3I0CA

Crystal structure of gtb c80s/c196s unliganded
Total Genus 91
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
91
sequence length
275
structure length
271
Chain Sequence
YPQPKVLTPSRKDVLVVTPWLAPIVWEGTFNIDILNEQFRLQNTTIGLTVFAIKKYVAFLKLFLETAEKHFMVGHRVHYYVFTDQPAAVPRVTLGTGRQLSVLEVGWQDVSMRRMEMISDFSERRFLSEVDYLVCVDVDMEFRDHVGVEILTPLFGTLHPSFYGSSREAFTYERRPQSQAYIPKDEGDFYYMGAFFGGSVQEVQRLTRACHQAMMVDQANGIEAVWHDESHLNKYLLRHKPTKVLSPEYLWDQQLLGWPAVLRKLRFTAVP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ABO glycosyltransferase
publication title Cysteine-to-serine mutants dramatically reorder the active site of human ABO(H) blood group B glycosyltransferase without affecting activity: structural insights into cooperative substrate binding
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 91
structure length 271
sequence length 275
ec nomenclature ec 2.4.1.37: Fucosylgalactoside 3-alpha-galactosyltransferase.
pdb deposition date 2009-06-25
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.550.10 Alpha Beta Alpha-Beta Complex Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A 3i0cA00
1LZ0A 1H7EA 4CJCA 2AGDA 4KPXA 3D5NA 5FYEA 5L6VA 1V82A 1NHEB 1WT2A 5C8RA 3I0LA 2VXLA 2VS4A 2YC3A 3E25A 1YP3A 4HO5A 4GBPA 4Y64A 2RJ5A 5C48A 2D7RA 1ZHJA 1QGQA 4FRLA 2I5KA 1TW5A 1FGGA 4NAKA 3RMWA 1NF5B 1S4NA 1W57A 1FGXA 4UEGA 5C1HA 3ZGFA 1HM0A 3GUEA 2VS3A 1H7QA 2OI5A 4ARWA 3R3IA 5DDVA 2P73A 4G87A 2GGOA 4LW6A 5AJNA 1ZCVA 3OH4A 1WSZA 1JV1A 5J49A 1OMXA 1G23A 3V91A 4KT7A 1G1LA 2BO8A 2JCKA 2Y4KA 4MNDA 1G93A 1ZJ3A 5FU0A 1G8OA 2I7BA 1JV3A 1ZJPA 3IOHA 1OMZA 2AE7A 1ZI5A 1GX0A 2CU2A 2FYDB 3SX3A 4NANA 1H7HA 1TZFA 4G3SA 1H4EA 1GWWA 2YC5A 2AH9A 4KNXA 2P6WA 4ZDQA 1LZIA 4M2AA 3JUKA 4HO3A 1W77A 3IOIA 5AJOA 3CKJA 4JD0A 1SS9A 4NAIA 2WGZA 1FR8A 5C4BA 1HJLA 1O7OA 1H5SC 4D0TA 1VGZA 1ZDFA 1G97A 2QGIA 2A8UA 1R82A 1OQMB 1VH1A 3K8EA 1TVYA 3USRA 1MC3A 1W55A 4FQWA 3SXGA 2A8WA 1MP5A 3USQA 1FR9A 1ZI4A 1R7XA 3OGZA 4FCEA 3PNNA 4M28A 3SXDA 2XMEA 3EE5A 4E1KA 2MZBA 5I1FA 1TW1A 4HO2A 2OI6A 5CMFX 3V0LA 4EE4A 1IINA 4AC3A 4EEGA 3SX7A 5CQPA 1PZYB 2FFUA 1ON6A 2RIZA 2VXMA 2X5ZA 5C4EA 1YP2A 4EVWA 1H5RA 2FYBA 4L41C 1ZJ0A 3CGXA 4B4BA 4G3QA 5EJ1A 4FROA 5C49A 2AESA 5FU8A 2W0VA 3R2WA 1FWYA 3OKRA 4KNRA 1YROB 4YS8A 1WVCA 2RJ4A 4KC4A 4Y6UA 1LVWA 3POLA 4KPZA 5CQOA 3U2WA 3V0PA 1VZUA 2E8BA 2VD4A 3O3PA 4D48A 3PKQA 1H7LA 5C3BA 3I0JA 1GX4A 5IDTA 1INIA 1ZCYA 2P72A 2ZU9A 5EJZA 4HCQA 3I0HA 1GQ9A 1GQCA 3OH3A 4D0ZA 2JCOA 2AECA 1R7UA 2V0IA 4B42A 3LW6A 1EYRA 1NMMB 1FZWA 2YCMA 3ST8A 4BQHA 1VGWA 2ICYA 5CMJA 3IOJA 1FOAA 4EE3A 4EEOA 1VM8A 1H5RB 1R7VA 1HM8A 1VH3A 1ZJ2A 1NQIB 5C4CA 3SXBA 1ZJOA 1MP3A 4FRDA 1QG8A 3Q4SA 3U2UA 1FG5N 2XMHA 3N9WA 3V0MA 3SXAA 4BMAA 2JCLA 4J18A 1YP4A 3CU0A 4JISA 1QWJA 1VGTA 4KXOA 4KRVA 4Y7GA 2Y7AA 1O0RA 4EEAA 1GA8A 1H5SD 2FY7A 3E26A 3Q7UA 2Y4MA 4CVHA 5FV9A 5FTSA 3U0XA 4ASYA 4ASJA 5C36A 5L6SA 4HO4A 1H5SB 5C47A 1JVDA 1ZI3A 4IRQA 3ZF8A 2DPWA 4CJBA 1ZIZA 3FOQA 3D8VA 1FRWA 4B3UA 1WT0A 4FRAA 3I0IX 1ZDGA 4FRBA 2WVMA 3RSBA 5JQQA 1K4VA 2RJ8A 3ZLLA 4B2WA 3I0DA 2RJ7A 2YQHA 2X5SA 1FO9A 2ZU7A 3I0GA 1G3LA 1H4DA 1JYKA 1G2VA 5DDTA 2RJ1A 4HOCA 1MP4A 2D0JA 2VSHA 2V0JA 3I0FA 1HV9A 1H7GA 1NKHB 2E3DA 5IDSA 2VSIA 4HG6A 4G3PA 4KQLA 3OH2A 5HS2A 2YQSA 2O1FA 1EZIA 4HO9A 1FO8A 4DE7A 4FRMA 1FXOA 4AAWA 2WVLA 3F1CA 3SX8A 2Q4JA 4NALA 5C4FA 3CKVA 3KIAA 1R81A 2UX8A 2BO6A 2ZU8A 1LL0A 2V0KA 2Z87A 5CMIA 1GWVA 1V83A 2WVKA 2X60A 3PKPA 2RJ6A 5CQMX 4FRHA 4IRPA 3V8ZA 2I5EA 5C3DA 2VFZA 1VZXA 2XWMA 1IIMA 1R80A 1LL3A 3DK5A 1H5TB 2PX7A 2GGQA 1H7TA 1H5SA 2AM5A 2Y4LA 2D7IA 3V0NA 3V90A 3T7MA 4AYJA 1INJA 1E5KA 4FREA 2V0HA 1NWGB 4HO8A 5CQNX 2XWNA 4Y7VA 3CKOA 1VPAA 1O23B 2VS5A 5FUHA 4K6RA 3HL3A 2QH5A 2O1HA 1HJJA 4MYBA 1LL2A 1VICA 4EE5A 3BRKX 3T7OA 3K8DA 3OH0A 5CQLX 4Y7UA 1V84A 4C2SA 2PGYA 4Y7TA 3NGWA 4Y6NA 3U2VA 1JVGA 2YESA 2FYAA 4KC1A 5AJPA 1XHBA 2XWLA 1WT1A 1WT3A 2W0WA 3DUVA 2FFVA 1XZ6A 4XWIA 2BO4A 3U0YA 1S4PA 3V0QA 1ZCUA 2NXVA 1H3MA 2BO7A 1VGUA 5C1LA 1ZCTA 4HO0A 2RJ0A 1I52A 3I0KA 5IFYA 4D11C 2ICXA 3FWWA 4ECMA 2O1GA 4CJ8A 4P00A 1Z90A 2Y4JA 4FRPA 3V0OA 3OC9A 4B4GA 1ON8A 1S4OA 2JCJA 4Y7FA 2RITA 3SXCA 5C4DA 4Y9XA 4Y63A 1KWSA 1R7YA 4LW3A 3I0CA 3I0EA 1G95A 3ZGGA 3QVBA 2RIXA 3Q80A 2X65A 4AYLA 2RJ9A 1H5TA 1R7TA 1ZI1A 4DECA 1O7QA 3SX5A 4B4MA 3ZLKA 2OEFA 5C1GA 1QGSA 1FXJA 2WAWA 4KC2A 4DDZA 3OAMA 3RMVA 4R7PA 2YQJA 5CMHA 3TZTA 3DJ4A 2APCA 1JYLA 3SPTA 4Y62A 2RIYA 3SXEA 2FYCB 3JUJA 4B2XA 1HM9A 2AM3A 4HO6A 3U2XA 2QKXA 2V0LA 1LZ7A 3CKQA 5C38A 2WE9A 3F1YA 2WEEA 5CMGX 5C3AA 4P02A 1H4CA 4FCUA 3T7NA 5FTVA 1ZJ1A 3JTJA 5BXCA 4EEMA 4D11A 4FRQA 3V8YA 2Z86A 2OI7A 1VZTA 3OH1A 2AM4A 1G9RA 1PZTA 5EIYA 2PGVA 4M2BA 3TQDA 2Y6PA 3D98A 3BCVA 3U2TA 1H7FA 2OEGA 1LZJA 2PA4A 3CKNA 4B5BA 2YQCA 1G0RA 4M4KA
chains in the Genus database with same CATH superfamily
1LZ0A 1H7EA 4CJCA 2AGDA 4KPXA 3D5NA 5FYEA 5L6VA 1V82A 1NHEB 1WT2A 4MIXA 5C8RA 3I0LA 2VXLA 2VS4A 2YC3A 3E25A 1YP3A 4HO5A 4GBPA 4Y64A 2RJ5A 5C48A 2D7RA 1ZHJA 1QGQA 4FRLA 2I5KA 1TW5A 1FGGA 4NAKA 3RMWA 1NF5B 1S4NA 1W57A 1FGXA 4UEGA 5C1HA 3ZGFA 1HM0A 3GUEA 2VS3A 1H7QA 2OI5A 4ARWA 3R3IA 5DDVA 2J0BA 2P73A 4G87A 2GGOA 4LW6A 5AJNA 1ZCVA 3OH4A 1WSZA 1JV1A 5J49A 1OMXA 1G23A 5D91A 3V91A 4KT7A 1G1LA 2BO8A 2JCKA 2Y4KA 4MNDA 1G93A 1ZJ3A 5FU0A 1G8OA 2I7BA 1JV3A 1ZJPA 3IOHA 1OMZA 2AE7A 1ZI5A 1GX0A 2CU2A 2FYDB 3SX3A 4NANA 1H7HA 1TZFA 4G3SA 1H4EA 1GWWA 2YC5A 4FIXA 2AH9A 4KNXA 2P6WA 4ZDQA 1LZIA 4M2AA 3JUKA 4HO3A 1W77A 3IOIA 5AJOA 3CKJA 4JD0A 1SS9A 4NAIA 2WGZA 1FR8A 5C4BA 1HJLA 1O7OA 1H5SC 4D0TA 1VGZA 1ZDFA 1G97A 2QGIA 2A8UA 1R82A 1OQMB 1VH1A 3K8EA 1TVYA 3USRA 1MC3A 1W55A 4FQWA 3SXGA 2A8WA 1MP5A 3USQA 1FR9A 1ZI4A 1R7XA 3OGZA 4FCEA 3PNNA 4M28A 3SXDA 2XMEA 3EE5A 4E1KA 2MZBA 5I1FA 1TW1A 4HO2A 2OI6A 4Q7CA 5CMFX 3V0LA 4EE4A 1IINA 4AC3A 4EEGA 3SX7A 5CQPA 1PZYB 4FIYA 2FFUA 1ON6A 2RIZA 2VXMA 2X5ZA 5C4EA 1YP2A 4EVWA 1H5RA 2FYBA 4L41C 1ZJ0A 3CGXA 4B4BA 4G3QA 5EJ1A 4FROA 5C49A 2AESA 5FU8A 2C0NA 2W0VA 3R2WA 1FWYA 3OKRA 4KNRA 1YROB 4O6NA 4YS8A 1WVCA 2RJ4A 4KC4A 4Y6UA 1LVWA 3POLA 4KPZA 5CQOA 3U2WA 3V0PA 1VZUA 2E8BA 2VD4A 3O3PA 4D48A 3PKQA 1H7LA 5C3BA 3I0JA 1GX4A 5IDTA 1INIA 1ZCYA 2P72A 2ZU9A 5EJZA 4HCQA 3I0HA 1GQ9A 1GQCA 3OH3A 4D0ZA 2JCOA 2AECA 1R7UA 2V0IA 4B42A 3LW6A 1EYRA 1NMMB 1FZWA 2YCMA 3ST8A 4BQHA 1VGWA 2ICYA 5CMJA 3IOJA 1FOAA 4EE3A 4EEOA 1VM8A 1H5RB 1R7VA 1HM8A 1VH3A 1ZJ2A 1NQIB 5C4CA 3SXBA 1ZJOA 1MP3A 4FRDA 1QG8A 3Q4SA 3U2UA 1FG5N 2XMHA 3N9WA 3V0MA 3SXAA 4BMAA 2JCLA 4J18A 1YP4A 3CU0A 4JISA 1QWJA 1VGTA 4KXOA 4KRVA 4Y7GA 2Y7AA 1O0RA 4EEAA 1GA8A 1H5SD 2FY7A 3E26A 3Q7UA 2Y4MA 4CVHA 5FV9A 5FTSA 3U0XA 4ASYA 4ASJA 5C36A 5L6SA 4HO4A 1H5SB 5C47A 1JVDA 1ZI3A 4IRQA 3ZF8A 2DPWA 4CJBA 1ZIZA 3FOQA 3D8VA 1FRWA 4B3UA 1WT0A 4FRAA 3I0IX 1ZDGA 4FRBA 2WVMA 3RSBA 5JQQA 1K4VA 2RJ8A 3ZLLA 4B2WA 3I0DA 2RJ7A 2YQHA 2X5SA 1FO9A 2ZU7A 3I0GA 1G3LA 1H4DA 1JYKA 1G2VA 5DDTA 2RJ1A 4HOCA 1MP4A 2D0JA 2VSHA 2V0JA 3I0FA 1HV9A 1H7GA 1NKHB 2E3DA 5IDSA 2VSIA 4HG6A 2J0AA 4G3PA 4KQLA 3OH2A 5HS2A 2YQSA 2O1FA 1EZIA 4HO9A 1FO8A 4DE7A 4FRMA 1FXOA 4AAWA 2WVLA 3F1CA 3SX8A 2Q4JA 4NALA 5C4FA 3CKVA 3KIAA 1R81A 2UX8A 2BO6A 2ZU8A 1LL0A 2V0KA 2Z87A 5CMIA 1GWVA 1V83A 2WVKA 2X60A 3PKPA 2RJ6A 5CQMX 4FRHA 4IRPA 3V8ZA 2I5EA 5C3DA 2VFZA 1VZXA 2XWMA 1IIMA 1R80A 1LL3A 3DK5A 1H5TB 2PX7A 2GGQA 1H7TA 1H5SA 2AM5A 2Y4LA 2D7IA 3V0NA 3V90A 3T7MA 4AYJA 1INJA 1E5KA 4FREA 2V0HA 1NWGB 4HO8A 5CQNX 2XWNA 4Y7VA 3CKOA 1VPAA 1O23B 2VS5A 5FUHA 4K6RA 3HL3A 2QH5A 2O1HA 1HJJA 4MYBA 1LL2A 1VICA 4EE5A 3BRKX 3T7OA 3K8DA 3OH0A 5CQLX 4Y7UA 1V84A 4C2SA 2PGYA 4Y7TA 3NGWA 4Y6NA 2VK9A 3U2VA 1JVGA 2YESA 2FYAA 4KC1A 5AJPA 1XHBA 2XWLA 1WT1A 1WT3A 2W0WA 3DUVA 2FFVA 1XZ6A 4XWIA 2BO4A 3U0YA 1S4PA 3V0QA 1ZCUA 2NXVA 1H3MA 2BO7A 1VGUA 5C1LA 1ZCTA 4HO0A 2RJ0A 1I52A 3I0KA 5IFYA 4D11C 2ICXA 3FWWA 4ECMA 2O1GA 4CJ8A 4P00A 1Z90A 2Y4JA 4FRPA 3V0OA 3OC9A 4B4GA 1ON8A 1S4OA 2JCJA 4Y7FA 2RITA 3SXCA 5C4DA 4Y9XA 4Y63A 1KWSA 1R7YA 4LW3A 3I0CA 3I0EA 1G95A 3ZGGA 3QVBA 2RIXA 3Q80A 2X65A 4AYLA 2RJ9A 1H5TA 1R7TA 1ZI1A 4DECA 1O7QA 3SX5A 4B4MA 3ZLKA 2OEFA 5C1GA 1QGSA 1FXJA 2WAWA 4KC2A 4DDZA 3OAMA 3RMVA 4R7PA 2YQJA 5CMHA 3TZTA 3DJ4A 2APCA 1JYLA 3SPTA 4Y62A 2RIYA 3SXEA 2FYCB 3JUJA 4B2XA 1HM9A 2AM3A 4HO6A 3U2XA 2QKXA 2V0LA 1LZ7A 3CKQA 5C38A 2WE9A 3F1YA 2WEEA 5CMGX 5C3AA 4P02A 1H4CA 4FCUA 3T7NA 5FTVA 1ZJ1A 3JTJA 5BXCA 4EEMA 4D11A 4FRQA 3V8YA 2Z86A 2OI7A 1VZTA 3OH1A 2AM4A 1G9RA 1PZTA 5EIYA 2PGVA 4M2BA 4O6MA 3TQDA 2Y6PA 3D98A 3BCVA 3U2TA 1H7FA 2OEGA 5D92A 1LZJA 2PA4A 3CKNA 4B5BA 2YQCA 1G0RA 4M4KA
chains in the Genus database with same CATH topology
1LZ0A 1H7EA 4CJCA 2AGDA 4KPXA 3D5NA 5FYEA 5L6VA 1V82A 1NHEB 1WT2A 4MIXA 5C8RA 3I0LA 2VXLA 2VS4A 2YC3A 3E25A 1YP3A 4HO5A 4GBPA 4Y64A 2RJ5A 5C48A 2D7RA 1ZHJA 1QGQA 4FRLA 2I5KA 1TW5A 1FGGA 4NAKA 3RMWA 1NF5B 1S4NA 1W57A 1FGXA 4UEGA 5C1HA 3ZGFA 1HM0A 3GUEA 2VS3A 1H7QA 2OI5A 4ARWA 3R3IA 5DDVA 2J0BA 2P73A 4G87A 2GGOA 4LW6A 5AJNA 1ZCVA 3OH4A 1WSZA 1JV1A 5J49A 1OMXA 1G23A 5D91A 3V91A 4KT7A 1G1LA 2BO8A 2JCKA 2Y4KA 4MNDA 1G93A 1ZJ3A 5FU0A 1G8OA 2I7BA 1JV3A 1ZJPA 3IOHA 1OMZA 2AE7A 1ZI5A 1GX0A 2CU2A 2FYDB 3SX3A 4NANA 1H7HA 1TZFA 4G3SA 1H4EA 1GWWA 2YC5A 4FIXA 2AH9A 4KNXA 2P6WA 4ZDQA 1LZIA 4M2AA 3JUKA 4HO3A 1W77A 3IOIA 5AJOA 3CKJA 4JD0A 1SS9A 4NAIA 2WGZA 1FR8A 5C4BA 1HJLA 1O7OA 1H5SC 4D0TA 1VGZA 1ZDFA 1G97A 2QGIA 2A8UA 1R82A 1OQMB 1VH1A 3K8EA 1TVYA 3USRA 1MC3A 1W55A 4FQWA 3SXGA 2A8WA 1MP5A 3USQA 1FR9A 1ZI4A 1R7XA 3OGZA 4FCEA 3PNNA 4M28A 3SXDA 2XMEA 3EE5A 4E1KA 2MZBA 5I1FA 1TW1A 4HO2A 2OI6A 4Q7CA 5CMFX 3V0LA 4EE4A 1IINA 4AC3A 4EEGA 3SX7A 5CQPA 1PZYB 4FIYA 2FFUA 1ON6A 2RIZA 2VXMA 2X5ZA 5C4EA 1YP2A 4EVWA 1H5RA 2FYBA 4L41C 1ZJ0A 3CGXA 4B4BA 4G3QA 5EJ1A 4FROA 5C49A 2AESA 5FU8A 2C0NA 2W0VA 3R2WA 1FWYA 3OKRA 4KNRA 1YROB 4O6NA 4YS8A 1WVCA 2RJ4A 4KC4A 4Y6UA 1LVWA 3POLA 4KPZA 5CQOA 3U2WA 3V0PA 1VZUA 2E8BA 2VD4A 3O3PA 4D48A 3PKQA 1H7LA 5C3BA 3I0JA 1GX4A 5IDTA 1INIA 1ZCYA 2P72A 2ZU9A 5EJZA 4HCQA 3I0HA 1GQ9A 1GQCA 3OH3A 4D0ZA 2JCOA 2AECA 1R7UA 2V0IA 4B42A 3LW6A 1EYRA 1NMMB 1FZWA 2YCMA 3ST8A 4BQHA 1VGWA 2ICYA 5CMJA 3IOJA 1FOAA 4EE3A 4EEOA 1VM8A 1H5RB 1R7VA 1HM8A 1VH3A 1ZJ2A 1NQIB 5C4CA 3SXBA 1ZJOA 1MP3A 4FRDA 1QG8A 3Q4SA 3U2UA 1FG5N 2XMHA 3N9WA 3V0MA 3SXAA 4BMAA 2JCLA 4J18A 1YP4A 3CU0A 4JISA 1QWJA 1VGTA 4KXOA 4KRVA 4Y7GA 2Y7AA 1O0RA 4EEAA 1GA8A 1H5SD 2FY7A 3E26A 3Q7UA 2Y4MA 4CVHA 5FV9A 5FTSA 3U0XA 4ASYA 4ASJA 5C36A 5L6SA 4HO4A 1H5SB 5C47A 1JVDA 1ZI3A 4IRQA 3ZF8A 2DPWA 4CJBA 1ZIZA 3FOQA 3D8VA 1FRWA 4B3UA 1WT0A 4FRAA 3I0IX 1ZDGA 4FRBA 2WVMA 3RSBA 5JQQA 1K4VA 2RJ8A 3ZLLA 4B2WA 3I0DA 2RJ7A 2YQHA 2X5SA 1FO9A 2ZU7A 3I0GA 1G3LA 1H4DA 1JYKA 1G2VA 5DDTA 2RJ1A 4HOCA 1MP4A 2D0JA 2VSHA 2V0JA 3I0FA 1HV9A 1H7GA 1NKHB 2E3DA 5IDSA 2VSIA 4HG6A 2J0AA 4G3PA 4KQLA 3OH2A 5HS2A 2YQSA 2O1FA 1EZIA 4HO9A 1FO8A 4DE7A 4FRMA 1FXOA 4AAWA 2WVLA 3F1CA 3SX8A 2Q4JA 4NALA 5C4FA 3CKVA 3KIAA 1R81A 2UX8A 2BO6A 2ZU8A 1LL0A 2V0KA 2Z87A 5CMIA 1GWVA 1V83A 2WVKA 2X60A 3PKPA 2RJ6A 5CQMX 4FRHA 4IRPA 3V8ZA 2I5EA 5C3DA 2VFZA 1VZXA 2XWMA 1IIMA 1R80A 1LL3A 3DK5A 1H5TB 2PX7A 2GGQA 1H7TA 1H5SA 2AM5A 2Y4LA 2D7IA 3V0NA 3V90A 3T7MA 4AYJA 1INJA 1E5KA 4FREA 2V0HA 1NWGB 4HO8A 5CQNX 2XWNA 4Y7VA 3CKOA 1VPAA 1O23B 2VS5A 5FUHA 4K6RA 3HL3A 2QH5A 2O1HA 1HJJA 4MYBA 1LL2A 1VICA 4EE5A 3BRKX 3T7OA 3K8DA 3OH0A 5CQLX 4Y7UA 1V84A 4C2SA 2PGYA 4Y7TA 3NGWA 4Y6NA 2VK9A 3U2VA 1JVGA 2YESA 2FYAA 4KC1A 5AJPA 1XHBA 2XWLA 1WT1A 1WT3A 2W0WA 3DUVA 2FFVA 1XZ6A 4XWIA 2BO4A 3U0YA 1S4PA 3V0QA 1ZCUA 2NXVA 1H3MA 2BO7A 1VGUA 5C1LA 1ZCTA 4HO0A 2RJ0A 1I52A 3I0KA 5IFYA 4D11C 2ICXA 3FWWA 4ECMA 2O1GA 4CJ8A 4P00A 1Z90A 2Y4JA 4FRPA 3V0OA 3OC9A 4B4GA 1ON8A 1S4OA 2JCJA 4Y7FA 2RITA 3SXCA 5C4DA 4Y9XA 4Y63A 1KWSA 1R7YA 4LW3A 3I0CA 3I0EA 1G95A 3ZGGA 3QVBA 2RIXA 3Q80A 2X65A 4AYLA 2RJ9A 1H5TA 1R7TA 1ZI1A 4DECA 1O7QA 3SX5A 4B4MA 3ZLKA 2OEFA 5C1GA 1QGSA 1FXJA 2WAWA 4KC2A 4DDZA 3OAMA 3RMVA 4R7PA 2YQJA 5CMHA 3TZTA 3DJ4A 2APCA 1JYLA 3SPTA 4Y62A 2RIYA 3SXEA 2FYCB 3JUJA 4B2XA 1HM9A 2AM3A 4HO6A 3U2XA 2QKXA 2V0LA 1LZ7A 3CKQA 5C38A 2WE9A 3F1YA 2WEEA 5CMGX 5C3AA 4P02A 1H4CA 4FCUA 3T7NA 5FTVA 1ZJ1A 3JTJA 5BXCA 4EEMA 4D11A 4FRQA 3V8YA 2Z86A 2OI7A 1VZTA 3OH1A 2AM4A 1G9RA 1PZTA 5EIYA 2PGVA 4M2BA 4O6MA 3TQDA 2Y6PA 3D98A 3BCVA 3U2TA 1H7FA 2OEGA 5D92A 1LZJA 2PA4A 3CKNA 4B5BA 2YQCA 1G0RA 4M4KA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1LZ0 A;  1H7E A;  4CJC A;  2AGD A;  4KPX A;  3D5N A;  5FYE A;  5L6V A;  1V82 A;  1NHE B;  1WT2 A;  5C8R A;  3I0L A;  2VXL A;  2VS4 A;  2YC3 A;  3E25 A;  1YP3 A;  4HO5 A;  4GBP A;  4Y64 A;  2RJ5 A;  5C48 A;  2D7R A;  1ZHJ A;  1QGQ A;  4FRL A;  2I5K A;  1TW5 A;  1FGG A;  4NAK A;  3RMW A;  1NF5 B;  1S4N A;  1W57 A;  1FGX A;  4UEG A;  5C1H A;  3ZGF A;  1HM0 A;  3GUE A;  2VS3 A;  1H7Q A;  2OI5 A;  4ARW A;  3R3I A;  5DDV A;  2P73 A;  4G87 A;  2GGO A;  4LW6 A;  5AJN A;  1ZCV A;  3OH4 A;  1WSZ A;  1JV1 A;  5J49 A;  1OMX A;  1G23 A;  3V91 A;  4KT7 A;  1G1L A;  2BO8 A;  2JCK A;  2Y4K A;  4MND A;  1G93 A;  1ZJ3 A;  5FU0 A;  1G8O A;  2I7B A;  1JV3 A;  1ZJP A;  3IOH A;  1OMZ A;  2AE7 A;  1ZI5 A;  1GX0 A;  2CU2 A;  2FYD B;  3SX3 A;  4NAN A;  1H7H A;  1TZF A;  4G3S A;  1H4E A;  1GWW A;  2YC5 A;  2AH9 A;  4KNX A;  2P6W A;  4ZDQ A;  1LZI A;  4M2A A;  3JUK A;  4HO3 A;  1W77 A;  3IOI A;  5AJO A;  3CKJ A;  4JD0 A;  1SS9 A;  4NAI A;  2WGZ A;  1FR8 A;  5C4B A;  1HJL A;  1O7O A;  1H5S C;  4D0T A;  1VGZ A;  1ZDF A;  1G97 A;  2QGI A;  2A8U A;  1R82 A;  1OQM B;  1VH1 A;  3K8E A;  1TVY A;  3USR A;  1MC3 A;  1W55 A;  4FQW A;  3SXG A;  2A8W A;  1MP5 A;  3USQ A;  1FR9 A;  1ZI4 A;  1R7X A;  3OGZ A;  4FCE A;  3PNN A;  4M28 A;  3SXD A;  2XME A;  3EE5 A;  4E1K A;  2MZB A;  5I1F A;  1TW1 A;  4HO2 A;  2OI6 A;  5CMF X;  3V0L A;  4EE4 A;  1IIN A;  4AC3 A;  4EEG A;  3SX7 A;  5CQP A;  1PZY B;  2FFU A;  1ON6 A;  2RIZ A;  2VXM A;  2X5Z A;  5C4E A;  1YP2 A;  4EVW A;  1H5R A;  2FYB A;  4L41 C;  1ZJ0 A;  3CGX A;  4B4B A;  4G3Q A;  5EJ1 A;  4FRO A;  5C49 A;  2AES A;  5FU8 A;  2W0V A;  3R2W A;  1FWY A;  3OKR A;  4KNR A;  1YRO B;  4YS8 A;  1WVC A;  2RJ4 A;  4KC4 A;  4Y6U A;  1LVW A;  3POL A;  4KPZ A;  5CQO A;  3U2W A;  3V0P A;  1VZU A;  2E8B A;  2VD4 A;  3O3P A;  4D48 A;  3PKQ A;  1H7L A;  5C3B A;  3I0J A;  1GX4 A;  5IDT A;  1INI A;  1ZCY A;  2P72 A;  2ZU9 A;  5EJZ A;  4HCQ A;  3I0H A;  1GQ9 A;  1GQC A;  3OH3 A;  4D0Z A;  2JCO A;  2AEC A;  1R7U A;  2V0I A;  4B42 A;  3LW6 A;  1EYR A;  1NMM B;  1FZW A;  2YCM A;  3ST8 A;  4BQH A;  1VGW A;  2ICY A;  5CMJ A;  3IOJ A;  1FOA A;  4EE3 A;  4EEO A;  1VM8 A;  1H5R B;  1R7V A;  1HM8 A;  1VH3 A;  1ZJ2 A;  1NQI B;  5C4C A;  3SXB A;  1ZJO A;  1MP3 A;  4FRD A;  1QG8 A;  3Q4S A;  3U2U A;  1FG5 N;  2XMH A;  3N9W A;  3V0M A;  3SXA A;  4BMA A;  2JCL A;  4J18 A;  1YP4 A;  3CU0 A;  4JIS A;  1QWJ A;  1VGT A;  4KXO A;  4KRV A;  4Y7G A;  2Y7A A;  1O0R A;  4EEA A;  1GA8 A;  1H5S D;  2FY7 A;  3E26 A;  3Q7U A;  2Y4M A;  4CVH A;  5FV9 A;  5FTS A;  3U0X A;  4ASY A;  4ASJ A;  5C36 A;  5L6S A;  4HO4 A;  1H5S B;  5C47 A;  1JVD A;  1ZI3 A;  4IRQ A;  3ZF8 A;  2DPW A;  4CJB A;  1ZIZ A;  3FOQ A;  3D8V A;  1FRW A;  4B3U A;  1WT0 A;  4FRA A;  3I0I X;  1ZDG A;  4FRB A;  2WVM A;  3RSB A;  5JQQ A;  1K4V A;  2RJ8 A;  3ZLL A;  4B2W A;  3I0D A;  2RJ7 A;  2YQH A;  2X5S A;  1FO9 A;  2ZU7 A;  3I0G A;  1G3L A;  1H4D A;  1JYK A;  1G2V A;  5DDT A;  2RJ1 A;  4HOC A;  1MP4 A;  2D0J A;  2VSH A;  2V0J A;  3I0F A;  1HV9 A;  1H7G A;  1NKH B;  2E3D A;  5IDS A;  2VSI A;  4HG6 A;  4G3P A;  4KQL A;  3OH2 A;  5HS2 A;  2YQS A;  2O1F A;  1EZI A;  4HO9 A;  1FO8 A;  4DE7 A;  4FRM A;  1FXO A;  4AAW A;  2WVL A;  3F1C A;  3SX8 A;  2Q4J A;  4NAL A;  5C4F A;  3CKV A;  3KIA A;  1R81 A;  2UX8 A;  2BO6 A;  2ZU8 A;  1LL0 A;  2V0K A;  2Z87 A;  5CMI A;  1GWV A;  1V83 A;  2WVK A;  2X60 A;  3PKP A;  2RJ6 A;  5CQM X;  4FRH A;  4IRP A;  3V8Z A;  2I5E A;  5C3D A;  2VFZ A;  1VZX A;  2XWM A;  1IIM A;  1R80 A;  1LL3 A;  3DK5 A;  1H5T B;  2PX7 A;  2GGQ A;  1H7T A;  1H5S A;  2AM5 A;  2Y4L A;  2D7I A;  3V0N A;  3V90 A;  3T7M A;  4AYJ A;  1INJ A;  1E5K A;  4FRE A;  2V0H A;  1NWG B;  4HO8 A;  5CQN X;  2XWN A;  4Y7V A;  3CKO A;  1VPA A;  1O23 B;  2VS5 A;  5FUH A;  4K6R A;  3HL3 A;  2QH5 A;  2O1H A;  1HJJ A;  4MYB A;  1LL2 A;  1VIC A;  4EE5 A;  3BRK X;  3T7O A;  3K8D A;  3OH0 A;  5CQL X;  4Y7U A;  1V84 A;  4C2S A;  2PGY A;  4Y7T A;  3NGW A;  4Y6N A;  3U2V A;  1JVG A;  2YES A;  2FYA A;  4KC1 A;  5AJP A;  1XHB A;  2XWL A;  1WT1 A;  1WT3 A;  2W0W A;  3DUV A;  2FFV A;  1XZ6 A;  4XWI A;  2BO4 A;  3U0Y A;  1S4P A;  3V0Q A;  1ZCU A;  2NXV A;  1H3M A;  2BO7 A;  1VGU A;  5C1L A;  1ZCT A;  4HO0 A;  2RJ0 A;  1I52 A;  3I0K A;  5IFY A;  4D11 C;  2ICX A;  3FWW A;  4ECM A;  2O1G A;  4CJ8 A;  4P00 A;  1Z90 A;  2Y4J A;  4FRP A;  3V0O A;  3OC9 A;  4B4G A;  1ON8 A;  1S4O A;  2JCJ A;  4Y7F A;  2RIT A;  3SXC A;  5C4D A;  4Y9X A;  4Y63 A;  1KWS A;  1R7Y A;  4LW3 A;  3I0C A;  3I0E A;  1G95 A;  3ZGG A;  3QVB A;  2RIX A;  3Q80 A;  2X65 A;  4AYL A;  2RJ9 A;  1H5T A;  1R7T A;  1ZI1 A;  4DEC A;  1O7Q A;  3SX5 A;  4B4M A;  3ZLK A;  2OEF A;  5C1G A;  1QGS A;  1FXJ A;  2WAW A;  4KC2 A;  4DDZ A;  3OAM A;  3RMV A;  4R7P A;  2YQJ A;  5CMH A;  3TZT A;  3DJ4 A;  2APC A;  1JYL A;  3SPT A;  4Y62 A;  2RIY A;  3SXE A;  2FYC B;  3JUJ A;  4B2X A;  1HM9 A;  2AM3 A;  4HO6 A;  3U2X A;  2QKX A;  2V0L A;  1LZ7 A;  3CKQ A;  5C38 A;  2WE9 A;  3F1Y A;  2WEE A;  5CMG X;  5C3A A;  4P02 A;  1H4C A;  4FCU A;  3T7N A;  5FTV A;  1ZJ1 A;  3JTJ A;  5BXC A;  4EEM A;  4D11 A;  4FRQ A;  3V8Y A;  2Z86 A;  2OI7 A;  1VZT A;  3OH1 A;  2AM4 A;  1G9R A;  1PZT A;  5EIY A;  2PGV A;  4M2B A;  3TQD A;  2Y6P A;  3D98 A;  3BCV A;  3U2T A;  1H7F A;  2OEG A;  1LZJ A;  2PA4 A;  3CKN A;  4B5B A;  2YQC A;  1G0R A;  4M4K A; 
#chains in the Genus database with same CATH topology
 1LZ0 A;  1H7E A;  4CJC A;  2AGD A;  4KPX A;  3D5N A;  5FYE A;  5L6V A;  1V82 A;  1NHE B;  1WT2 A;  4MIX A;  5C8R A;  3I0L A;  2VXL A;  2VS4 A;  2YC3 A;  3E25 A;  1YP3 A;  4HO5 A;  4GBP A;  4Y64 A;  2RJ5 A;  5C48 A;  2D7R A;  1ZHJ A;  1QGQ A;  4FRL A;  2I5K A;  1TW5 A;  1FGG A;  4NAK A;  3RMW A;  1NF5 B;  1S4N A;  1W57 A;  1FGX A;  4UEG A;  5C1H A;  3ZGF A;  1HM0 A;  3GUE A;  2VS3 A;  1H7Q A;  2OI5 A;  4ARW A;  3R3I A;  5DDV A;  2J0B A;  2P73 A;  4G87 A;  2GGO A;  4LW6 A;  5AJN A;  1ZCV A;  3OH4 A;  1WSZ A;  1JV1 A;  5J49 A;  1OMX A;  1G23 A;  5D91 A;  3V91 A;  4KT7 A;  1G1L A;  2BO8 A;  2JCK A;  2Y4K A;  4MND A;  1G93 A;  1ZJ3 A;  5FU0 A;  1G8O A;  2I7B A;  1JV3 A;  1ZJP A;  3IOH A;  1OMZ A;  2AE7 A;  1ZI5 A;  1GX0 A;  2CU2 A;  2FYD B;  3SX3 A;  4NAN A;  1H7H A;  1TZF A;  4G3S A;  1H4E A;  1GWW A;  2YC5 A;  4FIX A;  2AH9 A;  4KNX A;  2P6W A;  4ZDQ A;  1LZI A;  4M2A A;  3JUK A;  4HO3 A;  1W77 A;  3IOI A;  5AJO A;  3CKJ A;  4JD0 A;  1SS9 A;  4NAI A;  2WGZ A;  1FR8 A;  5C4B A;  1HJL A;  1O7O A;  1H5S C;  4D0T A;  1VGZ A;  1ZDF A;  1G97 A;  2QGI A;  2A8U A;  1R82 A;  1OQM B;  1VH1 A;  3K8E A;  1TVY A;  3USR A;  1MC3 A;  1W55 A;  4FQW A;  3SXG A;  2A8W A;  1MP5 A;  3USQ A;  1FR9 A;  1ZI4 A;  1R7X A;  3OGZ A;  4FCE A;  3PNN A;  4M28 A;  3SXD A;  2XME A;  3EE5 A;  4E1K A;  2MZB A;  5I1F A;  1TW1 A;  4HO2 A;  2OI6 A;  4Q7C A;  5CMF X;  3V0L A;  4EE4 A;  1IIN A;  4AC3 A;  4EEG A;  3SX7 A;  5CQP A;  1PZY B;  4FIY A;  2FFU A;  1ON6 A;  2RIZ A;  2VXM A;  2X5Z A;  5C4E A;  1YP2 A;  4EVW A;  1H5R A;  2FYB A;  4L41 C;  1ZJ0 A;  3CGX A;  4B4B A;  4G3Q A;  5EJ1 A;  4FRO A;  5C49 A;  2AES A;  5FU8 A;  2C0N A;  2W0V A;  3R2W A;  1FWY A;  3OKR A;  4KNR A;  1YRO B;  4O6N A;  4YS8 A;  1WVC A;  2RJ4 A;  4KC4 A;  4Y6U A;  1LVW A;  3POL A;  4KPZ A;  5CQO A;  3U2W A;  3V0P A;  1VZU A;  2E8B A;  2VD4 A;  3O3P A;  4D48 A;  3PKQ A;  1H7L A;  5C3B A;  3I0J A;  1GX4 A;  5IDT A;  1INI A;  1ZCY A;  2P72 A;  2ZU9 A;  5EJZ A;  4HCQ A;  3I0H A;  1GQ9 A;  1GQC A;  3OH3 A;  4D0Z A;  2JCO A;  2AEC A;  1R7U A;  2V0I A;  4B42 A;  3LW6 A;  1EYR A;  1NMM B;  1FZW A;  2YCM A;  3ST8 A;  4BQH A;  1VGW A;  2ICY A;  5CMJ A;  3IOJ A;  1FOA A;  4EE3 A;  4EEO A;  1VM8 A;  1H5R B;  1R7V A;  1HM8 A;  1VH3 A;  1ZJ2 A;  1NQI B;  5C4C A;  3SXB A;  1ZJO A;  1MP3 A;  4FRD A;  1QG8 A;  3Q4S A;  3U2U A;  1FG5 N;  2XMH A;  3N9W A;  3V0M A;  3SXA A;  4BMA A;  2JCL A;  4J18 A;  1YP4 A;  3CU0 A;  4JIS A;  1QWJ A;  1VGT A;  4KXO A;  4KRV A;  4Y7G A;  2Y7A A;  1O0R A;  4EEA A;  1GA8 A;  1H5S D;  2FY7 A;  3E26 A;  3Q7U A;  2Y4M A;  4CVH A;  5FV9 A;  5FTS A;  3U0X A;  4ASY A;  4ASJ A;  5C36 A;  5L6S A;  4HO4 A;  1H5S B;  5C47 A;  1JVD A;  1ZI3 A;  4IRQ A;  3ZF8 A;  2DPW A;  4CJB A;  1ZIZ A;  3FOQ A;  3D8V A;  1FRW A;  4B3U A;  1WT0 A;  4FRA A;  3I0I X;  1ZDG A;  4FRB A;  2WVM A;  3RSB A;  5JQQ A;  1K4V A;  2RJ8 A;  3ZLL A;  4B2W A;  3I0D A;  2RJ7 A;  2YQH A;  2X5S A;  1FO9 A;  2ZU7 A;  3I0G A;  1G3L A;  1H4D A;  1JYK A;  1G2V A;  5DDT A;  2RJ1 A;  4HOC A;  1MP4 A;  2D0J A;  2VSH A;  2V0J A;  3I0F A;  1HV9 A;  1H7G A;  1NKH B;  2E3D A;  5IDS A;  2VSI A;  4HG6 A;  2J0A A;  4G3P A;  4KQL A;  3OH2 A;  5HS2 A;  2YQS A;  2O1F A;  1EZI A;  4HO9 A;  1FO8 A;  4DE7 A;  4FRM A;  1FXO A;  4AAW A;  2WVL A;  3F1C A;  3SX8 A;  2Q4J A;  4NAL A;  5C4F A;  3CKV A;  3KIA A;  1R81 A;  2UX8 A;  2BO6 A;  2ZU8 A;  1LL0 A;  2V0K A;  2Z87 A;  5CMI A;  1GWV A;  1V83 A;  2WVK A;  2X60 A;  3PKP A;  2RJ6 A;  5CQM X;  4FRH A;  4IRP A;  3V8Z A;  2I5E A;  5C3D A;  2VFZ A;  1VZX A;  2XWM A;  1IIM A;  1R80 A;  1LL3 A;  3DK5 A;  1H5T B;  2PX7 A;  2GGQ A;  1H7T A;  1H5S A;  2AM5 A;  2Y4L A;  2D7I A;  3V0N A;  3V90 A;  3T7M A;  4AYJ A;  1INJ A;  1E5K A;  4FRE A;  2V0H A;  1NWG B;  4HO8 A;  5CQN X;  2XWN A;  4Y7V A;  3CKO A;  1VPA A;  1O23 B;  2VS5 A;  5FUH A;  4K6R A;  3HL3 A;  2QH5 A;  2O1H A;  1HJJ A;  4MYB A;  1LL2 A;  1VIC A;  4EE5 A;  3BRK X;  3T7O A;  3K8D A;  3OH0 A;  5CQL X;  4Y7U A;  1V84 A;  4C2S A;  2PGY A;  4Y7T A;  3NGW A;  4Y6N A;  2VK9 A;  3U2V A;  1JVG A;  2YES A;  2FYA A;  4KC1 A;  5AJP A;  1XHB A;  2XWL A;  1WT1 A;  1WT3 A;  2W0W A;  3DUV A;  2FFV A;  1XZ6 A;  4XWI A;  2BO4 A;  3U0Y A;  1S4P A;  3V0Q A;  1ZCU A;  2NXV A;  1H3M A;  2BO7 A;  1VGU A;  5C1L A;  1ZCT A;  4HO0 A;  2RJ0 A;  1I52 A;  3I0K A;  5IFY A;  4D11 C;  2ICX A;  3FWW A;  4ECM A;  2O1G A;  4CJ8 A;  4P00 A;  1Z90 A;  2Y4J A;  4FRP A;  3V0O A;  3OC9 A;  4B4G A;  1ON8 A;  1S4O A;  2JCJ A;  4Y7F A;  2RIT A;  3SXC A;  5C4D A;  4Y9X A;  4Y63 A;  1KWS A;  1R7Y A;  4LW3 A;  3I0C A;  3I0E A;  1G95 A;  3ZGG A;  3QVB A;  2RIX A;  3Q80 A;  2X65 A;  4AYL A;  2RJ9 A;  1H5T A;  1R7T A;  1ZI1 A;  4DEC A;  1O7Q A;  3SX5 A;  4B4M A;  3ZLK A;  2OEF A;  5C1G A;  1QGS A;  1FXJ A;  2WAW A;  4KC2 A;  4DDZ A;  3OAM A;  3RMV A;  4R7P A;  2YQJ A;  5CMH A;  3TZT A;  3DJ4 A;  2APC A;  1JYL A;  3SPT A;  4Y62 A;  2RIY A;  3SXE A;  2FYC B;  3JUJ A;  4B2X A;  1HM9 A;  2AM3 A;  4HO6 A;  3U2X A;  2QKX A;  2V0L A;  1LZ7 A;  3CKQ A;  5C38 A;  2WE9 A;  3F1Y A;  2WEE A;  5CMG X;  5C3A A;  4P02 A;  1H4C A;  4FCU A;  3T7N A;  5FTV A;  1ZJ1 A;  3JTJ A;  5BXC A;  4EEM A;  4D11 A;  4FRQ A;  3V8Y A;  2Z86 A;  2OI7 A;  1VZT A;  3OH1 A;  2AM4 A;  1G9R A;  1PZT A;  5EIY A;  2PGV A;  4M2B A;  4O6M A;  3TQD A;  2Y6P A;  3D98 A;  3BCV A;  3U2T A;  1H7F A;  2OEG A;  5D92 A;  1LZJ A;  2PA4 A;  3CKN A;  4B5B A;  2YQC A;  1G0R A;  4M4K A; 
#chains in the Genus database with same CATH homology
 1LZ0 A;  1H7E A;  4CJC A;  2AGD A;  4KPX A;  3D5N A;  5FYE A;  5L6V A;  1V82 A;  1NHE B;  1WT2 A;  4MIX A;  5C8R A;  3I0L A;  2VXL A;  2VS4 A;  2YC3 A;  3E25 A;  1YP3 A;  4HO5 A;  4GBP A;  4Y64 A;  2RJ5 A;  5C48 A;  2D7R A;  1ZHJ A;  1QGQ A;  4FRL A;  2I5K A;  1TW5 A;  1FGG A;  4NAK A;  3RMW A;  1NF5 B;  1S4N A;  1W57 A;  1FGX A;  4UEG A;  5C1H A;  3ZGF A;  1HM0 A;  3GUE A;  2VS3 A;  1H7Q A;  2OI5 A;  4ARW A;  3R3I A;  5DDV A;  2J0B A;  2P73 A;  4G87 A;  2GGO A;  4LW6 A;  5AJN A;  1ZCV A;  3OH4 A;  1WSZ A;  1JV1 A;  5J49 A;  1OMX A;  1G23 A;  5D91 A;  3V91 A;  4KT7 A;  1G1L A;  2BO8 A;  2JCK A;  2Y4K A;  4MND A;  1G93 A;  1ZJ3 A;  5FU0 A;  1G8O A;  2I7B A;  1JV3 A;  1ZJP A;  3IOH A;  1OMZ A;  2AE7 A;  1ZI5 A;  1GX0 A;  2CU2 A;  2FYD B;  3SX3 A;  4NAN A;  1H7H A;  1TZF A;  4G3S A;  1H4E A;  1GWW A;  2YC5 A;  4FIX A;  2AH9 A;  4KNX A;  2P6W A;  4ZDQ A;  1LZI A;  4M2A A;  3JUK A;  4HO3 A;  1W77 A;  3IOI A;  5AJO A;  3CKJ A;  4JD0 A;  1SS9 A;  4NAI A;  2WGZ A;  1FR8 A;  5C4B A;  1HJL A;  1O7O A;  1H5S C;  4D0T A;  1VGZ A;  1ZDF A;  1G97 A;  2QGI A;  2A8U A;  1R82 A;  1OQM B;  1VH1 A;  3K8E A;  1TVY A;  3USR A;  1MC3 A;  1W55 A;  4FQW A;  3SXG A;  2A8W A;  1MP5 A;  3USQ A;  1FR9 A;  1ZI4 A;  1R7X A;  3OGZ A;  4FCE A;  3PNN A;  4M28 A;  3SXD A;  2XME A;  3EE5 A;  4E1K A;  2MZB A;  5I1F A;  1TW1 A;  4HO2 A;  2OI6 A;  4Q7C A;  5CMF X;  3V0L A;  4EE4 A;  1IIN A;  4AC3 A;  4EEG A;  3SX7 A;  5CQP A;  1PZY B;  4FIY A;  2FFU A;  1ON6 A;  2RIZ A;  2VXM A;  2X5Z A;  5C4E A;  1YP2 A;  4EVW A;  1H5R A;  2FYB A;  4L41 C;  1ZJ0 A;  3CGX A;  4B4B A;  4G3Q A;  5EJ1 A;  4FRO A;  5C49 A;  2AES A;  5FU8 A;  2C0N A;  2W0V A;  3R2W A;  1FWY A;  3OKR A;  4KNR A;  1YRO B;  4O6N A;  4YS8 A;  1WVC A;  2RJ4 A;  4KC4 A;  4Y6U A;  1LVW A;  3POL A;  4KPZ A;  5CQO A;  3U2W A;  3V0P A;  1VZU A;  2E8B A;  2VD4 A;  3O3P A;  4D48 A;  3PKQ A;  1H7L A;  5C3B A;  3I0J A;  1GX4 A;  5IDT A;  1INI A;  1ZCY A;  2P72 A;  2ZU9 A;  5EJZ A;  4HCQ A;  3I0H A;  1GQ9 A;  1GQC A;  3OH3 A;  4D0Z A;  2JCO A;  2AEC A;  1R7U A;  2V0I A;  4B42 A;  3LW6 A;  1EYR A;  1NMM B;  1FZW A;  2YCM A;  3ST8 A;  4BQH A;  1VGW A;  2ICY A;  5CMJ A;  3IOJ A;  1FOA A;  4EE3 A;  4EEO A;  1VM8 A;  1H5R B;  1R7V A;  1HM8 A;  1VH3 A;  1ZJ2 A;  1NQI B;  5C4C A;  3SXB A;  1ZJO A;  1MP3 A;  4FRD A;  1QG8 A;  3Q4S A;  3U2U A;  1FG5 N;  2XMH A;  3N9W A;  3V0M A;  3SXA A;  4BMA A;  2JCL A;  4J18 A;  1YP4 A;  3CU0 A;  4JIS A;  1QWJ A;  1VGT A;  4KXO A;  4KRV A;  4Y7G A;  2Y7A A;  1O0R A;  4EEA A;  1GA8 A;  1H5S D;  2FY7 A;  3E26 A;  3Q7U A;  2Y4M A;  4CVH A;  5FV9 A;  5FTS A;  3U0X A;  4ASY A;  4ASJ A;  5C36 A;  5L6S A;  4HO4 A;  1H5S B;  5C47 A;  1JVD A;  1ZI3 A;  4IRQ A;  3ZF8 A;  2DPW A;  4CJB A;  1ZIZ A;  3FOQ A;  3D8V A;  1FRW A;  4B3U A;  1WT0 A;  4FRA A;  3I0I X;  1ZDG A;  4FRB A;  2WVM A;  3RSB A;  5JQQ A;  1K4V A;  2RJ8 A;  3ZLL A;  4B2W A;  3I0D A;  2RJ7 A;  2YQH A;  2X5S A;  1FO9 A;  2ZU7 A;  3I0G A;  1G3L A;  1H4D A;  1JYK A;  1G2V A;  5DDT A;  2RJ1 A;  4HOC A;  1MP4 A;  2D0J A;  2VSH A;  2V0J A;  3I0F A;  1HV9 A;  1H7G A;  1NKH B;  2E3D A;  5IDS A;  2VSI A;  4HG6 A;  2J0A A;  4G3P A;  4KQL A;  3OH2 A;  5HS2 A;  2YQS A;  2O1F A;  1EZI A;  4HO9 A;  1FO8 A;  4DE7 A;  4FRM A;  1FXO A;  4AAW A;  2WVL A;  3F1C A;  3SX8 A;  2Q4J A;  4NAL A;  5C4F A;  3CKV A;  3KIA A;  1R81 A;  2UX8 A;  2BO6 A;  2ZU8 A;  1LL0 A;  2V0K A;  2Z87 A;  5CMI A;  1GWV A;  1V83 A;  2WVK A;  2X60 A;  3PKP A;  2RJ6 A;  5CQM X;  4FRH A;  4IRP A;  3V8Z A;  2I5E A;  5C3D A;  2VFZ A;  1VZX A;  2XWM A;  1IIM A;  1R80 A;  1LL3 A;  3DK5 A;  1H5T B;  2PX7 A;  2GGQ A;  1H7T A;  1H5S A;  2AM5 A;  2Y4L A;  2D7I A;  3V0N A;  3V90 A;  3T7M A;  4AYJ A;  1INJ A;  1E5K A;  4FRE A;  2V0H A;  1NWG B;  4HO8 A;  5CQN X;  2XWN A;  4Y7V A;  3CKO A;  1VPA A;  1O23 B;  2VS5 A;  5FUH A;  4K6R A;  3HL3 A;  2QH5 A;  2O1H A;  1HJJ A;  4MYB A;  1LL2 A;  1VIC A;  4EE5 A;  3BRK X;  3T7O A;  3K8D A;  3OH0 A;  5CQL X;  4Y7U A;  1V84 A;  4C2S A;  2PGY A;  4Y7T A;  3NGW A;  4Y6N A;  2VK9 A;  3U2V A;  1JVG A;  2YES A;  2FYA A;  4KC1 A;  5AJP A;  1XHB A;  2XWL A;  1WT1 A;  1WT3 A;  2W0W A;  3DUV A;  2FFV A;  1XZ6 A;  4XWI A;  2BO4 A;  3U0Y A;  1S4P A;  3V0Q A;  1ZCU A;  2NXV A;  1H3M A;  2BO7 A;  1VGU A;  5C1L A;  1ZCT A;  4HO0 A;  2RJ0 A;  1I52 A;  3I0K A;  5IFY A;  4D11 C;  2ICX A;  3FWW A;  4ECM A;  2O1G A;  4CJ8 A;  4P00 A;  1Z90 A;  2Y4J A;  4FRP A;  3V0O A;  3OC9 A;  4B4G A;  1ON8 A;  1S4O A;  2JCJ A;  4Y7F A;  2RIT A;  3SXC A;  5C4D A;  4Y9X A;  4Y63 A;  1KWS A;  1R7Y A;  4LW3 A;  3I0C A;  3I0E A;  1G95 A;  3ZGG A;  3QVB A;  2RIX A;  3Q80 A;  2X65 A;  4AYL A;  2RJ9 A;  1H5T A;  1R7T A;  1ZI1 A;  4DEC A;  1O7Q A;  3SX5 A;  4B4M A;  3ZLK A;  2OEF A;  5C1G A;  1QGS A;  1FXJ A;  2WAW A;  4KC2 A;  4DDZ A;  3OAM A;  3RMV A;  4R7P A;  2YQJ A;  5CMH A;  3TZT A;  3DJ4 A;  2APC A;  1JYL A;  3SPT A;  4Y62 A;  2RIY A;  3SXE A;  2FYC B;  3JUJ A;  4B2X A;  1HM9 A;  2AM3 A;  4HO6 A;  3U2X A;  2QKX A;  2V0L A;  1LZ7 A;  3CKQ A;  5C38 A;  2WE9 A;  3F1Y A;  2WEE A;  5CMG X;  5C3A A;  4P02 A;  1H4C A;  4FCU A;  3T7N A;  5FTV A;  1ZJ1 A;  3JTJ A;  5BXC A;  4EEM A;  4D11 A;  4FRQ A;  3V8Y A;  2Z86 A;  2OI7 A;  1VZT A;  3OH1 A;  2AM4 A;  1G9R A;  1PZT A;  5EIY A;  2PGV A;  4M2B A;  4O6M A;  3TQD A;  2Y6P A;  3D98 A;  3BCV A;  3U2T A;  1H7F A;  2OEG A;  5D92 A;  1LZJ A;  2PA4 A;  3CKN A;  4B5B A;  2YQC A;  1G0R A;  4M4K A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...