3I0CA

Crystal structure of gtb c80s/c196s unliganded
Total Genus 91
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
91
sequence length
275
structure length
271
Chain Sequence
YPQPKVLTPSRKDVLVVTPWLAPIVWEGTFNIDILNEQFRLQNTTIGLTVFAIKKYVAFLKLFLETAEKHFMVGHRVHYYVFTDQPAAVPRVTLGTGRQLSVLEVGWQDVSMRRMEMISDFSERRFLSEVDYLVCVDVDMEFRDHVGVEILTPLFGTLHPSFYGSSREAFTYERRPQSQAYIPKDEGDFYYMGAFFGGSVQEVQRLTRACHQAMMVDQANGIEAVWHDESHLNKYLLRHKPTKVLSPEYLWDQQLLGWPAVLRKLRFTAVP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords ABO glycosyltransferase
publication title Cysteine-to-serine mutants dramatically reorder the active site of human ABO(H) blood group B glycosyltransferase without affecting activity: structural insights into cooperative substrate binding
pubmed doi rcsb
source organism Homo sapiens
total genus 91
structure length 271
sequence length 275
ec nomenclature ec 2.4.1.37: Fucosylgalactoside 3-alpha-galactosyltransferase.
pdb deposition date 2009-06-25
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.550.10 Alpha Beta Alpha-Beta Complex Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A 3i0cA00
1ZJOA 5HS2A 5EIYA 4G87A 4HO5A 3RSBA 1NQIB 4FREA 2D7IA 1VGUA 3CKOA 3OAMA 2X60A 2V0LA 1GQCA 3V0NA 4KC1A 2FY7A 4B4GA 4Y62A 1OQMB 2RJ8A 3V0PA 1G0RA 1VZTA 1H3MA 5FTSA 3JUJA 2ZU8A 4HO9A 4LW3A 3SXEA 3IOJA 2V0HA 2ICYA 2AE7A 2YC3A 2X65A 3FOQA 1LL0A 3U2TA 1FGXA 2VXMA 4EE5A 2BO7A 1FZWA 5IDSA 3CGXA 4IRPA 1YP4A 2O1GA 4KPZA 1R7UA 4HG6A 1TW1A 2A8WA 4G3PA 4B4MA 3V8YA 2YESA 3SX7A 3OH0A 1FO8A 3IOIA 3D98A 3ZGFA 2OEFA 2AM3A 1TW5A 2RJ7A 3USRA 3I0FA 1HV9A 2Z87A 1HM9A 2CU2A 1NMMB 1ZCVA 3E25A 3ST8A 1JV1A 3CKVA 4KXOA 1ZJPA 4FROA 2Y4KA 5C49A 1FRWA 4BQHA 1G95A 3KIAA 3CKQA 2JCKA 4NALA 2WVMA 1V84A 3V91A 4KNXA 4HO4A 1LVWA 4D11C 3U2WA 2GGOA 1MC3A 3IOHA 2FYDB 2ZU9A 4UEGA 5C8RA 1E5KA 1LL3A 5EJZA 3K8EA 4DDZA 3POLA 1G9RA 1H7EA 3OH4A 4CVHA 2MZBA 3I0KA 3Q7UA 2VS5A 2PA4A 3JTJA 4Y7FA 1INJA 2AGDA 2V0KA 4C2SA 5C4DA 4ASYA 3OH2A 4AAWA 4M2BA 1S4PA 1PZYB 5L6VA 1NKHB 1INIA 1WVCA 2E3DA 1H5SA 1JYLA 3DJ4A 1FWYA 3PKQA 1G23A 1LZIA 4Y7UA 2QH5A 4YS8A 3U2XA 4D0TA 4KC2A 1IINA 1S4OA 1GWVA 2AECA 1FR9A 1VGWA 1GQ9A 2WAWA 5C48A 1FR8A 2Y7AA 1H7QA 1WT3A 1ZHJA 1EZIA 2YCMA 4HOCA 4D48A 2VXLA 2AESA 4Y6NA 4B42A 4FCUA 2GGQA 4KRVA 1ZJ3A 3D8VA 1ZDGA 1G2VA 4NAKA 1G1LA 5C4BA 3Q80A 2OI6A 4E1KA 1MP4A 1TVYA 4L41C 1EYRA 1VPAA 4D0ZA 2FYBA 1JVDA 1V82A 2XWMA 4B5BA 5DDVA 2FFUA 4CJCA 1XHBA 3TZTA 5CMIA 1R7TA 2JCOA 3SX5A 4AYJA 1H5SD 1FO9A 4ASJA 3V0OA 2VFZA 4G3SA 4EVWA 1G8OA 4FRHA 2Y4JA 2FFVA 5BXCA 1QWJA 2PX7A 2RIYA 3I0CA 1OMZA 1ON6A 2FYAA 2OI5A 1LZ0A 2AM4A 1WT1A 3ZLKA 5CQNX 5L6SA 3F1CA 4IRQA 4Y63A 3E26A 3I0EA 1LZ7A 2WE9A 4Y7GA 3OH1A 5CMGX 1ZI1A 2XMHA 5I1FA 2RJ1A 1ZJ2A 3I0HA 1W77A 3O3PA 2YQJA 4EEOA 1NF5B 4JISA 5C4CA 2P6WA 2YQSA 3I0DA 1R82A 2X5ZA 5CQOA 4FRDA 4D11A 4JD0A 2RJ9A 5CQMX 1FXOA 1V83A 1VZUA 1TZFA 4KQLA 4Y9XA 1ON8A 3R3IA 1ZCYA 2YQHA 4G3QA 5JQQA 2JCLA 2PGYA 4FRPA 4Y7TA 1VH3A 4FQWA 2RITA 4AC3A 1ZIZA 5AJNA 1HJJA 3ZGGA 3D5NA 3V0QA 2VS4A 4KPXA 4CJBA 4B2XA 3SPTA 2Y4LA 4FRAA 4FRQA 3SXDA 2PGVA 3K8DA 1ZI4A 1OMXA 2V0IA 1HJLA 3T7MA 1VGZA 5C47A 4HO2A 1H4EA 1H5TB 5CQPA 5FTVA 1R7YA 2WEEA 3Q4SA 2D7RA 1QGQA 2O1FA 2XWLA 2VSHA 2RJ5A 2VSIA 1GWWA 5CQLX 1O7OA 3U2UA 5CMFX 2RJ0A 2BO4A 3NGWA 2UX8A 2DPWA 1H7LA 4FCEA 4MYBA 2Y6PA 1R7VA 3ZLLA 2BO6A 4AYLA 2FYCB 1R80A 1O23B 5C1GA 1ZI5A 4M2AA 1H5SC 1QGSA 1H5RB 2O1HA 1W57A 4NANA 3EE5A 3U0YA 4FRLA 1FOAA 2VD4A 1MP3A 4NAIA 3GUEA 4XWIA 3SXBA 1H7HA 1Z90A 4GBPA 5C4EA 1I52A 3CU0A 1FGGA 3CKNA 1ZJ1A 4HO8A 1FXJA 1ZDFA 1WT0A 3N9WA 4FRBA 4ARWA 2AH9A 4B3UA 3T7OA 2I5EA 1YP3A 2ICXA 3CKJA 3OC9A 1H7FA 3R2WA 3SXGA 1VM8A 1MP5A 2Y4MA 4BMAA 4HO0A 1VH1A 2W0VA 4B2WA 1IIMA 1W55A 2I7BA 1LZJA 2VS3A 5C3AA 1H4DA 3LW6A 3OGZA 1HM0A 2XWNA 4KC4A 3V8ZA 3SX3A 4K6RA 1H4CA 4Y7VA 4Y6UA 1GX0A 2AM5A 1K4VA 3SXCA 3BCVA 4EE4A 3I0GA 5FYEA 3I0IX 4KT7A 4M28A 3U0XA 4HCQA 5J49A 1PZTA 2RJ6A 5CMJA 2BO8A 1YP2A 2YQCA 1WT2A 1GX4A 1ZCUA 2P72A 2XMEA 1ZCTA 1R7XA 4EE3A 4Y64A 1G3LA 2OI7A 4CJ8A 1HM8A 2V0JA 1O7QA 5IFYA 2Q4JA 5C3DA 3FWWA 1FG5N 4P02A 2NXVA 1VZXA 3T7NA 2E8BA 1YROB 5IDTA 2WGZA 5CMHA 3JUKA 4EEMA 4J18A 5AJOA 5C3BA 1SS9A 2WVLA 1NHEB 1ZJ0A 3PKPA 1R81A 2QKXA 3RMWA 5C1LA 2JCJA 3V90A 5C4FA 1O0RA 4R7PA 5DDTA 1H7TA 4M4KA 3SXAA 2WVKA 1QG8A 1H5TA 5FV9A 3PNNA 2W0WA 3OKRA 1ZI3A 4HO6A 3RMVA 2I5KA 5FU8A 4HO3A 2RJ4A 4KNRA 1JV3A 2OEGA 3HL3A 2Z86A 5C1HA 3V0MA 3V0LA 1GA8A 5C36A 4LW6A 3DK5A 2D0JA 4B4BA 1NWGB 5C38A 4EEAA 1S4NA 4ECMA 1JVGA 1WSZA 4DECA 4P00A 3USQA 3DUVA 4DE7A 1G97A 4MNDA 1H5RA 1G93A 1LL2A 4FRMA 1VICA 5FUHA 3OH3A 5EJ1A 3SX8A 1JYKA 2YC5A 2A8UA 4ZDQA 2QGIA 3I0LA 1VGTA 3I0JA 1KWSA 4EEGA 3TQDA 2RIZA 3U2VA 2RIXA 2ZU7A 1H5SB 1XZ6A 5FU0A 3BRKX 2APCA 3ZF8A 2P73A 2X5SA 5AJPA 1H7GA 3F1YA 3QVBA
chains in the Genus database with same CATH superfamily
1ZJOA 5HS2A 5EIYA 4G87A 4HO5A 3RSBA 1NQIB 4FREA 2D7IA 1VGUA 3CKOA 3OAMA 2X60A 2V0LA 1GQCA 3V0NA 4KC1A 2FY7A 4B4GA 4Y62A 1OQMB 2RJ8A 3V0PA 1G0RA 1VZTA 1H3MA 5FTSA 3JUJA 2ZU8A 4HO9A 4LW3A 3SXEA 3IOJA 2V0HA 2ICYA 2AE7A 2YC3A 2X65A 3FOQA 1LL0A 3U2TA 1FGXA 2VXMA 4EE5A 2BO7A 1FZWA 5IDSA 3CGXA 4IRPA 1YP4A 2O1GA 4KPZA 1R7UA 4HG6A 1TW1A 2A8WA 4G3PA 2VK9A 4B4MA 3V8YA 2YESA 3SX7A 3OH0A 1FO8A 3IOIA 3D98A 3ZGFA 2OEFA 2AM3A 5D91A 1TW5A 2RJ7A 3USRA 3I0FA 1HV9A 2Z87A 1HM9A 2CU2A 1NMMB 1ZCVA 3E25A 3ST8A 1JV1A 3CKVA 4KXOA 1ZJPA 4FROA 2Y4KA 5C49A 1FRWA 4BQHA 1G95A 3KIAA 3CKQA 2J0AA 2JCKA 2WVMA 4NALA 1V84A 3V91A 4KNXA 4HO4A 1LVWA 4D11C 3U2WA 2GGOA 1MC3A 3IOHA 2FYDB 2ZU9A 4UEGA 5C8RA 1E5KA 1LL3A 5EJZA 3K8EA 4DDZA 3POLA 1G9RA 1H7EA 3OH4A 4CVHA 2MZBA 3I0KA 3Q7UA 2VS5A 2PA4A 3JTJA 4Y7FA 1INJA 2AGDA 2V0KA 4C2SA 5C4DA 4ASYA 3OH2A 4AAWA 4M2BA 1S4PA 1PZYB 5L6VA 1NKHB 1INIA 1WVCA 2E3DA 1H5SA 1JYLA 3DJ4A 1FWYA 3PKQA 1G23A 1LZIA 4Y7UA 2QH5A 4YS8A 3U2XA 4D0TA 4KC2A 4O6MA 1IINA 1S4OA 1GWVA 2AECA 1FR9A 1VGWA 1GQ9A 2WAWA 5C48A 1FR8A 2Y7AA 1H7QA 1WT3A 1ZHJA 1EZIA 2YCMA 4FIYA 4HOCA 4D48A 2VXLA 2AESA 4Y6NA 4B42A 4FCUA 2GGQA 4KRVA 1ZJ3A 3D8VA 4O6NA 1ZDGA 1G2VA 4NAKA 1G1LA 5C4BA 3Q80A 2OI6A 4E1KA 1MP4A 1TVYA 4L41C 1EYRA 1VPAA 4D0ZA 2FYBA 1JVDA 1V82A 2XWMA 4B5BA 5DDVA 2FFUA 4CJCA 1XHBA 3TZTA 5CMIA 1R7TA 2JCOA 3SX5A 4AYJA 1H5SD 1FO9A 4ASJA 3V0OA 2VFZA 4G3SA 4EVWA 1G8OA 4FRHA 2Y4JA 2FFVA 5BXCA 1QWJA 2PX7A 2RIYA 3I0CA 1OMZA 1ON6A 2FYAA 2OI5A 1LZ0A 2AM4A 1WT1A 3ZLKA 5CQNX 5L6SA 3F1CA 4IRQA 4Y63A 3E26A 3I0EA 2C0NA 1LZ7A 2WE9A 4Y7GA 3OH1A 5CMGX 1ZI1A 2XMHA 5I1FA 2RJ1A 1ZJ2A 3I0HA 1W77A 3O3PA 2YQJA 4EEOA 1NF5B 4JISA 5C4CA 2P6WA 2YQSA 3I0DA 1R82A 2X5ZA 5CQOA 4FRDA 4D11A 4JD0A 2RJ9A 5CQMX 1FXOA 1V83A 1VZUA 1TZFA 4KQLA 4Y9XA 1ON8A 3R3IA 1ZCYA 2YQHA 4G3QA 5JQQA 2JCLA 2PGYA 4FRPA 4Y7TA 1VH3A 4FQWA 2RITA 4AC3A 1ZIZA 5AJNA 1HJJA 3ZGGA 3D5NA 3V0QA 2VS4A 4KPXA 4CJBA 4B2XA 3SPTA 2Y4LA 4FRAA 4MIXA 4FRQA 3SXDA 2PGVA 3K8DA 1ZI4A 1OMXA 2V0IA 1HJLA 3T7MA 1VGZA 5C47A 4HO2A 1H4EA 1H5TB 5CQPA 5FTVA 1R7YA 2WEEA 3Q4SA 2D7RA 1QGQA 2O1FA 2XWLA 2VSHA 2RJ5A 2VSIA 1GWWA 5CQLX 1O7OA 3U2UA 5CMFX 2RJ0A 2BO4A 3NGWA 2UX8A 2DPWA 1H7LA 4FCEA 4MYBA 2Y6PA 1R7VA 3ZLLA 2BO6A 4AYLA 2FYCB 1R80A 1O23B 5C1GA 1ZI5A 4M2AA 1H5SC 1QGSA 1H5RB 2O1HA 1W57A 4NANA 3EE5A 3U0YA 4FRLA 1FOAA 2VD4A 1MP3A 4NAIA 3GUEA 4XWIA 3SXBA 1H7HA 1Z90A 4GBPA 5C4EA 1I52A 3CU0A 1FGGA 3CKNA 1ZJ1A 4FIXA 4HO8A 1FXJA 1ZDFA 1WT0A 3N9WA 4FRBA 4ARWA 2AH9A 4B3UA 3T7OA 2I5EA 1YP3A 2ICXA 3CKJA 3OC9A 1H7FA 3R2WA 3SXGA 1VM8A 1MP5A 2Y4MA 4BMAA 4HO0A 1VH1A 2W0VA 4B2WA 1IIMA 1W55A 2I7BA 1LZJA 2VS3A 5C3AA 1H4DA 3LW6A 3OGZA 1HM0A 2XWNA 4KC4A 2J0BA 3V8ZA 3SX3A 4K6RA 1H4CA 4Y7VA 4Y6UA 1GX0A 2AM5A 1K4VA 3SXCA 3BCVA 4EE4A 3I0GA 5FYEA 3I0IX 4KT7A 4M28A 3U0XA 4HCQA 5J49A 1PZTA 2RJ6A 5CMJA 2BO8A 1YP2A 2YQCA 1WT2A 1GX4A 1ZCUA 2P72A 2XMEA 1ZCTA 1R7XA 4EE3A 4Y64A 1G3LA 2OI7A 4CJ8A 5D92A 1HM8A 2V0JA 1O7QA 5IFYA 2Q4JA 5C3DA 3FWWA 1FG5N 4P02A 2NXVA 1VZXA 3T7NA 2E8BA 1YROB 5IDTA 2WGZA 5CMHA 3JUKA 4EEMA 4J18A 5AJOA 5C3BA 1SS9A 2WVLA 1NHEB 1ZJ0A 3PKPA 1R81A 2QKXA 3RMWA 5C1LA 2JCJA 3V90A 5C4FA 1O0RA 4R7PA 5DDTA 1H7TA 4M4KA 3SXAA 2WVKA 1QG8A 1H5TA 5FV9A 3PNNA 2W0WA 3OKRA 1ZI3A 4HO6A 3RMVA 2I5KA 5FU8A 4HO3A 2RJ4A 4KNRA 1JV3A 2OEGA 3HL3A 2Z86A 5C1HA 3V0MA 3V0LA 1GA8A 5C36A 4LW6A 3DK5A 2D0JA 4B4BA 1NWGB 4Q7CA 4EEAA 1S4NA 4ECMA 1JVGA 1WSZA 5C38A 4DECA 4P00A 3USQA 3DUVA 4DE7A 1G97A 4MNDA 1H5RA 1G93A 1LL2A 4FRMA 1VICA 5FUHA 3OH3A 5EJ1A 3SX8A 1JYKA 2YC5A 2A8UA 4ZDQA 2QGIA 3I0LA 1VGTA 3I0JA 1KWSA 4EEGA 3TQDA 2RIZA 3U2VA 2RIXA 2ZU7A 1H5SB 1XZ6A 5FU0A 3BRKX 2APCA 3ZF8A 2P73A 2X5SA 5AJPA 1H7GA 3F1YA 3QVBA
chains in the Genus database with same CATH topology
1ZJOA 5HS2A 5EIYA 4G87A 4HO5A 3RSBA 1NQIB 4FREA 2D7IA 1VGUA 3CKOA 3OAMA 2X60A 2V0LA 1GQCA 3V0NA 4KC1A 2FY7A 4B4GA 4Y62A 1OQMB 2RJ8A 3V0PA 1G0RA 1VZTA 1H3MA 5FTSA 3JUJA 2ZU8A 4HO9A 4LW3A 3SXEA 3IOJA 2V0HA 2ICYA 2AE7A 2YC3A 2X65A 3FOQA 1LL0A 3U2TA 1FGXA 2VXMA 4EE5A 2BO7A 1FZWA 5IDSA 3CGXA 4IRPA 1YP4A 2O1GA 4KPZA 1R7UA 4HG6A 1TW1A 2A8WA 4G3PA 2VK9A 4B4MA 3V8YA 2YESA 3SX7A 3OH0A 1FO8A 3IOIA 3D98A 3ZGFA 2OEFA 2AM3A 5D91A 1TW5A 2RJ7A 3USRA 3I0FA 1HV9A 2Z87A 1HM9A 2CU2A 1NMMB 1ZCVA 3E25A 3ST8A 1JV1A 3CKVA 4KXOA 1ZJPA 4FROA 2Y4KA 5C49A 1FRWA 4BQHA 1G95A 3KIAA 3CKQA 2J0AA 2JCKA 2WVMA 4NALA 1V84A 3V91A 4KNXA 4HO4A 1LVWA 4D11C 3U2WA 2GGOA 1MC3A 3IOHA 2FYDB 2ZU9A 4UEGA 5C8RA 1E5KA 1LL3A 5EJZA 3K8EA 4DDZA 3POLA 1G9RA 1H7EA 3OH4A 4CVHA 2MZBA 3I0KA 3Q7UA 2VS5A 2PA4A 3JTJA 4Y7FA 1INJA 2AGDA 2V0KA 4C2SA 5C4DA 4ASYA 3OH2A 4AAWA 4M2BA 1S4PA 1PZYB 5L6VA 1NKHB 1INIA 1WVCA 2E3DA 1H5SA 1JYLA 3DJ4A 1FWYA 3PKQA 1G23A 1LZIA 4Y7UA 2QH5A 4YS8A 3U2XA 4D0TA 4KC2A 4O6MA 1IINA 1S4OA 1GWVA 2AECA 1FR9A 1VGWA 1GQ9A 2WAWA 5C48A 1FR8A 2Y7AA 1H7QA 1WT3A 1ZHJA 1EZIA 2YCMA 4FIYA 4HOCA 4D48A 2VXLA 2AESA 4Y6NA 4B42A 4FCUA 2GGQA 4KRVA 1ZJ3A 3D8VA 4O6NA 1ZDGA 1G2VA 4NAKA 1G1LA 5C4BA 3Q80A 2OI6A 4E1KA 1MP4A 1TVYA 4L41C 1EYRA 1VPAA 4D0ZA 2FYBA 1JVDA 1V82A 2XWMA 4B5BA 5DDVA 2FFUA 4CJCA 1XHBA 3TZTA 5CMIA 1R7TA 2JCOA 3SX5A 4AYJA 1H5SD 1FO9A 4ASJA 3V0OA 2VFZA 4G3SA 4EVWA 1G8OA 4FRHA 2Y4JA 2FFVA 5BXCA 1QWJA 2PX7A 2RIYA 3I0CA 1OMZA 1ON6A 2FYAA 2OI5A 1LZ0A 2AM4A 1WT1A 3ZLKA 5CQNX 5L6SA 3F1CA 4IRQA 4Y63A 3E26A 3I0EA 2C0NA 1LZ7A 2WE9A 4Y7GA 3OH1A 5CMGX 1ZI1A 2XMHA 5I1FA 2RJ1A 1ZJ2A 3I0HA 1W77A 3O3PA 2YQJA 4EEOA 1NF5B 4JISA 5C4CA 2P6WA 2YQSA 3I0DA 1R82A 2X5ZA 5CQOA 4FRDA 4D11A 4JD0A 2RJ9A 5CQMX 1FXOA 1V83A 1VZUA 1TZFA 4KQLA 4Y9XA 1ON8A 3R3IA 1ZCYA 2YQHA 4G3QA 5JQQA 2JCLA 2PGYA 4FRPA 4Y7TA 1VH3A 4FQWA 2RITA 4AC3A 1ZIZA 5AJNA 1HJJA 3ZGGA 3D5NA 3V0QA 2VS4A 4KPXA 4CJBA 4B2XA 3SPTA 2Y4LA 4FRAA 4MIXA 4FRQA 3SXDA 2PGVA 3K8DA 1ZI4A 1OMXA 2V0IA 1HJLA 3T7MA 1VGZA 5C47A 4HO2A 1H4EA 1H5TB 5CQPA 5FTVA 1R7YA 2WEEA 3Q4SA 2D7RA 1QGQA 2O1FA 2XWLA 2VSHA 2RJ5A 2VSIA 1GWWA 5CQLX 1O7OA 3U2UA 5CMFX 2RJ0A 2BO4A 3NGWA 2UX8A 2DPWA 1H7LA 4FCEA 4MYBA 2Y6PA 1R7VA 3ZLLA 2BO6A 4AYLA 2FYCB 1R80A 1O23B 5C1GA 1ZI5A 4M2AA 1H5SC 1QGSA 1H5RB 2O1HA 1W57A 4NANA 3EE5A 3U0YA 4FRLA 1FOAA 2VD4A 1MP3A 4NAIA 3GUEA 4XWIA 3SXBA 1H7HA 1Z90A 4GBPA 5C4EA 1I52A 3CU0A 1FGGA 3CKNA 1ZJ1A 4FIXA 4HO8A 1FXJA 1ZDFA 1WT0A 3N9WA 4FRBA 4ARWA 2AH9A 4B3UA 3T7OA 2I5EA 1YP3A 2ICXA 3CKJA 3OC9A 1H7FA 3R2WA 3SXGA 1VM8A 1MP5A 2Y4MA 4BMAA 4HO0A 1VH1A 2W0VA 4B2WA 1IIMA 1W55A 2I7BA 1LZJA 2VS3A 5C3AA 1H4DA 3LW6A 3OGZA 1HM0A 2XWNA 4KC4A 2J0BA 3V8ZA 3SX3A 4K6RA 1H4CA 4Y7VA 4Y6UA 1GX0A 2AM5A 1K4VA 3SXCA 3BCVA 4EE4A 3I0GA 5FYEA 3I0IX 4KT7A 4M28A 3U0XA 4HCQA 5J49A 1PZTA 2RJ6A 5CMJA 2BO8A 1YP2A 2YQCA 1WT2A 1GX4A 1ZCUA 2P72A 2XMEA 1ZCTA 1R7XA 4EE3A 4Y64A 1G3LA 2OI7A 4CJ8A 5D92A 1HM8A 2V0JA 1O7QA 5IFYA 2Q4JA 5C3DA 3FWWA 1FG5N 4P02A 2NXVA 1VZXA 3T7NA 2E8BA 1YROB 5IDTA 2WGZA 5CMHA 3JUKA 4EEMA 4J18A 5AJOA 5C3BA 1SS9A 2WVLA 1NHEB 1ZJ0A 3PKPA 1R81A 2QKXA 3RMWA 5C1LA 2JCJA 3V90A 5C4FA 1O0RA 4R7PA 5DDTA 1H7TA 4M4KA 3SXAA 2WVKA 1QG8A 1H5TA 5FV9A 3PNNA 2W0WA 3OKRA 1ZI3A 4HO6A 3RMVA 2I5KA 5FU8A 4HO3A 2RJ4A 4KNRA 1JV3A 2OEGA 3HL3A 2Z86A 5C1HA 3V0MA 3V0LA 1GA8A 5C36A 4LW6A 3DK5A 2D0JA 4B4BA 1NWGB 4Q7CA 4EEAA 1S4NA 4ECMA 1JVGA 1WSZA 5C38A 4DECA 4P00A 3USQA 3DUVA 4DE7A 1G97A 4MNDA 1H5RA 1G93A 1LL2A 4FRMA 1VICA 5FUHA 3OH3A 5EJ1A 3SX8A 1JYKA 2YC5A 2A8UA 4ZDQA 2QGIA 3I0LA 1VGTA 3I0JA 1KWSA 4EEGA 3TQDA 2RIZA 3U2VA 2RIXA 2ZU7A 1H5SB 1XZ6A 5FU0A 3BRKX 2APCA 3ZF8A 2P73A 2X5SA 5AJPA 1H7GA 3F1YA 3QVBA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1ZJO A;  5HS2 A;  5EIY A;  4G87 A;  4HO5 A;  3RSB A;  1NQI B;  4FRE A;  2D7I A;  1VGU A;  3CKO A;  3OAM A;  2X60 A;  2V0L A;  1GQC A;  3V0N A;  4KC1 A;  2FY7 A;  4B4G A;  4Y62 A;  1OQM B;  2RJ8 A;  3V0P A;  1G0R A;  1VZT A;  1H3M A;  5FTS A;  3JUJ A;  2ZU8 A;  4HO9 A;  4LW3 A;  3SXE A;  3IOJ A;  2V0H A;  2ICY A;  2AE7 A;  2YC3 A;  2X65 A;  3FOQ A;  1LL0 A;  3U2T A;  1FGX A;  2VXM A;  4EE5 A;  2BO7 A;  1FZW A;  5IDS A;  3CGX A;  4IRP A;  1YP4 A;  2O1G A;  4KPZ A;  1R7U A;  4HG6 A;  1TW1 A;  2A8W A;  4G3P A;  4B4M A;  3V8Y A;  2YES A;  3SX7 A;  3OH0 A;  1FO8 A;  3IOI A;  3D98 A;  3ZGF A;  2OEF A;  2AM3 A;  1TW5 A;  2RJ7 A;  3USR A;  3I0F A;  1HV9 A;  2Z87 A;  1HM9 A;  2CU2 A;  1NMM B;  1ZCV A;  3E25 A;  3ST8 A;  1JV1 A;  3CKV A;  4KXO A;  1ZJP A;  4FRO A;  2Y4K A;  5C49 A;  1FRW A;  4BQH A;  1G95 A;  3KIA A;  3CKQ A;  2JCK A;  4NAL A;  2WVM A;  1V84 A;  3V91 A;  4KNX A;  4HO4 A;  1LVW A;  4D11 C;  3U2W A;  2GGO A;  1MC3 A;  3IOH A;  2FYD B;  2ZU9 A;  4UEG A;  5C8R A;  1E5K A;  1LL3 A;  5EJZ A;  3K8E A;  4DDZ A;  3POL A;  1G9R A;  1H7E A;  3OH4 A;  4CVH A;  2MZB A;  3I0K A;  3Q7U A;  2VS5 A;  2PA4 A;  3JTJ A;  4Y7F A;  1INJ A;  2AGD A;  2V0K A;  4C2S A;  5C4D A;  4ASY A;  3OH2 A;  4AAW A;  4M2B A;  1S4P A;  1PZY B;  5L6V A;  1NKH B;  1INI A;  1WVC A;  2E3D A;  1H5S A;  1JYL A;  3DJ4 A;  1FWY A;  3PKQ A;  1G23 A;  1LZI A;  4Y7U A;  2QH5 A;  4YS8 A;  3U2X A;  4D0T A;  4KC2 A;  1IIN A;  1S4O A;  1GWV A;  2AEC A;  1FR9 A;  1VGW A;  1GQ9 A;  2WAW A;  5C48 A;  1FR8 A;  2Y7A A;  1H7Q A;  1WT3 A;  1ZHJ A;  1EZI A;  2YCM A;  4HOC A;  4D48 A;  2VXL A;  2AES A;  4Y6N A;  4B42 A;  4FCU A;  2GGQ A;  4KRV A;  1ZJ3 A;  3D8V A;  1ZDG A;  1G2V A;  4NAK A;  1G1L A;  5C4B A;  3Q80 A;  2OI6 A;  4E1K A;  1MP4 A;  1TVY A;  4L41 C;  1EYR A;  1VPA A;  4D0Z A;  2FYB A;  1JVD A;  1V82 A;  2XWM A;  4B5B A;  5DDV A;  2FFU A;  4CJC A;  1XHB A;  3TZT A;  5CMI A;  1R7T A;  2JCO A;  3SX5 A;  4AYJ A;  1H5S D;  1FO9 A;  4ASJ A;  3V0O A;  2VFZ A;  4G3S A;  4EVW A;  1G8O A;  4FRH A;  2Y4J A;  2FFV A;  5BXC A;  1QWJ A;  2PX7 A;  2RIY A;  3I0C A;  1OMZ A;  1ON6 A;  2FYA A;  2OI5 A;  1LZ0 A;  2AM4 A;  1WT1 A;  3ZLK A;  5CQN X;  5L6S A;  3F1C A;  4IRQ A;  4Y63 A;  3E26 A;  3I0E A;  1LZ7 A;  2WE9 A;  4Y7G A;  3OH1 A;  5CMG X;  1ZI1 A;  2XMH A;  5I1F A;  2RJ1 A;  1ZJ2 A;  3I0H A;  1W77 A;  3O3P A;  2YQJ A;  4EEO A;  1NF5 B;  4JIS A;  5C4C A;  2P6W A;  2YQS A;  3I0D A;  1R82 A;  2X5Z A;  5CQO A;  4FRD A;  4D11 A;  4JD0 A;  2RJ9 A;  5CQM X;  1FXO A;  1V83 A;  1VZU A;  1TZF A;  4KQL A;  4Y9X A;  1ON8 A;  3R3I A;  1ZCY A;  2YQH A;  4G3Q A;  5JQQ A;  2JCL A;  2PGY A;  4FRP A;  4Y7T A;  1VH3 A;  4FQW A;  2RIT A;  4AC3 A;  1ZIZ A;  5AJN A;  1HJJ A;  3ZGG A;  3D5N A;  3V0Q A;  2VS4 A;  4KPX A;  4CJB A;  4B2X A;  3SPT A;  2Y4L A;  4FRA A;  4FRQ A;  3SXD A;  2PGV A;  3K8D A;  1ZI4 A;  1OMX A;  2V0I A;  1HJL A;  3T7M A;  1VGZ A;  5C47 A;  4HO2 A;  1H4E A;  1H5T B;  5CQP A;  5FTV A;  1R7Y A;  2WEE A;  3Q4S A;  2D7R A;  1QGQ A;  2O1F A;  2XWL A;  2VSH A;  2RJ5 A;  2VSI A;  1GWW A;  5CQL X;  1O7O A;  3U2U A;  5CMF X;  2RJ0 A;  2BO4 A;  3NGW A;  2UX8 A;  2DPW A;  1H7L A;  4FCE A;  4MYB A;  2Y6P A;  1R7V A;  3ZLL A;  2BO6 A;  4AYL A;  2FYC B;  1R80 A;  1O23 B;  5C1G A;  1ZI5 A;  4M2A A;  1H5S C;  1QGS A;  1H5R B;  2O1H A;  1W57 A;  4NAN A;  3EE5 A;  3U0Y A;  4FRL A;  1FOA A;  2VD4 A;  1MP3 A;  4NAI A;  3GUE A;  4XWI A;  3SXB A;  1H7H A;  1Z90 A;  4GBP A;  5C4E A;  1I52 A;  3CU0 A;  1FGG A;  3CKN A;  1ZJ1 A;  4HO8 A;  1FXJ A;  1ZDF A;  1WT0 A;  3N9W A;  4FRB A;  4ARW A;  2AH9 A;  4B3U A;  3T7O A;  2I5E A;  1YP3 A;  2ICX A;  3CKJ A;  3OC9 A;  1H7F A;  3R2W A;  3SXG A;  1VM8 A;  1MP5 A;  2Y4M A;  4BMA A;  4HO0 A;  1VH1 A;  2W0V A;  4B2W A;  1IIM A;  1W55 A;  2I7B A;  1LZJ A;  2VS3 A;  5C3A A;  1H4D A;  3LW6 A;  3OGZ A;  1HM0 A;  2XWN A;  4KC4 A;  3V8Z A;  3SX3 A;  4K6R A;  1H4C A;  4Y7V A;  4Y6U A;  1GX0 A;  2AM5 A;  1K4V A;  3SXC A;  3BCV A;  4EE4 A;  3I0G A;  5FYE A;  3I0I X;  4KT7 A;  4M28 A;  3U0X A;  4HCQ A;  5J49 A;  1PZT A;  2RJ6 A;  5CMJ A;  2BO8 A;  1YP2 A;  2YQC A;  1WT2 A;  1GX4 A;  1ZCU A;  2P72 A;  2XME A;  1ZCT A;  1R7X A;  4EE3 A;  4Y64 A;  1G3L A;  2OI7 A;  4CJ8 A;  1HM8 A;  2V0J A;  1O7Q A;  5IFY A;  2Q4J A;  5C3D A;  3FWW A;  1FG5 N;  4P02 A;  2NXV A;  1VZX A;  3T7N A;  2E8B A;  1YRO B;  5IDT A;  2WGZ A;  5CMH A;  3JUK A;  4EEM A;  4J18 A;  5AJO A;  5C3B A;  1SS9 A;  2WVL A;  1NHE B;  1ZJ0 A;  3PKP A;  1R81 A;  2QKX A;  3RMW A;  5C1L A;  2JCJ A;  3V90 A;  5C4F A;  1O0R A;  4R7P A;  5DDT A;  1H7T A;  4M4K A;  3SXA A;  2WVK A;  1QG8 A;  1H5T A;  5FV9 A;  3PNN A;  2W0W A;  3OKR A;  1ZI3 A;  4HO6 A;  3RMV A;  2I5K A;  5FU8 A;  4HO3 A;  2RJ4 A;  4KNR A;  1JV3 A;  2OEG A;  3HL3 A;  2Z86 A;  5C1H A;  3V0M A;  3V0L A;  1GA8 A;  5C36 A;  4LW6 A;  3DK5 A;  2D0J A;  4B4B A;  1NWG B;  5C38 A;  4EEA A;  1S4N A;  4ECM A;  1JVG A;  1WSZ A;  4DEC A;  4P00 A;  3USQ A;  3DUV A;  4DE7 A;  1G97 A;  4MND A;  1H5R A;  1G93 A;  1LL2 A;  4FRM A;  1VIC A;  5FUH A;  3OH3 A;  5EJ1 A;  3SX8 A;  1JYK A;  2YC5 A;  2A8U A;  4ZDQ A;  2QGI A;  3I0L A;  1VGT A;  3I0J A;  1KWS A;  4EEG A;  3TQD A;  2RIZ A;  3U2V A;  2RIX A;  2ZU7 A;  1H5S B;  1XZ6 A;  5FU0 A;  3BRK X;  2APC A;  3ZF8 A;  2P73 A;  2X5S A;  5AJP A;  1H7G A;  3F1Y A;  3QVB A; 
#chains in the Genus database with same CATH topology
 1ZJO A;  5HS2 A;  5EIY A;  4G87 A;  4HO5 A;  3RSB A;  1NQI B;  4FRE A;  2D7I A;  1VGU A;  3CKO A;  3OAM A;  2X60 A;  2V0L A;  1GQC A;  3V0N A;  4KC1 A;  2FY7 A;  4B4G A;  4Y62 A;  1OQM B;  2RJ8 A;  3V0P A;  1G0R A;  1VZT A;  1H3M A;  5FTS A;  3JUJ A;  2ZU8 A;  4HO9 A;  4LW3 A;  3SXE A;  3IOJ A;  2V0H A;  2ICY A;  2AE7 A;  2YC3 A;  2X65 A;  3FOQ A;  1LL0 A;  3U2T A;  1FGX A;  2VXM A;  4EE5 A;  2BO7 A;  1FZW A;  5IDS A;  3CGX A;  4IRP A;  1YP4 A;  2O1G A;  4KPZ A;  1R7U A;  4HG6 A;  1TW1 A;  2A8W A;  4G3P A;  2VK9 A;  4B4M A;  3V8Y A;  2YES A;  3SX7 A;  3OH0 A;  1FO8 A;  3IOI A;  3D98 A;  3ZGF A;  2OEF A;  2AM3 A;  5D91 A;  1TW5 A;  2RJ7 A;  3USR A;  3I0F A;  1HV9 A;  2Z87 A;  1HM9 A;  2CU2 A;  1NMM B;  1ZCV A;  3E25 A;  3ST8 A;  1JV1 A;  3CKV A;  4KXO A;  1ZJP A;  4FRO A;  2Y4K A;  5C49 A;  1FRW A;  4BQH A;  1G95 A;  3KIA A;  3CKQ A;  2J0A A;  2JCK A;  2WVM A;  4NAL A;  1V84 A;  3V91 A;  4KNX A;  4HO4 A;  1LVW A;  4D11 C;  3U2W A;  2GGO A;  1MC3 A;  3IOH A;  2FYD B;  2ZU9 A;  4UEG A;  5C8R A;  1E5K A;  1LL3 A;  5EJZ A;  3K8E A;  4DDZ A;  3POL A;  1G9R A;  1H7E A;  3OH4 A;  4CVH A;  2MZB A;  3I0K A;  3Q7U A;  2VS5 A;  2PA4 A;  3JTJ A;  4Y7F A;  1INJ A;  2AGD A;  2V0K A;  4C2S A;  5C4D A;  4ASY A;  3OH2 A;  4AAW A;  4M2B A;  1S4P A;  1PZY B;  5L6V A;  1NKH B;  1INI A;  1WVC A;  2E3D A;  1H5S A;  1JYL A;  3DJ4 A;  1FWY A;  3PKQ A;  1G23 A;  1LZI A;  4Y7U A;  2QH5 A;  4YS8 A;  3U2X A;  4D0T A;  4KC2 A;  4O6M A;  1IIN A;  1S4O A;  1GWV A;  2AEC A;  1FR9 A;  1VGW A;  1GQ9 A;  2WAW A;  5C48 A;  1FR8 A;  2Y7A A;  1H7Q A;  1WT3 A;  1ZHJ A;  1EZI A;  2YCM A;  4FIY A;  4HOC A;  4D48 A;  2VXL A;  2AES A;  4Y6N A;  4B42 A;  4FCU A;  2GGQ A;  4KRV A;  1ZJ3 A;  3D8V A;  4O6N A;  1ZDG A;  1G2V A;  4NAK A;  1G1L A;  5C4B A;  3Q80 A;  2OI6 A;  4E1K A;  1MP4 A;  1TVY A;  4L41 C;  1EYR A;  1VPA A;  4D0Z A;  2FYB A;  1JVD A;  1V82 A;  2XWM A;  4B5B A;  5DDV A;  2FFU A;  4CJC A;  1XHB A;  3TZT A;  5CMI A;  1R7T A;  2JCO A;  3SX5 A;  4AYJ A;  1H5S D;  1FO9 A;  4ASJ A;  3V0O A;  2VFZ A;  4G3S A;  4EVW A;  1G8O A;  4FRH A;  2Y4J A;  2FFV A;  5BXC A;  1QWJ A;  2PX7 A;  2RIY A;  3I0C A;  1OMZ A;  1ON6 A;  2FYA A;  2OI5 A;  1LZ0 A;  2AM4 A;  1WT1 A;  3ZLK A;  5CQN X;  5L6S A;  3F1C A;  4IRQ A;  4Y63 A;  3E26 A;  3I0E A;  2C0N A;  1LZ7 A;  2WE9 A;  4Y7G A;  3OH1 A;  5CMG X;  1ZI1 A;  2XMH A;  5I1F A;  2RJ1 A;  1ZJ2 A;  3I0H A;  1W77 A;  3O3P A;  2YQJ A;  4EEO A;  1NF5 B;  4JIS A;  5C4C A;  2P6W A;  2YQS A;  3I0D A;  1R82 A;  2X5Z A;  5CQO A;  4FRD A;  4D11 A;  4JD0 A;  2RJ9 A;  5CQM X;  1FXO A;  1V83 A;  1VZU A;  1TZF A;  4KQL A;  4Y9X A;  1ON8 A;  3R3I A;  1ZCY A;  2YQH A;  4G3Q A;  5JQQ A;  2JCL A;  2PGY A;  4FRP A;  4Y7T A;  1VH3 A;  4FQW A;  2RIT A;  4AC3 A;  1ZIZ A;  5AJN A;  1HJJ A;  3ZGG A;  3D5N A;  3V0Q A;  2VS4 A;  4KPX A;  4CJB A;  4B2X A;  3SPT A;  2Y4L A;  4FRA A;  4MIX A;  4FRQ A;  3SXD A;  2PGV A;  3K8D A;  1ZI4 A;  1OMX A;  2V0I A;  1HJL A;  3T7M A;  1VGZ A;  5C47 A;  4HO2 A;  1H4E A;  1H5T B;  5CQP A;  5FTV A;  1R7Y A;  2WEE A;  3Q4S A;  2D7R A;  1QGQ A;  2O1F A;  2XWL A;  2VSH A;  2RJ5 A;  2VSI A;  1GWW A;  5CQL X;  1O7O A;  3U2U A;  5CMF X;  2RJ0 A;  2BO4 A;  3NGW A;  2UX8 A;  2DPW A;  1H7L A;  4FCE A;  4MYB A;  2Y6P A;  1R7V A;  3ZLL A;  2BO6 A;  4AYL A;  2FYC B;  1R80 A;  1O23 B;  5C1G A;  1ZI5 A;  4M2A A;  1H5S C;  1QGS A;  1H5R B;  2O1H A;  1W57 A;  4NAN A;  3EE5 A;  3U0Y A;  4FRL A;  1FOA A;  2VD4 A;  1MP3 A;  4NAI A;  3GUE A;  4XWI A;  3SXB A;  1H7H A;  1Z90 A;  4GBP A;  5C4E A;  1I52 A;  3CU0 A;  1FGG A;  3CKN A;  1ZJ1 A;  4FIX A;  4HO8 A;  1FXJ A;  1ZDF A;  1WT0 A;  3N9W A;  4FRB A;  4ARW A;  2AH9 A;  4B3U A;  3T7O A;  2I5E A;  1YP3 A;  2ICX A;  3CKJ A;  3OC9 A;  1H7F A;  3R2W A;  3SXG A;  1VM8 A;  1MP5 A;  2Y4M A;  4BMA A;  4HO0 A;  1VH1 A;  2W0V A;  4B2W A;  1IIM A;  1W55 A;  2I7B A;  1LZJ A;  2VS3 A;  5C3A A;  1H4D A;  3LW6 A;  3OGZ A;  1HM0 A;  2XWN A;  4KC4 A;  2J0B A;  3V8Z A;  3SX3 A;  4K6R A;  1H4C A;  4Y7V A;  4Y6U A;  1GX0 A;  2AM5 A;  1K4V A;  3SXC A;  3BCV A;  4EE4 A;  3I0G A;  5FYE A;  3I0I X;  4KT7 A;  4M28 A;  3U0X A;  4HCQ A;  5J49 A;  1PZT A;  2RJ6 A;  5CMJ A;  2BO8 A;  1YP2 A;  2YQC A;  1WT2 A;  1GX4 A;  1ZCU A;  2P72 A;  2XME A;  1ZCT A;  1R7X A;  4EE3 A;  4Y64 A;  1G3L A;  2OI7 A;  4CJ8 A;  5D92 A;  1HM8 A;  2V0J A;  1O7Q A;  5IFY A;  2Q4J A;  5C3D A;  3FWW A;  1FG5 N;  4P02 A;  2NXV A;  1VZX A;  3T7N A;  2E8B A;  1YRO B;  5IDT A;  2WGZ A;  5CMH A;  3JUK A;  4EEM A;  4J18 A;  5AJO A;  5C3B A;  1SS9 A;  2WVL A;  1NHE B;  1ZJ0 A;  3PKP A;  1R81 A;  2QKX A;  3RMW A;  5C1L A;  2JCJ A;  3V90 A;  5C4F A;  1O0R A;  4R7P A;  5DDT A;  1H7T A;  4M4K A;  3SXA A;  2WVK A;  1QG8 A;  1H5T A;  5FV9 A;  3PNN A;  2W0W A;  3OKR A;  1ZI3 A;  4HO6 A;  3RMV A;  2I5K A;  5FU8 A;  4HO3 A;  2RJ4 A;  4KNR A;  1JV3 A;  2OEG A;  3HL3 A;  2Z86 A;  5C1H A;  3V0M A;  3V0L A;  1GA8 A;  5C36 A;  4LW6 A;  3DK5 A;  2D0J A;  4B4B A;  1NWG B;  4Q7C A;  4EEA A;  1S4N A;  4ECM A;  1JVG A;  1WSZ A;  5C38 A;  4DEC A;  4P00 A;  3USQ A;  3DUV A;  4DE7 A;  1G97 A;  4MND A;  1H5R A;  1G93 A;  1LL2 A;  4FRM A;  1VIC A;  5FUH A;  3OH3 A;  5EJ1 A;  3SX8 A;  1JYK A;  2YC5 A;  2A8U A;  4ZDQ A;  2QGI A;  3I0L A;  1VGT A;  3I0J A;  1KWS A;  4EEG A;  3TQD A;  2RIZ A;  3U2V A;  2RIX A;  2ZU7 A;  1H5S B;  1XZ6 A;  5FU0 A;  3BRK X;  2APC A;  3ZF8 A;  2P73 A;  2X5S A;  5AJP A;  1H7G A;  3F1Y A;  3QVB A; 
#chains in the Genus database with same CATH homology
 1ZJO A;  5HS2 A;  5EIY A;  4G87 A;  4HO5 A;  3RSB A;  1NQI B;  4FRE A;  2D7I A;  1VGU A;  3CKO A;  3OAM A;  2X60 A;  2V0L A;  1GQC A;  3V0N A;  4KC1 A;  2FY7 A;  4B4G A;  4Y62 A;  1OQM B;  2RJ8 A;  3V0P A;  1G0R A;  1VZT A;  1H3M A;  5FTS A;  3JUJ A;  2ZU8 A;  4HO9 A;  4LW3 A;  3SXE A;  3IOJ A;  2V0H A;  2ICY A;  2AE7 A;  2YC3 A;  2X65 A;  3FOQ A;  1LL0 A;  3U2T A;  1FGX A;  2VXM A;  4EE5 A;  2BO7 A;  1FZW A;  5IDS A;  3CGX A;  4IRP A;  1YP4 A;  2O1G A;  4KPZ A;  1R7U A;  4HG6 A;  1TW1 A;  2A8W A;  4G3P A;  2VK9 A;  4B4M A;  3V8Y A;  2YES A;  3SX7 A;  3OH0 A;  1FO8 A;  3IOI A;  3D98 A;  3ZGF A;  2OEF A;  2AM3 A;  5D91 A;  1TW5 A;  2RJ7 A;  3USR A;  3I0F A;  1HV9 A;  2Z87 A;  1HM9 A;  2CU2 A;  1NMM B;  1ZCV A;  3E25 A;  3ST8 A;  1JV1 A;  3CKV A;  4KXO A;  1ZJP A;  4FRO A;  2Y4K A;  5C49 A;  1FRW A;  4BQH A;  1G95 A;  3KIA A;  3CKQ A;  2J0A A;  2JCK A;  2WVM A;  4NAL A;  1V84 A;  3V91 A;  4KNX A;  4HO4 A;  1LVW A;  4D11 C;  3U2W A;  2GGO A;  1MC3 A;  3IOH A;  2FYD B;  2ZU9 A;  4UEG A;  5C8R A;  1E5K A;  1LL3 A;  5EJZ A;  3K8E A;  4DDZ A;  3POL A;  1G9R A;  1H7E A;  3OH4 A;  4CVH A;  2MZB A;  3I0K A;  3Q7U A;  2VS5 A;  2PA4 A;  3JTJ A;  4Y7F A;  1INJ A;  2AGD A;  2V0K A;  4C2S A;  5C4D A;  4ASY A;  3OH2 A;  4AAW A;  4M2B A;  1S4P A;  1PZY B;  5L6V A;  1NKH B;  1INI A;  1WVC A;  2E3D A;  1H5S A;  1JYL A;  3DJ4 A;  1FWY A;  3PKQ A;  1G23 A;  1LZI A;  4Y7U A;  2QH5 A;  4YS8 A;  3U2X A;  4D0T A;  4KC2 A;  4O6M A;  1IIN A;  1S4O A;  1GWV A;  2AEC A;  1FR9 A;  1VGW A;  1GQ9 A;  2WAW A;  5C48 A;  1FR8 A;  2Y7A A;  1H7Q A;  1WT3 A;  1ZHJ A;  1EZI A;  2YCM A;  4FIY A;  4HOC A;  4D48 A;  2VXL A;  2AES A;  4Y6N A;  4B42 A;  4FCU A;  2GGQ A;  4KRV A;  1ZJ3 A;  3D8V A;  4O6N A;  1ZDG A;  1G2V A;  4NAK A;  1G1L A;  5C4B A;  3Q80 A;  2OI6 A;  4E1K A;  1MP4 A;  1TVY A;  4L41 C;  1EYR A;  1VPA A;  4D0Z A;  2FYB A;  1JVD A;  1V82 A;  2XWM A;  4B5B A;  5DDV A;  2FFU A;  4CJC A;  1XHB A;  3TZT A;  5CMI A;  1R7T A;  2JCO A;  3SX5 A;  4AYJ A;  1H5S D;  1FO9 A;  4ASJ A;  3V0O A;  2VFZ A;  4G3S A;  4EVW A;  1G8O A;  4FRH A;  2Y4J A;  2FFV A;  5BXC A;  1QWJ A;  2PX7 A;  2RIY A;  3I0C A;  1OMZ A;  1ON6 A;  2FYA A;  2OI5 A;  1LZ0 A;  2AM4 A;  1WT1 A;  3ZLK A;  5CQN X;  5L6S A;  3F1C A;  4IRQ A;  4Y63 A;  3E26 A;  3I0E A;  2C0N A;  1LZ7 A;  2WE9 A;  4Y7G A;  3OH1 A;  5CMG X;  1ZI1 A;  2XMH A;  5I1F A;  2RJ1 A;  1ZJ2 A;  3I0H A;  1W77 A;  3O3P A;  2YQJ A;  4EEO A;  1NF5 B;  4JIS A;  5C4C A;  2P6W A;  2YQS A;  3I0D A;  1R82 A;  2X5Z A;  5CQO A;  4FRD A;  4D11 A;  4JD0 A;  2RJ9 A;  5CQM X;  1FXO A;  1V83 A;  1VZU A;  1TZF A;  4KQL A;  4Y9X A;  1ON8 A;  3R3I A;  1ZCY A;  2YQH A;  4G3Q A;  5JQQ A;  2JCL A;  2PGY A;  4FRP A;  4Y7T A;  1VH3 A;  4FQW A;  2RIT A;  4AC3 A;  1ZIZ A;  5AJN A;  1HJJ A;  3ZGG A;  3D5N A;  3V0Q A;  2VS4 A;  4KPX A;  4CJB A;  4B2X A;  3SPT A;  2Y4L A;  4FRA A;  4MIX A;  4FRQ A;  3SXD A;  2PGV A;  3K8D A;  1ZI4 A;  1OMX A;  2V0I A;  1HJL A;  3T7M A;  1VGZ A;  5C47 A;  4HO2 A;  1H4E A;  1H5T B;  5CQP A;  5FTV A;  1R7Y A;  2WEE A;  3Q4S A;  2D7R A;  1QGQ A;  2O1F A;  2XWL A;  2VSH A;  2RJ5 A;  2VSI A;  1GWW A;  5CQL X;  1O7O A;  3U2U A;  5CMF X;  2RJ0 A;  2BO4 A;  3NGW A;  2UX8 A;  2DPW A;  1H7L A;  4FCE A;  4MYB A;  2Y6P A;  1R7V A;  3ZLL A;  2BO6 A;  4AYL A;  2FYC B;  1R80 A;  1O23 B;  5C1G A;  1ZI5 A;  4M2A A;  1H5S C;  1QGS A;  1H5R B;  2O1H A;  1W57 A;  4NAN A;  3EE5 A;  3U0Y A;  4FRL A;  1FOA A;  2VD4 A;  1MP3 A;  4NAI A;  3GUE A;  4XWI A;  3SXB A;  1H7H A;  1Z90 A;  4GBP A;  5C4E A;  1I52 A;  3CU0 A;  1FGG A;  3CKN A;  1ZJ1 A;  4FIX A;  4HO8 A;  1FXJ A;  1ZDF A;  1WT0 A;  3N9W A;  4FRB A;  4ARW A;  2AH9 A;  4B3U A;  3T7O A;  2I5E A;  1YP3 A;  2ICX A;  3CKJ A;  3OC9 A;  1H7F A;  3R2W A;  3SXG A;  1VM8 A;  1MP5 A;  2Y4M A;  4BMA A;  4HO0 A;  1VH1 A;  2W0V A;  4B2W A;  1IIM A;  1W55 A;  2I7B A;  1LZJ A;  2VS3 A;  5C3A A;  1H4D A;  3LW6 A;  3OGZ A;  1HM0 A;  2XWN A;  4KC4 A;  2J0B A;  3V8Z A;  3SX3 A;  4K6R A;  1H4C A;  4Y7V A;  4Y6U A;  1GX0 A;  2AM5 A;  1K4V A;  3SXC A;  3BCV A;  4EE4 A;  3I0G A;  5FYE A;  3I0I X;  4KT7 A;  4M28 A;  3U0X A;  4HCQ A;  5J49 A;  1PZT A;  2RJ6 A;  5CMJ A;  2BO8 A;  1YP2 A;  2YQC A;  1WT2 A;  1GX4 A;  1ZCU A;  2P72 A;  2XME A;  1ZCT A;  1R7X A;  4EE3 A;  4Y64 A;  1G3L A;  2OI7 A;  4CJ8 A;  5D92 A;  1HM8 A;  2V0J A;  1O7Q A;  5IFY A;  2Q4J A;  5C3D A;  3FWW A;  1FG5 N;  4P02 A;  2NXV A;  1VZX A;  3T7N A;  2E8B A;  1YRO B;  5IDT A;  2WGZ A;  5CMH A;  3JUK A;  4EEM A;  4J18 A;  5AJO A;  5C3B A;  1SS9 A;  2WVL A;  1NHE B;  1ZJ0 A;  3PKP A;  1R81 A;  2QKX A;  3RMW A;  5C1L A;  2JCJ A;  3V90 A;  5C4F A;  1O0R A;  4R7P A;  5DDT A;  1H7T A;  4M4K A;  3SXA A;  2WVK A;  1QG8 A;  1H5T A;  5FV9 A;  3PNN A;  2W0W A;  3OKR A;  1ZI3 A;  4HO6 A;  3RMV A;  2I5K A;  5FU8 A;  4HO3 A;  2RJ4 A;  4KNR A;  1JV3 A;  2OEG A;  3HL3 A;  2Z86 A;  5C1H A;  3V0M A;  3V0L A;  1GA8 A;  5C36 A;  4LW6 A;  3DK5 A;  2D0J A;  4B4B A;  1NWG B;  4Q7C A;  4EEA A;  1S4N A;  4ECM A;  1JVG A;  1WSZ A;  5C38 A;  4DEC A;  4P00 A;  3USQ A;  3DUV A;  4DE7 A;  1G97 A;  4MND A;  1H5R A;  1G93 A;  1LL2 A;  4FRM A;  1VIC A;  5FUH A;  3OH3 A;  5EJ1 A;  3SX8 A;  1JYK A;  2YC5 A;  2A8U A;  4ZDQ A;  2QGI A;  3I0L A;  1VGT A;  3I0J A;  1KWS A;  4EEG A;  3TQD A;  2RIZ A;  3U2V A;  2RIX A;  2ZU7 A;  1H5S B;  1XZ6 A;  5FU0 A;  3BRK X;  2APC A;  3ZF8 A;  2P73 A;  2X5S A;  5AJP A;  1H7G A;  3F1Y A;  3QVB A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...