3V0L A;  2VXL A;  3ZGF A;  5C1G A;  3PKP A;  3V0P A;  3PKQ A;  2WVM A;  3JUJ A;  4L41 C;  5EJ1 A;  5EJZ A;  2AGD A;  1H4D A;  5DDV A;  4Y7U A;  2X5S A;  3V0N A;  1TW5 A;  1Z90 A;  1IIN A;  2AES A;  3OH0 A;  1GQ9 A;  1FXO A;  1H7L A;  2YCM A;  1S4P A;  5CMG X;  1OMX A;  1G2V A;  1W55 A;  3U0X A;  1ZI1 A;  2P73 A;  1FXJ A;  1YP4 A;  3OKR A;  2V0K A;  1WT0 A;  4AAW A;  4EE4 A;  1NHE B;  3V0M A;  2BO7 A;  4FRQ A;  1XZ6 A;  2QGI A;  4IRP A;  3OH1 A;  1G95 A;  1YP2 A;  3RMV A;  3U2T A;  4ASY A;  4K6R A;  1VM8 A;  4FRB A;  4JIS A;  2OEF A;  2RJ6 A;  1G3L A;  3I0H A;  3T7N A;  4FRE A;  2JCK A;  5FV9 A;  4HO9 A;  3DK5 A;  1LL3 A;  4EE3 A;  1ZJ3 A;  1NWG B;  1LL0 A;  2A8W A;  2ICY A;  1JYK A;  2VS5 A;  3USR A;  4CJ8 A;  4ARW A;  4ZDQ A;  1H4E A;  1V83 A;  2WEE A;  3ZGG A;  4Y7T A;  1FO9 A;  1S4O A;  1G9R A;  2YC3 A;  4FCU A;  1NMM B;  2PGY A;  1FZW A;  5C8R A;  3BCV A;  2OEG A;  1FR9 A;  5C1H A;  1TZF A;  1HM9 A;  3RSB A;  4HO0 A;  3ZLK A;  5L6S A;  1LZJ A;  2JCL A;  1ZIZ A;  2ZU8 A;  3RMW A;  1O7Q A;  3T7M A;  1MC3 A;  3D98 A;  4EEO A;  1O23 B;  2E8B A;  4M2A A;  5C3B A;  4D11 C;  3E26 A;  1G23 A;  3F1Y A;  4CVH A;  3EE5 A;  3T7O A;  1G93 A;  1H5S C;  1H5R A;  2V0L A;  4Y7F A;  1GA8 A;  2RIZ A;  1I52 A;  1ZDF A;  1VH1 A;  2WVL A;  3SXG A;  4B5B A;  3N9W A;  1ZJ0 A;  4B2X A;  1VGT A;  1VGW A;  2V0I A;  5FUH A;  4NAI A;  2VFZ A;  5CQL X;  1LZ7 A;  3V0O A;  4HOC A;  3OH2 A;  1JV3 A;  4DDZ A;  3OGZ A;  4D0Z A;  3I0E A;  2AEC A;  1VZX A;  3OC9 A;  2OI6 A;  3O3P A;  1H5S B;  1G0R A;  2FY7 A;  3CKJ A;  1O0R A;  2A8U A;  1JVG A;  1HJJ A;  1PZY B;  1VGZ A;  1LL2 A;  2AM3 A;  2YQS A;  2I5E A;  4E1K A;  2OI5 A;  1ON6 A;  2Y4M A;  3GUE A;  4DE7 A;  5AJN A;  1R7Y A;  3V91 A;  1H5T A;  1ZJ1 A;  4AYL A;  1ZDG A;  2APC A;  3SX3 A;  3OH3 A;  4KXO A;  2Y7A A;  2GGQ A;  2VXM A;  3Q4S A;  2WE9 A;  1QGQ A;  4HO3 A;  1ZJP A;  2RIY A;  4KQL A;  2O1F A;  4JD0 A;  3U0Y A;  4UEG A;  3USQ A;  4EEA A;  1SS9 A;  1WT3 A;  3FOQ A;  4KPZ A;  4NAK A;  2RJ7 A;  1R7X A;  1JV1 A;  5L6V A;  2VSI A;  3SX7 A;  1H5S D;  1FOA A;  5J49 A;  4M2B A;  1H7E A;  4Y7G A;  3V90 A;  3CKO A;  4G3S A;  5C36 A;  2RIT A;  4HO5 A;  4NAN A;  4EEM A;  4R7P A;  3SX8 A;  1ON8 A;  1QG8 A;  5C1L A;  1OQM B;  3K8D A;  3CKV A;  5IDT A;  2V0J A;  1H7H A;  3NGW A;  2V0H A;  4FRH A;  1ZI4 A;  1ZI5 A;  5C49 A;  3SX5 A;  5IFY A;  2YQC A;  3I0L A;  2E3D A;  3DJ4 A;  5DDT A;  1YRO B;  3ZF8 A;  2W0W A;  3I0D A;  2YES A;  3D8V A;  2AE7 A;  4BMA A;  3I0C A;  1WVC A;  3OH4 A;  1GX0 A;  1TW1 A;  3CKQ A;  3TQD A;  1XHB A;  5C4B A;  2O1H A;  1INI A;  1TVY A;  4KC2 A;  2AH9 A;  3D5N A;  4FCE A;  2DPW A;  4M28 A;  3IOH A;  3SXE A;  4EE5 A;  5CMF X;  4KNX A;  4Y6U A;  1H5R B;  3HL3 A;  1FWY A;  2X5Z A;  2D7I A;  5C4C A;  2RJ4 A;  1NKH B;  1MP4 A;  2XWM A;  4HG6 A;  3ZLL A;  3I0F A;  2BO6 A;  2VS3 A;  1H7T A;  4Y7V A;  3CU0 A;  5FU8 A;  1ZJ2 A;  4Y64 A;  5C4F A;  5C3A A;  2AM4 A;  4KRV A;  2OI7 A;  1JYL A;  1W77 A;  4ECM A;  1OMZ A;  3F1C A;  3DUV A;  5C38 A;  3U2V A;  4BQH A;  3R2W A;  1IIM A;  5FTV A;  4EEG A;  1EZI A;  4D48 A;  3QVB A;  2PX7 A;  2FFV A;  3U2W A;  2XWN A;  3JUK A;  1FR8 A;  2RJ0 A;  2D0J A;  4P00 A;  2P6W A;  3POL A;  4D11 A;  1FGG A;  2YQJ A;  2VS4 A;  4G3Q A;  1R7T A;  2Y4J A;  3I0J A;  2XMH A;  1V82 A;  1R7U A;  2Y6P A;  1WSZ A;  4AC3 A;  2D7R A;  3LW6 A;  3I0K A;  1GWV A;  3Q7U A;  5HS2 A;  4M4K A;  3K8E A;  1VZT A;  5C48 A;  1LZI A;  2ICX A;  2WVK A;  4NAL A;  1WT1 A;  1G97 A;  1R81 A;  4FRO A;  4Y62 A;  1NQI B;  1ZJO A;  1MP5 A;  2FFU A;  4FRA A;  4KPX A;  4D0T A;  4Y6N A;  1LZ0 A;  1EYR A;  4FRD A;  4KC4 A;  3SXB A;  1G8O A;  2UX8 A;  5AJO A;  1NF5 B;  4FRM A;  2MZB A;  1G1L A;  4P02 A;  3CKN A;  3V8Z A;  5IDS A;  1ZHJ A;  3R3I A;  5I1F A;  3BRK X;  1VPA A;  2Y4L A;  2PA4 A;  2Q4J A;  2ZU7 A;  4FQW A;  4B4M A;  2FYC B;  5C47 A;  3Q80 A;  2JCO A;  1GWW A;  1R80 A;  1VGU A;  3U2X A;  1GQC A;  1ZCY A;  2WGZ A;  4MYB A;  5FU0 A;  2QH5 A;  2P72 A;  4B4B A;  1FO8 A;  4YS8 A;  2ZU9 A;  2I5K A;  1HM0 A;  4HO2 A;  2VSH A;  1HM8 A;  1QGS A;  4DEC A;  2XWL A;  5BXC A;  2RJ5 A;  3ST8 A;  2YC5 A;  1KWS A;  3SXC A;  3CGX A;  2RJ8 A;  2AM5 A;  4LW6 A;  1FGX A;  1MP3 A;  5CQP A;  2FYB A;  4KNR A;  5FTS A;  5FYE A;  1WT2 A;  1FRW A;  3SXD A;  3KIA A;  2CU2 A;  5C4E A;  2RJ1 A;  2RJ9 A;  2FYD B;  2X60 A;  1VIC A;  1QWJ A;  5CMJ A;  2RIX A;  1JVD A;  1ZCV A;  4LW3 A;  5CMH A;  1ZCT A;  5CQN X;  4CJC A;  2Z86 A;  1R7V A; 
#chains in the Genus database with same CATH topology
 4C2S A;  1W57 A;  2GGO A;  2BO4 A;  1GX4 A;  2VD4 A;  3I0I X;  3JTJ A;  2BO8 A;  4FRL A;  2X65 A;  4J18 A;  1PZT A;  2PGV A;  3U2U A;  2O1G A;  3SPT A;  2JCJ A;  1ZCU A;  1H3M A;  4HO8 A;  4CJB A;  3OAM A;  4G87 A;  2I7B A;  4G3P A;  4GBP A;  1H4C A;  5CMI A;  5C3D A;  1ZI3 A;  4XWI A;  1S4N A;  3I0G A;  5CQO A;  3V0Q A;  1H7F A;  4HO6 A;  5CQM X;  4HCQ A;  3SXA A;  4MND A;  4B4G A;  1K4V A;  2VK9 A;  2W0V A;  2YQH A;  3PNN A;  4B42 A;  5C4D A;  4ASJ A;  1H7Q A;  4HO4 A;  3IOJ A;  1H5S A;  2FYA A;  1E5K A;  1LVW A;  1H7G A;  2QKX A;  4KT7 A;  1H5T B;  1VZU A;  2Y4K A;  3E25 A;  4B3U A;  2WAW A;  4AYJ A;  3FWW A;  2XME A;  4EVW A;  4B2W A;  1INJ A;  3IOI A;  2Z87 A;  4Y63 A;  3TZT A;  1YP3 A;  1R82 A;  4FRP A;  4KC1 A;  4Y9X A;  5AJP A;  1HJL A;  1FG5 N;  1V84 A;  1VH3 A;  5EIY A;  4IRQ A;  5JQQ A;  1O7O A;  3V8Y A;  1HV9 A;  4FIY A;  2NXV A;  3V0L A;  2VXL A;  3ZGF A;  5C1G A;  3PKP A;  3V0P A;  3PKQ A;  2WVM A;  3JUJ A;  4L41 C;  5EJ1 A;  5EJZ A;  2AGD A;  1H4D A;  5DDV A;  4Y7U A;  2X5S A;  3V0N A;  1TW5 A;  1Z90 A;  1IIN A;  2AES A;  3OH0 A;  1GQ9 A;  4FIX A;  1FXO A;  1H7L A;  2YCM A;  1S4P A;  5CMG X;  1OMX A;  1G2V A;  1W55 A;  2J0A A;  3U0X A;  1ZI1 A;  2P73 A;  1FXJ A;  1YP4 A;  4Q7C A;  3OKR A;  2V0K A;  1WT0 A;  4AAW A;  4EE4 A;  1NHE B;  3V0M A;  2BO7 A;  4FRQ A;  1XZ6 A;  2QGI A;  4IRP A;  3OH1 A;  1G95 A;  1YP2 A;  3RMV A;  3U2T A;  4ASY A;  4K6R A;  1VM8 A;  4FRB A;  4JIS A;  2OEF A;  2RJ6 A;  1G3L A;  3I0H A;  3T7N A;  4FRE A;  2JCK A;  5FV9 A;  4HO9 A;  3DK5 A;  1LL3 A;  4EE3 A;  1ZJ3 A;  1NWG B;  1LL0 A;  2A8W A;  2ICY A;  1JYK A;  2VS5 A;  3USR A;  4CJ8 A;  4ARW A;  4ZDQ A;  1H4E A;  1V83 A;  2WEE A;  3ZGG A;  4Y7T A;  1FO9 A;  1S4O A;  1G9R A;  2YC3 A;  4FCU A;  1NMM B;  2PGY A;  1FZW A;  5C8R A;  3BCV A;  2OEG A;  1FR9 A;  5C1H A;  1TZF A;  1HM9 A;  3RSB A;  4HO0 A;  3ZLK A;  5L6S A;  1LZJ A;  2JCL A;  1ZIZ A;  2ZU8 A;  3RMW A;  1O7Q A;  3T7M A;  4MIX A;  1MC3 A;  3D98 A;  4EEO A;  1O23 B;  2E8B A;  4M2A A;  5C3B A;  4D11 C;  3E26 A;  1G23 A;  3F1Y A;  4CVH A;  3EE5 A;  3T7O A;  1G93 A;  1H5S C;  1H5R A;  2V0L A;  4Y7F A;  2J0B A;  1GA8 A;  2RIZ A;  1I52 A;  1ZDF A;  1VH1 A;  2WVL A;  3SXG A;  4B5B A;  3N9W A;  1ZJ0 A;  4B2X A;  1VGT A;  1VGW A;  2V0I A;  5FUH A;  4NAI A;  2VFZ A;  5CQL X;  1LZ7 A;  3V0O A;  4HOC A;  3OH2 A;  1JV3 A;  4DDZ A;  3OGZ A;  4D0Z A;  3I0E A;  2AEC A;  1VZX A;  3OC9 A;  2OI6 A;  3O3P A;  1H5S B;  1G0R A;  2FY7 A;  3CKJ A;  1O0R A;  2A8U A;  1JVG A;  1HJJ A;  1PZY B;  1VGZ A;  1LL2 A;  2AM3 A;  2YQS A;  2I5E A;  4E1K A;  2OI5 A;  1ON6 A;  2Y4M A;  3GUE A;  5D92 A;  4DE7 A;  5AJN A;  1R7Y A;  3V91 A;  1H5T A;  1ZJ1 A;  4AYL A;  1ZDG A;  2APC A;  3SX3 A;  3OH3 A;  4KXO A;  2Y7A A;  2GGQ A;  2VXM A;  3Q4S A;  2WE9 A;  1QGQ A;  4HO3 A;  1ZJP A;  2RIY A;  4KQL A;  2O1F A;  4JD0 A;  3U0Y A;  4UEG A;  3USQ A;  4EEA A;  1SS9 A;  1WT3 A;  3FOQ A;  4KPZ A;  4NAK A;  2RJ7 A;  1R7X A;  1JV1 A;  5L6V A;  2VSI A;  3SX7 A;  1H5S D;  1FOA A;  5J49 A;  4M2B A;  1H7E A;  4Y7G A;  3V90 A;  3CKO A;  4G3S A;  5C36 A;  2RIT A;  4HO5 A;  4NAN A;  4EEM A;  4R7P A;  3SX8 A;  1ON8 A;  1QG8 A;  5C1L A;  1OQM B;  3K8D A;  3CKV A;  5IDT A;  2V0J A;  1H7H A;  3NGW A;  2V0H A;  4FRH A;  1ZI4 A;  1ZI5 A;  5C49 A;  3SX5 A;  5IFY A;  2YQC A;  3I0L A;  2E3D A;  3DJ4 A;  5DDT A;  1YRO B;  3ZF8 A;  2W0W A;  3I0D A;  2YES A;  3D8V A;  2AE7 A;  4BMA A;  3I0C A;  1WVC A;  3OH4 A;  1GX0 A;  1TW1 A;  3CKQ A;  3TQD A;  1XHB A;  4O6N A;  5C4B A;  2O1H A;  1INI A;  1TVY A;  4KC2 A;  2AH9 A;  3D5N A;  4FCE A;  2DPW A;  4M28 A;  3IOH A;  3SXE A;  4EE5 A;  5CMF X;  4KNX A;  4Y6U A;  1H5R B;  3HL3 A;  1FWY A;  2X5Z A;  2D7I A;  5C4C A;  2RJ4 A;  1NKH B;  1MP4 A;  2XWM A;  4HG6 A;  3ZLL A;  3I0F A;  2BO6 A;  2VS3 A;  1H7T A;  4Y7V A;  3CU0 A;  5FU8 A;  1ZJ2 A;  4Y64 A;  5C4F A;  5C3A A;  2AM4 A;  4KRV A;  2OI7 A;  1JYL A;  1W77 A;  4ECM A;  5D91 A;  1OMZ A;  3F1C A;  3DUV A;  5C38 A;  3U2V A;  4BQH A;  3R2W A;  1IIM A;  5FTV A;  4EEG A;  1EZI A;  4D48 A;  3QVB A;  2PX7 A;  2FFV A;  3U2W A;  2XWN A;  3JUK A;  1FR8 A;  2RJ0 A;  2D0J A;  4P00 A;  2P6W A;  3POL A;  4D11 A;  1FGG A;  2YQJ A;  2VS4 A;  4G3Q A;  1R7T A;  2Y4J A;  3I0J A;  2XMH A;  1V82 A;  1R7U A;  2Y6P A;  1WSZ A;  4AC3 A;  2D7R A;  3LW6 A;  3I0K A;  1GWV A;  3Q7U A;  5HS2 A;  4M4K A;  3K8E A;  1VZT A;  5C48 A;  1LZI A;  2ICX A;  2WVK A;  4NAL A;  1WT1 A;  1G97 A;  1R81 A;  4FRO A;  4Y62 A;  1NQI B;  1ZJO A;  1MP5 A;  2FFU A;  4FRA A;  4KPX A;  4D0T A;  4Y6N A;  1LZ0 A;  1EYR A;  4FRD A;  4KC4 A;  3SXB A;  1G8O A;  2UX8 A;  5AJO A;  1NF5 B;  4FRM A;  2MZB A;  1G1L A;  4P02 A;  3CKN A;  3V8Z A;  5IDS A;  1ZHJ A;  3R3I A;  5I1F A;  3BRK X;  1VPA A;  2Y4L A;  2PA4 A;  2Q4J A;  2ZU7 A;  4FQW A;  4B4M A;  2FYC B;  5C47 A;  3Q80 A;  2JCO A;  1GWW A;  1R80 A;  1VGU A;  3U2X A;  1GQC A;  1ZCY A;  2WGZ A;  4MYB A;  5FU0 A;  2QH5 A;  2P72 A;  4B4B A;  1FO8 A;  4YS8 A;  2ZU9 A;  2I5K A;  1HM0 A;  4HO2 A;  2VSH A;  1HM8 A;  1QGS A;  4DEC A;  2XWL A;  5BXC A;  2RJ5 A;  3ST8 A;  2YC5 A;  1KWS A;  3SXC A;  3CGX A;  2RJ8 A;  2C0N A;  2AM5 A;  4LW6 A;  1FGX A;  1MP3 A;  5CQP A;  2FYB A;  4O6M A;  4KNR A;  5FTS A;  5FYE A;  1WT2 A;  1FRW A;  3SXD A;  3KIA A;  2CU2 A;  5C4E A;  2RJ1 A;  2RJ9 A;  2FYD B;  2X60 A;  1VIC A;  1QWJ A;  5CMJ A;  2RIX A;  1JVD A;  1ZCV A;  4LW3 A;  5CMH A;  1ZCT A;  5CQN X;  4CJC A;  2Z86 A;  1R7V A; 
#chains in the Genus database with same CATH homology
 4C2S A;  1W57 A;  2GGO A;  2BO4 A;  1GX4 A;  2VD4 A;  3I0I X;  3JTJ A;  2BO8 A;  4FRL A;  2X65 A;  4J18 A;  1PZT A;  2PGV A;  3U2U A;  2O1G A;  3SPT A;  2JCJ A;  1ZCU A;  1H3M A;  4HO8 A;  4CJB A;  3OAM A;  4G87 A;  2I7B A;  4G3P A;  4GBP A;  1H4C A;  5CMI A;  5C3D A;  1ZI3 A;  4XWI A;  1S4N A;  3I0G A;  5CQO A;  3V0Q A;  1H7F A;  4HO6 A;  5CQM X;  4HCQ A;  3SXA A;  4MND A;  4B4G A;  1K4V A;  2VK9 A;  2W0V A;  2YQH A;  3PNN A;  4B42 A;  5C4D A;  4ASJ A;  1H7Q A;  4HO4 A;  3IOJ A;  1H5S A;  2FYA A;  1E5K A;  1LVW A;  1H7G A;  2QKX A;  4KT7 A;  1H5T B;  1VZU A;  2Y4K A;  3E25 A;  4B3U A;  2WAW A;  4AYJ A;  3FWW A;  2XME A;  4EVW A;  4B2W A;  1INJ A;  3IOI A;  2Z87 A;  4Y63 A;  3TZT A;  1YP3 A;  1R82 A;  4FRP A;  4KC1 A;  4Y9X A;  5AJP A;  1HJL A;  1FG5 N;  1V84 A;  1VH3 A;  5EIY A;  4IRQ A;  5JQQ A;  1O7O A;  3V8Y A;  1HV9 A;  4FIY A;  2NXV A;  3V0L A;  2VXL A;  3ZGF A;  5C1G A;  3PKP A;  3V0P A;  3PKQ A;  2WVM A;  3JUJ A;  4L41 C;  5EJ1 A;  5EJZ A;  2AGD A;  1H4D A;  5DDV A;  4Y7U A;  2X5S A;  3V0N A;  1TW5 A;  1Z90 A;  1IIN A;  2AES A;  3OH0 A;  1GQ9 A;  4FIX A;  1FXO A;  1H7L A;  2YCM A;  1S4P A;  5CMG X;  1OMX A;  1G2V A;  1W55 A;  2J0A A;  3U0X A;  1ZI1 A;  2P73 A;  1FXJ A;  1YP4 A;  4Q7C A;  3OKR A;  2V0K A;  1WT0 A;  4AAW A;  4EE4 A;  1NHE B;  3V0M A;  2BO7 A;  4FRQ A;  1XZ6 A;  2QGI A;  4IRP A;  3OH1 A;  1G95 A;  1YP2 A;  3RMV A;  3U2T A;  4ASY A;  4K6R A;  1VM8 A;  4FRB A;  4JIS A;  2OEF A;  2RJ6 A;  1G3L A;  3I0H A;  3T7N A;  4FRE A;  2JCK A;  5FV9 A;  4HO9 A;  3DK5 A;  1LL3 A;  4EE3 A;  1ZJ3 A;  1NWG B;  1LL0 A;  2A8W A;  2ICY A;  1JYK A;  2VS5 A;  3USR A;  4CJ8 A;  4ARW A;  4ZDQ A;  1H4E A;  1V83 A;  2WEE A;  3ZGG A;  4Y7T A;  1FO9 A;  1S4O A;  1G9R A;  2YC3 A;  4FCU A;  1NMM B;  2PGY A;  1FZW A;  5C8R A;  3BCV A;  2OEG A;  1FR9 A;  5C1H A;  1TZF A;  1HM9 A;  3RSB A;  4HO0 A;  3ZLK A;  5L6S A;  1LZJ A;  2JCL A;  1ZIZ A;  2ZU8 A;  3RMW A;  1O7Q A;  3T7M A;  4MIX A;  1MC3 A;  3D98 A;  4EEO A;  1O23 B;  2E8B A;  4M2A A;  5C3B A;  4D11 C;  3E26 A;  1G23 A;  3F1Y A;  4CVH A;  3EE5 A;  3T7O A;  1G93 A;  1H5S C;  1H5R A;  2V0L A;  4Y7F A;  2J0B A;  1GA8 A;  2RIZ A;  1I52 A;  1ZDF A;  1VH1 A;  2WVL A;  3SXG A;  4B5B A;  3N9W A;  1ZJ0 A;  4B2X A;  1VGT A;  1VGW A;  2V0I A;  5FUH A;  4NAI A;  2VFZ A;  5CQL X;  1LZ7 A;  3V0O A;  4HOC A;  3OH2 A;  1JV3 A;  4DDZ A;  3OGZ A;  4D0Z A;  3I0E A;  2AEC A;  1VZX A;  3OC9 A;  2OI6 A;  3O3P A;  1H5S B;  1G0R A;  2FY7 A;  3CKJ A;  1O0R A;  2A8U A;  1JVG A;  1HJJ A;  1PZY B;  1VGZ A;  1LL2 A;  2AM3 A;  2YQS A;  2I5E A;  4E1K A;  2OI5 A;  1ON6 A;  2Y4M A;  3GUE A;  5D92 A;  4DE7 A;  5AJN A;  1R7Y A;  3V91 A;  1H5T A;  1ZJ1 A;  4AYL A;  1ZDG A;  2APC A;  3SX3 A;  3OH3 A;  4KXO A;  2Y7A A;  2GGQ A;  2VXM A;  3Q4S A;  2WE9 A;  1QGQ A;  4HO3 A;  1ZJP A;  2RIY A;  4KQL A;  2O1F A;  4JD0 A;  3U0Y A;  4UEG A;  3USQ A;  4EEA A;  1SS9 A;  1WT3 A;  3FOQ A;  4KPZ A;  4NAK A;  2RJ7 A;  1R7X A;  1JV1 A;  5L6V A;  2VSI A;  3SX7 A;  1H5S D;  1FOA A;  5J49 A;  4M2B A;  1H7E A;  4Y7G A;  3V90 A;  3CKO A;  4G3S A;  5C36 A;  2RIT A;  4HO5 A;  4NAN A;  4EEM A;  4R7P A;  3SX8 A;  1ON8 A;  1QG8 A;  5C1L A;  1OQM B;  3K8D A;  3CKV A;  5IDT A;  2V0J A;  1H7H A;  3NGW A;  2V0H A;  4FRH A;  1ZI4 A;  1ZI5 A;  5C49 A;  3SX5 A;  5IFY A;  2YQC A;  3I0L A;  2E3D A;  3DJ4 A;  5DDT A;  1YRO B;  3ZF8 A;  2W0W A;  3I0D A;  2YES A;  3D8V A;  2AE7 A;  4BMA A;  3I0C A;  1WVC A;  3OH4 A;  1GX0 A;  1TW1 A;  3CKQ A;  3TQD A;  1XHB A;  4O6N A;  5C4B A;  2O1H A;  1INI A;  1TVY A;  4KC2 A;  2AH9 A;  3D5N A;  4FCE A;  2DPW A;  4M28 A;  3IOH A;  3SXE A;  4EE5 A;  5CMF X;  4KNX A;  4Y6U A;  1H5R B;  3HL3 A;  1FWY A;  2X5Z A;  2D7I A;  5C4C A;  2RJ4 A;  1NKH B;  1MP4 A;  2XWM A;  4HG6 A;  3ZLL A;  3I0F A;  2BO6 A;  2VS3 A;  1H7T A;  4Y7V A;  3CU0 A;  5FU8 A;  1ZJ2 A;  4Y64 A;  5C4F A;  5C3A A;  2AM4 A;  4KRV A;  2OI7 A;  1JYL A;  1W77 A;  4ECM A;  5D91 A;  1OMZ A;  3F1C A;  3DUV A;  5C38 A;  3U2V A;  4BQH A;  3R2W A;  1IIM A;  5FTV A;  4EEG A;  1EZI A;  4D48 A;  3QVB A;  2PX7 A;  2FFV A;  3U2W A;  2XWN A;  3JUK A;  1FR8 A;  2RJ0 A;  2D0J A;  4P00 A;  2P6W A;  3POL A;  4D11 A;  1FGG A;  2YQJ A;  2VS4 A;  4G3Q A;  1R7T A;  2Y4J A;  3I0J A;  2XMH A;  1V82 A;  1R7U A;  2Y6P A;  1WSZ A;  4AC3 A;  2D7R A;  3LW6 A;  3I0K A;  1GWV A;  3Q7U A;  5HS2 A;  4M4K A;  3K8E A;  1VZT A;  5C48 A;  1LZI A;  2ICX A;  2WVK A;  4NAL A;  1WT1 A;  1G97 A;  1R81 A;  4FRO A;  4Y62 A;  1NQI B;  1ZJO A;  1MP5 A;  2FFU A;  4FRA A;  4KPX A;  4D0T A;  4Y6N A;  1LZ0 A;  1EYR A;  4FRD A;  4KC4 A;  3SXB A;  1G8O A;  2UX8 A;  5AJO A;  1NF5 B;  4FRM A;  2MZB A;  1G1L A;  4P02 A;  3CKN A;  3V8Z A;  5IDS A;  1ZHJ A;  3R3I A;  5I1F A;  3BRK X;  1VPA A;  2Y4L A;  2PA4 A;  2Q4J A;  2ZU7 A;  4FQW A;  4B4M A;  2FYC B;  5C47 A;  3Q80 A;  2JCO A;  1GWW A;  1R80 A;  1VGU A;  3U2X A;  1GQC A;  1ZCY A;  2WGZ A;  4MYB A;  5FU0 A;  2QH5 A;  2P72 A;  4B4B A;  1FO8 A;  4YS8 A;  2ZU9 A;  2I5K A;  1HM0 A;  4HO2 A;  2VSH A;  1HM8 A;  1QGS A;  4DEC A;  2XWL A;  5BXC A;  2RJ5 A;  3ST8 A;  2YC5 A;  1KWS A;  3SXC A;  3CGX A;  2RJ8 A;  2C0N A;  2AM5 A;  4LW6 A;  1FGX A;  1MP3 A;  5CQP A;  2FYB A;  4O6M A;  4KNR A;  5FTS A;  5FYE A;  1WT2 A;  1FRW A;  3SXD A;  3KIA A;  2CU2 A;  5C4E A;  2RJ1 A;  2RJ9 A;  2FYD B;  2X60 A;  1VIC A;  1QWJ A;  5CMJ A;  2RIX A;  1JVD A;  1ZCV A;  4LW3 A;  5CMH A;  1ZCT A;  5CQN X;  4CJC A;  2Z86 A;  1R7V A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...